Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I08591g51750916820.0
YER158C573791541e-10
YDR085C (AFR1)620811245e-07
KLLA0C11891g617291023e-04
Kwal_56.2338065560996e-04
Scas_459.1*64829989e-04
Scas_636.8d43373910.005
AGR154C62829870.018
CAGL0J07480g97672657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I08591g
         (509 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I08591g complement(837496..839049) some similarities with s...   652   0.0  
YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein...    64   1e-10
YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein inv...    52   5e-07
KLLA0C11891g complement(1021360..1023213) some similarities with...    44   3e-04
Kwal_56.23380                                                          43   6e-04
Scas_459.1*                                                            42   9e-04
Scas_636.8d                                                            40   0.005
AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -...    38   0.018
CAGL0J07480g complement(720484..723414) similar to sp|P53858 Sac...    30   7.4  

>CAGL0I08591g complement(837496..839049) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c, hypothetical
           start
          Length = 517

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/509 (68%), Positives = 351/509 (68%)

Query: 1   MSVQGVSLTRSNSYRRLLTQDQMDLRQSIMVGDIAVVVXXXXXXXXXXXXXXXXXXXXXX 60
           MSVQGVSLTRSNSYRRLLTQDQMDLRQSIMVGDIAVVV                      
Sbjct: 1   MSVQGVSLTRSNSYRRLLTQDQMDLRQSIMVGDIAVVVPERRSPERRSPERPERPERPER 60

Query: 61  XXXXXXXXXXQRYERDREKVPSQNVRREPRITRSKTINVGSDSVRKKALQNSQKQNMLNA 120
                     QRYERDREKVPSQNVRREPRITRSKTINVGSDSVRKKALQNSQKQNMLNA
Sbjct: 61  SERFERHEPRQRYERDREKVPSQNVRREPRITRSKTINVGSDSVRKKALQNSQKQNMLNA 120

Query: 121 PAHKKVPXXXXXXXXXXXXXXXXXXXXXXXXRSKSVTASNIGKTYSXXXXXXXXXXXXXX 180
           PAHKKVP                        RSKSVTASNIGKTYS              
Sbjct: 121 PAHKKVPQNYYMQPHYQQQQQQMRQAYPAIQRSKSVTASNIGKTYSDRGREHGREHEREH 180

Query: 181 XXXXXXXXXLSRRHSHVYRAPQVEDRRAVETPTVSAYQLQKQKMKHSFKFENGEVFTPRR 240
                    LSRRHSHVYRAPQVEDRRAVETPTVSAYQLQKQKMKHSFKFENGEVFTPRR
Sbjct: 181 ERERDRQHELSRRHSHVYRAPQVEDRRAVETPTVSAYQLQKQKMKHSFKFENGEVFTPRR 240

Query: 241 ELQAAKNPQEKINPYAYKXXXXXXXXXXXXXXXXXXXXXXVGSINFQKRPAVSPIXXXXX 300
           ELQAAKNPQEKINPYAYK                      VGSINFQKRPAVSPI     
Sbjct: 241 ELQAAKNPQEKINPYAYKDKSSASSIHSDLSDDEDEFDLSVGSINFQKRPAVSPIKAKPK 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXDAEQPPKKLFIAEPKVEQKPATQPPEIKVSEPAP 360
                                     DAEQPPKKLFIAEPKVEQKPATQPPEIKVSEPAP
Sbjct: 301 AKEPVVKEKKKFGSFFKSIWKSKSLSDAEQPPKKLFIAEPKVEQKPATQPPEIKVSEPAP 360

Query: 361 KKNPIDEIYDRLVVQWEKVTFIPPDELETXXXXXXXXXXXLINFYLPXXXXXXXXXXXXX 420
           KKNPIDEIYDRLVVQWEKVTFIPPDELET           LINFYLP             
Sbjct: 361 KKNPIDEIYDRLVVQWEKVTFIPPDELETIRSISSSDRSSLINFYLPNLSSTSLSSNGNS 420

Query: 421 XXFASAVRKDMMSTMNKKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDS 480
             FASAVRKDMMSTMNKKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDS
Sbjct: 421 TSFASAVRKDMMSTMNKKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDS 480

Query: 481 SANTTTQKPEIKQEINEFKKNEMVVHEKS 509
           SANTTTQKPEIKQEINEFKKNEMVVHEKS
Sbjct: 481 SANTTTQKPEIKQEINEFKKNEMVVHEKS 509

>YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein of
           unknown function [1722 bp, 573 aa]
          Length = 573

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 6/79 (7%)

Query: 437 KKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIE------VGGSTSSGNDSSANTTTQKPE 490
           K LRF++E+ + DTW+   Y R +++FL+NF +         ST  GN+ S+       E
Sbjct: 487 KSLRFADEIYVNDTWSAADYCRCDNTFLNNFFKGKSQDITNPSTFVGNNLSSTKNISNIE 546

Query: 491 IKQEINEFKKNEMVVHEKS 509
           IK E+NEFK+ EM VH+ S
Sbjct: 547 IKMEVNEFKRKEMRVHQDS 565

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 24/29 (82%)

Query: 214 VSAYQLQKQKMKHSFKFENGEVFTPRREL 242
           ++ +QLQ+++MK +F+F NGE FTPR ++
Sbjct: 177 LTPFQLQRKQMKSAFQFPNGENFTPRNQI 205

>YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein
           involved in morphogenesis of the mating projection
           (shmoo) [1863 bp, 620 aa]
          Length = 620

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 16/81 (19%)

Query: 435 MNKKLRFSNEVLLTDTWAPEVYERSNDSFLDN------FIEVGGSTSSGNDSSANTTTQK 488
           + K +RF+ EV L  TW+   YER+N  F+ N       ++V  S +S  +         
Sbjct: 542 IKKDVRFAKEVCLASTWSSNAYERANPEFIMNRHRLLWMMKVHPSMNSAMN--------- 592

Query: 489 PEIKQEINEFKKNEMVVHEKS 509
            EIK E+N +KKNEMVVHE S
Sbjct: 593 -EIKLELNSYKKNEMVVHENS 612

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 214 VSAYQLQKQKMKHSFKFENGEVFTPR 239
           ++ YQLQ+ KMK SF+F NGE++ P+
Sbjct: 127 LTPYQLQRSKMKRSFQFPNGEIYKPK 152

>KLLA0C11891g complement(1021360..1023213) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c singleton,
           hypothetical start
          Length = 617

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 23/29 (79%)

Query: 214 VSAYQLQKQKMKHSFKFENGEVFTPRREL 242
           ++ YQ+Q+  MK SF+F NGE FTPRR+L
Sbjct: 78  LTPYQIQRSHMKQSFQFPNGESFTPRRQL 106

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 39/73 (53%), Gaps = 12/73 (16%)

Query: 437 KKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEIN 496
           KK RF+ E+ + DT++P  Y RS+ +F ++  ++  S                 IK E+N
Sbjct: 549 KKCRFNEEIYVNDTFSPTEYLRSDKAFPESRKQLSKSRYIDG------------IKMELN 596

Query: 497 EFKKNEMVVHEKS 509
           EFKK EM+VH  S
Sbjct: 597 EFKKREMLVHPNS 609

>Kwal_56.23380
          Length = 655

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 10/60 (16%)

Query: 196 HVYRAPQVEDRRAV-----ETPT-----VSAYQLQKQKMKHSFKFENGEVFTPRRELQAA 245
           HV+ +PQ  +  ++     + PT     ++ YQ Q+++MK+SF+F NGE FTPR++  AA
Sbjct: 61  HVFSSPQPNNSLSLIPEQQQVPTHLLHSLTPYQKQRRRMKNSFQFPNGESFTPRQKSVAA 120

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 31/87 (35%)

Query: 434 TMNKKLRFSNEVLLTDTWAPEVYERSNDSFLDN-----------FIEVGGSTSSGNDSSA 482
           T  KKLRFS  V + DT+A   YERS+  F+             +IE             
Sbjct: 581 TAGKKLRFSTAVYVKDTYAAAEYERSDKKFIRTRRRMMQTKNMAYIEA------------ 628

Query: 483 NTTTQKPEIKQEINEFKKNEMVVHEKS 509
                   +  ++N+FKK EM VH  S
Sbjct: 629 --------VTSQLNQFKKGEMKVHGAS 647

>Scas_459.1*
          Length = 648

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 23/29 (79%)

Query: 214 VSAYQLQKQKMKHSFKFENGEVFTPRREL 242
           ++ YQLQK++MK SF+F NGE FTPR + 
Sbjct: 259 LTPYQLQKKQMKASFQFPNGESFTPRNQF 287

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 19/78 (24%)

Query: 439 LRFSNEVLLTDTWAPEVYERSNDS-------FLDNFIEVGGSTSSGNDSSANTTTQKPEI 491
           LRF+ E+ +++T++P  Y R++         + DN + + G                 EI
Sbjct: 575 LRFAKEITISETYSPFEYLRADPDTSTTKSLYGDNLVYLKGHGFIN------------EI 622

Query: 492 KQEINEFKKNEMVVHEKS 509
           K EIN++K+NEM VHE S
Sbjct: 623 KFEINQYKRNEMSVHEMS 640

>Scas_636.8d
          Length = 433

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 437 KKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEIN 496
           K +RF  ++ + DTW+P  YER   +   N  E+       +    N       IK+EIN
Sbjct: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHVFIDN-------IKREIN 412

Query: 497 EFKKNEMVVHEKS 509
            FK  EM VHE S
Sbjct: 413 YFKMYEMQVHEDS 425

>AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -
           SH] (1038731..1040617) [1887 bp, 628 aa]
          Length = 628

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%)

Query: 215 SAYQLQKQKMKHSFKFENGEVFTPRRELQ 243
           +AYQ  + +MK SF+F NGE FTPR +L+
Sbjct: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQLR 91

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 437 KKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEIN 496
           K++ FS+ + + DT++   Y RS+  FL    ++         +SA+       +K E+N
Sbjct: 556 KRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLM--------TSAHGLPFVQAVKWELN 607

Query: 497 EFKKNEMVVHEKS 509
           E+K++EM+VH +S
Sbjct: 608 EYKRHEMMVHPES 620

>CAGL0J07480g complement(720484..723414) similar to sp|P53858
           Saccharomyces cerevisiae YNL233w BNI4 bud neck involved,
           hypothetical start
          Length = 976

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 16/72 (22%)

Query: 438 KLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEINE 497
           K+ FS+E+LL +T+  E Y+R  D    N +               T      IK E+NE
Sbjct: 914 KVCFSSEILLFETYGEEEYDRRPDIATCNQL---------------TPQLAQMIKAELNE 958

Query: 498 FKKNEMVVHEKS 509
             K+EM +HE+S
Sbjct: 959 I-KDEMEIHEES 969

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,168,866
Number of extensions: 373424
Number of successful extensions: 1214
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1221
Number of HSP's successfully gapped: 22
Length of query: 509
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 403
Effective length of database: 12,926,601
Effective search space: 5209420203
Effective search space used: 5209420203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)