Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04312g95193749030.0
YGL167C (PMR1)95094338940.0
Kwal_14.149893993834830.0
AEL301W95794734680.0
KLLA0A03157g93893933480.0
CAGL0J01870g94689830480.0
Scas_707.48*74174429840.0
Kwal_23.3160110092110181e-121
CAGL0K12034g108710469621e-113
YDR040C (ENA1)10919279201e-107
AGL097C10969139201e-107
KLLA0F20658g10828999191e-107
YDR039C (ENA2)10919169191e-107
YDR038C (ENA5)10919169181e-107
KLLA0E14630g10828838981e-104
AFL011W124210167396e-82
CAGL0A00517g11229757041e-77
KLLA0A08910g12809556892e-75
YGL008C (PMA1)9187256052e-65
AGL085C9097246033e-65
Kwal_47.175228997275892e-63
KLLA0A09031g8997265831e-62
Scas_688.19137305831e-62
YPL036W (PMA2)9477245842e-62
Scas_710.419047255787e-62
CAGL0A00495g9027245371e-56
Kwal_47.1754712404885341e-55
YGL006W (PMC1)11734455251e-54
Scas_297.18002753892e-38
Scas_569.0d4681893693e-37
Scas_665.3014398553074e-28
KLLA0B08217g14398623065e-28
Kwal_26.920714699412888e-26
KLLA0F07447g9755952851e-25
CAGL0M11308g14527552852e-25
AFR567W14498692727e-24
YOR291W14728752573e-22
CAGL0L01419g12147192369e-20
Kwal_55.215759895912351e-19
YIL048W (NEO1)11517572234e-18
KLLA0C08393g11487532181e-17
YEL031W (SPF1)12156212135e-17
ADL079C11666772127e-17
CAGL0L00715g11446702092e-16
Sklu_2193.111437722073e-16
Scas_583.14*8754252036e-16
Kwal_23.578911337872002e-15
Scas_704.3811616871993e-15
AFR354C12106261903e-14
KLLA0E22352g12067071903e-14
Scas_615.99421781796e-13
ACR086C8101701751e-12
Kwal_26.707013154661714e-12
ADR350W13115891698e-12
YDR270W (CCC2)10041511698e-12
KLLA0A04015g13434591652e-11
CAGL0M08602g10121371563e-10
CAGL0G06270g13284651537e-10
YAL026C (DRS2)13554641502e-09
AGL041C12332101473e-09
KLLA0D04092g11522431456e-09
CAGL0L11814g15762711242e-06
YDR093W (DNF2)16122231232e-06
Scas_576.815912131223e-06
YBR295W (PCA1)12161781206e-06
AFL191W15751971188e-06
KLLA0E01650g15502401161e-05
Scas_669.316383231117e-05
Scas_636.1615542151091e-04
YER166W (DNF1)15711851081e-04
AGR120C15472791072e-04
CAGL0G08085g15781841072e-04
CAGL0H04477g16262411053e-04
Scas_89.12711811015e-04
KLLA0C17644g15761851010.001
Kwal_23.355615971981010.001
YMR162C (DNF3)16562391000.001
Scas_505.4102556713.1
Scas_227.0d30721685.3
Scas_463.3315100668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04312g
         (937 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04312g complement(382354..385209) highly similar to sp|P13...  1893   0.0  
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...  1504   0.0  
Kwal_14.1498                                                         1346   0.0  
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...  1340   0.0  
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....  1294   0.0  
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...  1178   0.0  
Scas_707.48*                                                         1154   0.0  
Kwal_23.3160                                                          396   e-121
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...   375   e-113
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...   358   e-107
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....   358   e-107
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...   358   e-107
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...   358   e-107
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...   358   e-107
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...   350   e-104
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...   289   6e-82
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...   275   1e-77
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...   270   2e-75
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...   237   2e-65
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...   236   3e-65
Kwal_47.17522                                                         231   2e-63
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...   229   1e-62
Scas_688.1                                                            229   1e-62
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...   229   2e-62
Scas_710.41                                                           227   7e-62
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...   211   1e-56
Kwal_47.17547                                                         210   1e-55
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...   206   1e-54
Scas_297.1                                                            154   2e-38
Scas_569.0d                                                           146   3e-37
Scas_665.30                                                           122   4e-28
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   122   5e-28
Kwal_26.9207                                                          115   8e-26
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...   114   1e-25
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...   114   2e-25
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   109   7e-24
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...   103   3e-22
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    96   9e-20
Kwal_55.21575                                                          95   1e-19
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    91   4e-18
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...    89   1e-17
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    87   5e-17
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...    86   7e-17
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...    85   2e-16
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement          84   3e-16
Scas_583.14*                                                           83   6e-16
Kwal_23.5789                                                           82   2e-15
Scas_704.38                                                            81   3e-15
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    78   3e-14
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    78   3e-14
Scas_615.9                                                             74   6e-13
ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH] (511968..51...    72   1e-12
Kwal_26.7070                                                           70   4e-12
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...    70   8e-12
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    70   8e-12
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...    68   2e-11
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    65   3e-10
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...    64   7e-10
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...    62   2e-09
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    61   3e-09
KLLA0D04092g complement(344666..348124) some similarities with s...    60   6e-09
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...    52   2e-06
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...    52   2e-06
Scas_576.8                                                             52   3e-06
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    51   6e-06
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...    50   8e-06
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...    49   1e-05
Scas_669.3                                                             47   7e-05
Scas_636.16                                                            47   1e-04
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...    46   1e-04
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...    46   2e-04
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...    46   2e-04
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...    45   3e-04
Scas_89.1                                                              44   5e-04
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...    44   0.001
Kwal_23.3556                                                           44   0.001
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...    43   0.001
Scas_505.4                                                             32   3.1  
Scas_227.0d                                                            31   5.3  
Scas_463.3                                                             30   8.9  

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 1893 bits (4903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 925/937 (98%), Positives = 925/937 (98%)

Query: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60
           MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT
Sbjct: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60

Query: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120
           DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG
Sbjct: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120

Query: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180
           NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG
Sbjct: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180

Query: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240
           DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA
Sbjct: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240

Query: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300
           ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL
Sbjct: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300

Query: 301 ASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
           ASF            QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI
Sbjct: 301 ASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360

Query: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNY 420
           VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNY
Sbjct: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNY 420

Query: 421 LTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSF 480
           LTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSF
Sbjct: 421 LTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSF 480

Query: 481 NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT 540
           NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT
Sbjct: 481 NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT 540

Query: 541 LASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIH 600
           LASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIH
Sbjct: 541 LASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIH 600

Query: 601 IIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPE 660
           IIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPE
Sbjct: 601 IIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPE 660

Query: 661 HKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFS 720
           HKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFS
Sbjct: 661 HKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFS 720

Query: 721 TILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILMDG 780
           TILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILMDG
Sbjct: 721 TILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILMDG 780

Query: 781 PPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAEDGQ 840
           PPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAEDGQ
Sbjct: 781 PPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAEDGQ 840

Query: 841 VTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIP 900
           VTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIP
Sbjct: 841 VTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIP 900

Query: 901 FFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYWV 937
           FFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYWV
Sbjct: 901 FFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYWV 937

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 1504 bits (3894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/943 (78%), Positives = 830/943 (88%), Gaps = 15/943 (1%)

Query: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60
           MSDNPF     D+D+        ++E+EIL+AT  AL+KP+PSLEYCTLSV+E L KLDT
Sbjct: 1   MSDNPFNASLLDEDS--------NREREILDATAEALSKPSPSLEYCTLSVDEALEKLDT 52

Query: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120
           D   GL S  EA  RR  YGPNEI+V+DDESL KKFLSNF+EDR+ILLL+GSA++S+F+G
Sbjct: 53  DKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMG 112

Query: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180
           NIDDA+SIT+AI IVVTVGFVQEYRSEKSLEALNKLVP ECHL+R G+ES+VLA+ LVPG
Sbjct: 113 NIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPG 172

Query: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240
           DLV FRIGDRIPADIRIIE  DL+IDESNLTGE +PVHK+ + + + S+NDQPNSIVP++
Sbjct: 173 DLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPIS 232

Query: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300
           ER+ IAYMGTLVKEG+G+GIVVGTG  TSFG VFEMM++IEKPKTPLQLTMDKLGKDLSL
Sbjct: 233 ERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSL 292

Query: 301 ASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
            SF            QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI
Sbjct: 293 VSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 352

Query: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNK-----GG 415
           VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK+WCL SM+NKLNVLSLDKNK      G
Sbjct: 353 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNG 412

Query: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKV 475
           NLKNYLT+DV+ TL  GNLCNNAS+SQEHA +LGNPTDVALLEQL  FE+ D+R+   KV
Sbjct: 413 NLKNYLTEDVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKV 472

Query: 476 KELSFNSKRKMMATKIQDN-EKKTTLFIKGAFERILDKSSSYLTEKGK-IEKLTAGHRET 533
           +EL FNSKRK+MATKI +  + K T+++KGAFERIL+ S+SYL  KGK  EKLT   + T
Sbjct: 473 QELPFNSKRKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKAT 532

Query: 534 IIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQ 593
           I +CAN++ASEGLRV  FAK  ++DSS+ L ED I DL FTGLIGMNDPPR +VKFAI+Q
Sbjct: 533 INECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQ 592

Query: 594 FLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNI 653
            LQGG+HIIMITGDSENTAVNIA+QIGIPVIDPKLSVLSGDKL+EM+DDQLANVIDHVNI
Sbjct: 593 LLQGGVHIIMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNI 652

Query: 654 FARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMI 713
           FARATPEHKLNIVRALR+RGDVVAMTGDGVNDAPALKL+DIGVSMGR+GTDVAKEASDM+
Sbjct: 653 FARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMV 712

Query: 714 LTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILW 773
           LTDDDFSTILTAIEEGKGIFNNIQNFL+FQLSTS+AALSLVALSTAF LPNPLNAMQILW
Sbjct: 713 LTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILW 772

Query: 774 INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVK 833
           INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILT +++KRL+ TA+CII+GTVY+FVK
Sbjct: 773 INILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVK 832

Query: 834 EMAEDGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQ 893
           EMAEDG+VTARDTTMTFTCFVFFDMFNALACRH TKSIFEIGFFTNKMFN AVG SLLGQ
Sbjct: 833 EMAEDGKVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQ 892

Query: 894 MCAIYIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYW 936
           MCAIYIPFFQ+IFKTE L  SD++ L +ISSSVFI+DE+RK W
Sbjct: 893 MCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLW 935

>Kwal_14.1498
          Length = 939

 Score = 1346 bits (3483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/938 (69%), Positives = 783/938 (83%), Gaps = 16/938 (1%)

Query: 1   MSDNPF-TYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLD 59
           MSDNPF +Y D+ KD   S+A +              L++P PSLE+C+LSVEET   L 
Sbjct: 1   MSDNPFNSYLDRSKDREASTAEV--------------LSRPQPSLEFCSLSVEETAQSLG 46

Query: 60  TDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFL 119
           TD + GL ++    +RR  YG NEIS ++DE L  KF++ FV D LILLL+GSA+IS  +
Sbjct: 47  TDTQNGLPTMSVVEERRAQYGKNEISSEEDEPLWWKFVTTFVGDPLILLLIGSAVISFIM 106

Query: 120 GNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVP 179
           GNIDDA+SIT+AIVIVVTVGFVQEYRSEKSLEALN+LVP +CHLIR G+ES +LA+ LVP
Sbjct: 107 GNIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQCHLIRCGQESKLLASVLVP 166

Query: 180 GDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPV 239
           GD+VRFR+GDRIPAD+RIIE  DL+I+ESNLTGE +PVHKS   ++++ Y +   SIVPV
Sbjct: 167 GDVVRFRVGDRIPADLRIIEAVDLSIEESNLTGENEPVHKSTATVNKEFYKENLGSIVPV 226

Query: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLS 299
           +ER+ IA+MGTLV+EG+GRGIV+GT + T+FG VFEMM++IEKPKTPLQ  MDKLGKDLS
Sbjct: 227 SERSCIAFMGTLVREGHGRGIVIGTAKNTAFGKVFEMMNAIEKPKTPLQTAMDKLGKDLS 286

Query: 300 LASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359
             SF            QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR+A
Sbjct: 287 FMSFIVIGIICLIGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRA 346

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKN 419
           I+RRLPSVETLGSVNVICSDKTGTLT+NHM+V+K+WCLGSM+NK N+L LDK   G+ K 
Sbjct: 347 IIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKLDKATSGSFKK 406

Query: 420 YLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELS 479
            LT+D++ TL  GNLCNN++YS EHAKYLGNPTD+ALLE L KF L D R + T+  E+S
Sbjct: 407 NLTEDLRATLRTGNLCNNSTYSHEHAKYLGNPTDIALLEVLHKFGLEDERPQVTRSDEIS 466

Query: 480 FNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCAN 539
           FNSKRK MA K+++   K  + +KGA+E+IL+KS+ ++  + K+ KL +  R+ I D A+
Sbjct: 467 FNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSAD 526

Query: 540 TLASEGLRVLAFAKRAMTDSSS-KLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGG 598
            LAS+GLR LAFA+  +++ +S KL EDDI+ L F GL+GMNDPPR SVK A+++  +G 
Sbjct: 527 ALASDGLRTLAFAQLELSNGNSKKLTEDDINGLTFAGLLGMNDPPRPSVKAAVERLSEGS 586

Query: 599 IHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARAT 658
           +HIIMITGD+ENTAV+IARQIGIPV++P+ +VL+GDKL+ M++DQLA++IDHVNIFARAT
Sbjct: 587 VHIIMITGDAENTAVSIARQIGIPVVNPETAVLTGDKLDHMSEDQLASIIDHVNIFARAT 646

Query: 659 PEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718
           PEHKLNIVRAL++RGD+VAMTGDGVNDAPALKLADIGVSMG+MGTDVAKEASDM+LTDDD
Sbjct: 647 PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 706

Query: 719 FSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILM 778
           FSTILTAIEEGKGIFNNIQNFL+FQLSTS+AALSLVA++TAF LPNPLNAMQILWINILM
Sbjct: 707 FSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAIATAFKLPNPLNAMQILWINILM 766

Query: 779 DGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAED 838
           DGPPAQSLGVEPVDHEVMKKPPRKR DKILT  + +RL+ +A+ II+GT+YVF+KEMAED
Sbjct: 767 DGPPAQSLGVEPVDHEVMKKPPRKRADKILTKAVFQRLLQSAALIIIGTIYVFIKEMAED 826

Query: 839 GQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIY 898
           G+VTARDTTMTFTCFVFFDMFNALACRH+TKSIFE+G F NKMFN AVG SLLGQ+CAIY
Sbjct: 827 GEVTARDTTMTFTCFVFFDMFNALACRHSTKSIFEVGIFANKMFNYAVGCSLLGQVCAIY 886

Query: 899 IPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYW 936
           +PFFQ+IFKTE L+  DL FL ++SS+VFI DE+RK +
Sbjct: 887 VPFFQSIFKTERLSLGDLAFLLLLSSTVFIADELRKLY 924

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 1340 bits (3468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/947 (70%), Positives = 787/947 (83%), Gaps = 22/947 (2%)

Query: 1   MSDNPF-TYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLD 59
           MSDNPF +Y ++ KD   SS    S   E       A  KPN SLEYCT++V+ETL +L+
Sbjct: 7   MSDNPFDSYLNRSKD--DSSMETKSLASE-------AFLKPNASLEYCTMTVDETLRQLN 57

Query: 60  TDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFL 119
           TD+  GL   ++     Q +G NE++VD ++ + K+F+S FVED LILLL+GSA++S  +
Sbjct: 58  TDSAKGLCDQQQVRASEQEWGTNEVTVDGEDPVWKRFMSTFVEDPLILLLIGSAVLSFLM 117

Query: 120 GNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVP 179
           GNIDDA+SIT+A+VIVV+VGFVQEYRSEKSLEAL+KLVP  CHLIR G E++VLA+ LVP
Sbjct: 118 GNIDDAVSITLAVVIVVSVGFVQEYRSEKSLEALHKLVPASCHLIRFGAETHVLASCLVP 177

Query: 180 GDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPV 239
           GDLV F++GDRIPAD+RIIE  DL++DES LTGET+PVHKS   ++  +Y+D P  I+P+
Sbjct: 178 GDLVYFKVGDRIPADVRIIESTDLSLDESTLTGETEPVHKSCTPVNSATYSDVPGGIIPI 237

Query: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLS 299
            ERT+IAYMGTLV+EG+G+GIVV TG+ T FG VFEMM+SIEKPKTPLQ+ MD L +DLS
Sbjct: 238 GERTSIAYMGTLVREGHGKGIVVATGKHTMFGAVFEMMNSIEKPKTPLQMAMDTLRRDLS 297

Query: 300 LASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359
              F            QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA RKA
Sbjct: 298 YVRFVLSGIIFLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANRKA 357

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLD-KNKGG--- 415
           IVRRLPSVETLGSVNVICSDKTGTLT+NHMT SKIWCLGSMANK NVLSL+ K+ GG   
Sbjct: 358 IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSLEAKSSGGLPG 417

Query: 416 ---NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEY 472
              NLKNYL+DDVK TL  G++CNNAS+S EH KYLGNPTD+ALLE LQKF+L D R   
Sbjct: 418 KLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYLGNPTDIALLEVLQKFDLVDERPTT 477

Query: 473 TKVKELSFNSKRKMMATKIQD--NEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGH 530
           T+V EL+FNSKRK MA K+    N  K  +++KGAFERIL++S+S++   GK+EKL+  H
Sbjct: 478 TRVDELTFNSKRKYMAVKVDSPANSGKHIIYVKGAFERILERSASFIGGAGKVEKLSDSH 537

Query: 531 RETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDD-ISDLVFTGLIGMNDPPRSSVKF 589
           +  I DCA +LASEGLR LAFA+  +  S++K + D  I +L F GLIGM DPPRS+V+ 
Sbjct: 538 KSLINDCAKSLASEGLRTLAFAQ--LECSTNKPMNDSTIQNLTFVGLIGMKDPPRSTVRP 595

Query: 590 AIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVID 649
           AI++ LQGG+H+IMITGD+ENTAVNIARQIGIPVI+P++SVL+GD+L++MTDDQLA VID
Sbjct: 596 AIEELLQGGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTGDRLDQMTDDQLAGVID 655

Query: 650 HVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEA 709
           HVNIFARATPEHKLNIVRAL++RGD+VAMTGDGVNDAPALKLADIGV+MG MGTDVAKEA
Sbjct: 656 HVNIFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEA 715

Query: 710 SDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAM 769
           SDM+LTDDDFSTILTAIEEGKGIFNNIQ+FL+FQLSTS+AALSLVA++TAF L NPLNAM
Sbjct: 716 SDMVLTDDDFSTILTAIEEGKGIFNNIQSFLTFQLSTSVAALSLVAIATAFKLQNPLNAM 775

Query: 770 QILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVY 829
           QILWINILMDGPPAQSLGVEPVDHEVM+KPPRKR+DKILT ++++RL+  A+ II GT+Y
Sbjct: 776 QILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRSDKILTPQVMRRLLINAAFIIGGTIY 835

Query: 830 VFVKEMAEDGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFS 889
           VF+KEM EDGQVTARDTTMTFTCFVFFDMF+ALACRH TKSIFEIG F NKMFN AVGFS
Sbjct: 836 VFIKEMTEDGQVTARDTTMTFTCFVFFDMFSALACRHATKSIFEIGIFNNKMFNYAVGFS 895

Query: 890 LLGQMCAIYIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYW 936
           LLGQ+CAIYIPFFQ IFKTE L+  DLI+L +ISSSVFI DE+RKY+
Sbjct: 896 LLGQLCAIYIPFFQNIFKTERLSLGDLIYLIVISSSVFIADEVRKYY 942

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 1294 bits (3348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/939 (69%), Positives = 762/939 (81%), Gaps = 17/939 (1%)

Query: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60
           MSDNPF  Y              +++++  +     L++PN SLEYCT+SVE+T+ +L T
Sbjct: 1   MSDNPFESY-------------LARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQLGT 47

Query: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120
           D   GLS+  E   R+  +G NE+  D+  SL KKFLS F+ED LILLL+GSA+IS  +G
Sbjct: 48  DFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVISFLMG 107

Query: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180
           NIDD+ISI +AI+IVVTVGFVQEY+SEKSLEALNKLVP ECHL R G+ S+VLA+NLVPG
Sbjct: 108 NIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVLASNLVPG 167

Query: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240
           DLVRF++GDRIPAD+RI+E  DL +DESNLTGE +PVHKS  A+   +Y+  P SI+PV 
Sbjct: 168 DLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSHIPGSIIPVG 227

Query: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300
           +R  I +MGTLV+EG+G+GIV+ TG+ T FG+VFEMMS I+KPKTPLQ  MDKLG+DLS 
Sbjct: 228 DRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQTAMDKLGQDLSY 287

Query: 301 ASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
            SF            QGRSWLEMFQI+VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI
Sbjct: 288 MSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 347

Query: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNY 420
           VRRLPSVETLGSVNVICSDKTGTLT+NHMTVSKIWCLGSM NK N L+L K K   +K  
Sbjct: 348 VRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKERPIK-- 405

Query: 421 LTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSF 480
           +  DV TTL  GN+CNN +YSQEH KYLGNPTD+A+LE LQ F + D R+   K+ E+ F
Sbjct: 406 MEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGINDCRNSVNKINEIPF 465

Query: 481 NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT 540
           NSKRK MA K  D   K  +++KGAFE+I++KS +Y+   GK+ KL    +  I D A  
Sbjct: 466 NSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVA 525

Query: 541 LASEGLRVLAFAKR--AMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGG 598
           LASEGLR LAFA+   + T    +  ED +  L FTGLI MNDPPR +V+ AI++ LQG 
Sbjct: 526 LASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGS 585

Query: 599 IHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARAT 658
           +H+IMITGD+ENTAV+IARQIGIPVI+P+ SVLSGDKL++MTDDQLA+VIDHVN+FARAT
Sbjct: 586 VHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLDQMTDDQLASVIDHVNVFARAT 645

Query: 659 PEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718
           PEHKLNIVRAL++RGD+VAMTGDGVNDAPALKLADIGVSMG+MGTDVAKEASDM+LTDDD
Sbjct: 646 PEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDD 705

Query: 719 FSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILM 778
           FSTILTAIEEGKGIFNNIQNFL+FQLSTS+AALSLVA+ST+  LPNPLNAMQILWINILM
Sbjct: 706 FSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVAISTSLKLPNPLNAMQILWINILM 765

Query: 779 DGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAED 838
           DGPPAQSLGVEPVDHEVM+KPPRKRTDKILT  +LKR++ +A  II+GT+YVFVKEMAED
Sbjct: 766 DGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDAVLKRVLISACFIIVGTIYVFVKEMAED 825

Query: 839 GQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIY 898
           GQVT+RDTTMTFTCFVFFDMFNAL+CRH TKSIFEIGFF NKMFN AV  SLLGQ+CAIY
Sbjct: 826 GQVTSRDTTMTFTCFVFFDMFNALSCRHATKSIFEIGFFANKMFNYAVSLSLLGQLCAIY 885

Query: 899 IPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRKYWV 937
           IPFFQ IFKTESL+  DL+FL  +SSSVFI DEIRKY+V
Sbjct: 886 IPFFQGIFKTESLSLGDLLFLLTLSSSVFIGDEIRKYYV 924

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/898 (64%), Positives = 721/898 (80%), Gaps = 7/898 (0%)

Query: 37  LTKPNPSLEYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKF 96
           L +PNPSL++CTLSV ET+  L+TD   GLSS EE  KRR+ +G N+   DDDES++KKF
Sbjct: 39  LNRPNPSLKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKF 98

Query: 97  LSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKL 156
           L +FVEDRLILLL+GSA++S  +G IDDA+SI++AI+IVVTVGF+QEYRSEKSLEALNKL
Sbjct: 99  LMSFVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKL 158

Query: 157 VPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDP 216
           VP +CHLIR GRESN LA+ LVPGDLVRF+IGDRIPAD+RIIE  DL+IDESNLTGET+P
Sbjct: 159 VPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEP 218

Query: 217 VHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEM 276
           +HK  + +  + Y+   N  VPV+ER+ IAYMGTLVKEG+G+GIV+GTG  TS+G +FEM
Sbjct: 219 LHKDAQTIDPEEYD---NRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEM 275

Query: 277 MSSIEKPKTPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIP 336
           ++SIEKPKTPLQ TMD+LG +LS  SF            +G S L MFQ+SVSLAVAAIP
Sbjct: 276 VNSIEKPKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIP 335

Query: 337 EGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWC 396
           EGLPIIVTVTLALGVLRM K+ AIVRRLPSVETLGSVNVIC+DKTGTLT+NHMTVSK++C
Sbjct: 336 EGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFC 395

Query: 397 LGSMANKLNVLSLDKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVAL 456
           L S     N +S +++   ++ +   +DVK TL   N+CNNA YS+EH  Y+GNPTDVAL
Sbjct: 396 LDSSGTYENAISPEEDSEFDVHD---NDVKETLTIANICNNAKYSEEHNLYIGNPTDVAL 452

Query: 457 LEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSY 516
           +E L KF + D R  + K++ELSFNSKRK MA K      +  L+IKGAFERILDKSS Y
Sbjct: 453 IEVLTKFGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDKSSYY 512

Query: 517 LTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGL 576
           L + G++ +     +  +++ A++ AS+GLR +A A +  TDS + + EDDI+ L FTGL
Sbjct: 513 LDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKP-TDSDNVISEDDINGLTFTGL 571

Query: 577 IGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKL 636
            G+ DPPR +VK +I++  +GG+HIIMITGDS NTAV+IA +IG+ V D + SV++GDK+
Sbjct: 572 FGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGDKV 631

Query: 637 NEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGV 696
           +E+T+D+L+ VID VNIFARATPE+KLNIV+ALR+RGD+VAMTGDGVNDAPALKLADIG+
Sbjct: 632 SELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGI 691

Query: 697 SMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVAL 756
           +MG  GTDVAKE SDMILTDDDFS+ILTAIEEGKGIFNNI+NFL+FQLS S+A LSL+A+
Sbjct: 692 AMGISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAI 751

Query: 757 STAFMLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRL 816
           +T   LP PLN MQILWINI+MDGPPAQSLGVEPVD +VM KPPR R ++IL   +L RL
Sbjct: 752 TTIAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRL 811

Query: 817 IGTASCIILGTVYVFVKEMAEDGQVTARDTTMTFTCFVFFDMFNALACRHTTKSIFEIGF 876
           +  A CI++GT Y+F+K M E+ Q T++D TMTFT FVFF +FNA+ACRHTTKSIF+IG 
Sbjct: 812 LYLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFNAVACRHTTKSIFQIGL 871

Query: 877 FTNKMFNLAVGFSLLGQMCAIYIPFFQAIFKTESLAFSDLIFLAMISSSVFIIDEIRK 934
           F+N++FN+A+  S+ GQMCA+YIPFFQ IFKTE+L F DL+ L ++SSSV I+DEIRK
Sbjct: 872 FSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTLVLVSSSVLIVDEIRK 929

>Scas_707.48*
          Length = 741

 Score = 1154 bits (2984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/744 (75%), Positives = 645/744 (86%), Gaps = 8/744 (1%)

Query: 1   MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTLSVEETLHKLDT 60
           MS NPF     D+ +         +E+E+LE    AL++PN SLEYCT+SV+ETL KL+T
Sbjct: 1   MSANPFDAPIADERS--------IEERELLEVAKEALSRPNASLEYCTMSVDETLRKLET 52

Query: 61  DAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG 120
           D K GL S+ EA++R+  YG NEI +++DESL KKFLS+FVEDRLILLL+GSA++S  +G
Sbjct: 53  DPKSGLGSIAEASRRKLVYGANEIVIEEDESLWKKFLSSFVEDRLILLLIGSAVVSFIMG 112

Query: 121 NIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPG 180
           NIDDA+SIT+AIVIVV+VGFVQEYRSEKSLEALNKLVP ECHLIR G+ES+VLA+ LVPG
Sbjct: 113 NIDDAVSITLAIVIVVSVGFVQEYRSEKSLEALNKLVPAECHLIRCGQESHVLASGLVPG 172

Query: 181 DLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVA 240
           DLV F+IGDRIPAD+RIIE  DL+IDESNLTGE +PVHKS K +++DS+NDQPNSI+P++
Sbjct: 173 DLVHFKIGDRIPADLRIIEAVDLSIDESNLTGENEPVHKSAKEVNKDSFNDQPNSIIPIS 232

Query: 241 ERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL 300
           +RT +AYMGTLVKEG+G+GIVVG G+ TSFG +FEM+S+IEKPKTPLQ  MDKLGKDLSL
Sbjct: 233 DRTCVAYMGTLVKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPLQNAMDKLGKDLSL 292

Query: 301 ASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
            SF            QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI
Sbjct: 293 FSFIVIGLICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 352

Query: 361 VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNY 420
           VRRLPSVETLGSVNVICSDKTGTLTSNHMT SKIWCL SMANK NVLSL+K+K G+LKNY
Sbjct: 353 VRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWCLDSMANKANVLSLEKSKSGSLKNY 412

Query: 421 LTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSF 480
           LT+DVK+TL  GN+CNNAS+SQEH KYLGNPTD+ALLEQL KF+L+D+R  + KV+E+ F
Sbjct: 413 LTEDVKSTLTIGNICNNASFSQEHGKYLGNPTDIALLEQLSKFDLSDIRPTFKKVQEIPF 472

Query: 481 NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT 540
           NSKRK MA KI ++E K +L +KGAFE++L + S YL +KGK EKLT G R+ II+ AN+
Sbjct: 473 NSKRKFMAVKIVNSEGKYSLCVKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANS 532

Query: 541 LASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIH 600
           LASEGLR+LAFAK  + DS + L E+ + DL+FTGLIGMNDPPR +VK AI+Q LQGG+H
Sbjct: 533 LASEGLRMLAFAKTTLPDSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVH 592

Query: 601 IIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPE 660
           IIMITGDSENTAVNIARQIGIPV+DPKLSVLSGDKLNEM+DDQLANVIDHVNIFARATPE
Sbjct: 593 IIMITGDSENTAVNIARQIGIPVLDPKLSVLSGDKLNEMSDDQLANVIDHVNIFARATPE 652

Query: 661 HKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFS 720
           HKLNIVRALR+RGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDM+LTDDDFS
Sbjct: 653 HKLNIVRALRKRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVLTDDDFS 712

Query: 721 TILTAIEEGKGIFNNIQNFLSFQL 744
           TILTAIEEGKGIFNNIQNFL+FQL
Sbjct: 713 TILTAIEEGKGIFNNIQNFLTFQL 736

>Kwal_23.3160
          Length = 1100

 Score =  396 bits (1018), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 281/921 (30%), Positives = 455/921 (49%), Gaps = 139/921 (15%)

Query: 46  YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRL 105
           + T+S  +T H L+TD + GL S E AT R   YG N +  DD +   K  L + + + +
Sbjct: 23  FHTVSARDTAHVLETDLQAGLRSAE-ATARVSQYGENSLG-DDSKIDFKSILLHQICNAM 80

Query: 106 ILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIR 165
           IL+L  S +I++ + +      I   + I V +G  QEY++ K++ +L  L     H+IR
Sbjct: 81  ILVLFISMVITLAIRDWISGGVIAFVVFINVAIGSYQEYKASKTMNSLKSLSTPSAHVIR 140

Query: 166 GGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALS 225
            G +  + +  LVPGDL   + GD +PAD+R+IEC +   DE+ LTGE+ P+ K    + 
Sbjct: 141 DGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVY 200

Query: 226 RDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMM----SSIE 281
             + +       PV +R N+A+  + V +G   GIVV TG  T  G + + +    S I 
Sbjct: 201 PATED------TPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLIS 254

Query: 282 KPK-------------------------TPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQ 316
           K +                         TPL   + KL   L   +              
Sbjct: 255 KDENKTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFV 314

Query: 317 GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 376
               + ++ I V  AV+ IP  L +++T+T+++G   MA R  +VR+L S+E LG+VN +
Sbjct: 315 VNKEVAIYAICV--AVSMIPSSLVVVLTITMSVGAKIMATRNVVVRKLDSLEALGAVNDV 372

Query: 377 CSDKTGTLTSNHMTVSKIWC--LGSMANKLNVLSLDKNKGG----------NLKNYLTDD 424
           CSDKTGTLT   M V + W    G++    +    D   GG            K+  T+D
Sbjct: 373 CSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDSTED 432

Query: 425 VK------------------------TTLLCGNLCNNASYSQ----EHAKYLGNPTDVAL 456
           V                           L    L N A   Q    E  K  G+PT++A+
Sbjct: 433 VGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAI 492

Query: 457 LEQLQKFEL-------------------------ADVRSEYTKVKELSFNSK-RKMMATK 490
                K ++                         + V   Y  + E  F+S  ++M A  
Sbjct: 493 QVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVY 552

Query: 491 IQ-DNEKKTTLFIKGAFERILDKSSSYLTE---KGKIEKLTAGHRETIIDCANTLASEGL 546
           +  D +    +F KGAFER+LD  + +L +   +   + +T   +E +     TL+SEGL
Sbjct: 553 VSLDEDNAHRVFTKGAFERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGL 612

Query: 547 RVLAFAKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGG 598
           RVLAFA ++ T+S +  V +D+        SDL+F GL+G+ DPPR     A+ QF + G
Sbjct: 613 RVLAFATKSFTESQALKVSEDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAG 672

Query: 599 IHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLANVI 648
           I++ M+TGD   TA  IA+++GI           V+D    V++  + +++TD+++ N++
Sbjct: 673 INVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSM--VMTAAQFDQLTDEEIDNLL 730

Query: 649 DHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKE 708
               + AR  P+ K+ ++ AL RR    AMTGDGVND+P+LK A++G++MG  G+DVAK+
Sbjct: 731 LLPLVIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKD 790

Query: 709 ASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN---- 764
           ASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F+  +    
Sbjct: 791 ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEDRLSV 850

Query: 765 -PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLI--GT-- 819
            PL+ +++LWI ++    PA  LG+E    ++M+K P+     I T E++  ++  GT  
Sbjct: 851 FPLSPVEVLWIIVVTSCFPAMGLGLEKSAPDIMEKEPQDSKAGIFTWEIILDMLIYGTWM 910

Query: 820 -ASCIILGTVYVFVKEMAEDG 839
            A C+      ++ K   E G
Sbjct: 911 AACCLACFITVIYGKGNGELG 931

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score =  375 bits (962), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 302/1046 (28%), Positives = 494/1046 (47%), Gaps = 170/1046 (16%)

Query: 45   EYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDR 104
            +Y  LSVE+T  +L TD+  G+S  EE   R    G N +  DD +   K  L + + + 
Sbjct: 12   DYHALSVEDTCARLVTDSSKGISP-EEFQARLAQCGENSLG-DDAKIDYKAMLIHQICNA 69

Query: 105  LILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLI 164
            +IL+L+ S IIS  + +      I   I I V +G +QEY++ K++ AL  L     H+I
Sbjct: 70   MILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVI 129

Query: 165  RGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKAL 224
            R G    V +T++VPGDLV  ++GD IPAD+R++   +   DE+ LTGE+ PV K     
Sbjct: 130  RNGNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKD---- 185

Query: 225  SRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMS------ 278
            + + ++D+     PV +R N+A+  + V +G  +GI + TG  T  G + + +       
Sbjct: 186  ANEIFDDE----TPVGDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELI 241

Query: 279  SIEKPKT-----------------------PLQLTMDKLGKDLSLASFXXXXXXXXXXXX 315
            S +  KT                       PL   + KL   L   +             
Sbjct: 242  SRDPAKTWYQNAWISTKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKF 301

Query: 316  QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNV 375
                 + ++ + V+L++  IP  L +++T+T+++G   MA R  I+R+L S+E LG+VN 
Sbjct: 302  DVDRGVAIYAVCVALSM--IPSSLVVVLTITMSVGAAVMASRNVIIRKLDSLEALGAVND 359

Query: 376  ICSDKTGTLTSNHMTVSKIWC--LGSMA-----NKLNVLSLDKNKGGNLKNY-------- 420
            ICSDKTGTLT   M   +IW    G++        LN    D N   NL  Y        
Sbjct: 360  ICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLNPEKGDINFIPNLSPYEYSHNETE 419

Query: 421  -------LTDDVKTTLLCGN--------------LCNNASY----SQEHAKYLGNPTDVA 455
                     D  +   + GN              L N AS       +  K  G+PT++A
Sbjct: 420  DVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASVFTDPETKEWKAHGDPTEIA 479

Query: 456  LL-----------------------EQLQKFELAD-----VRSEYTKVKELSFNSKRKMM 487
            +                        E +    L++       +++    E  F+S  K M
Sbjct: 480  IQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAANAKFRHAAEFPFDSTIKRM 539

Query: 488  ATKIQDNEKKT-TLFIKGAFERILDKSSS-YLTEKGKIEKLTAGHRETIIDCANTLASEG 545
            ++  +  + KT  ++ KGAFE +L+  +  Y  +      +T    +TI +  ++++SEG
Sbjct: 540  SSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKENIDSMSSEG 599

Query: 546  LRVLAFAKRAMTDSSSK-------LVEDDISD--LVFTGLIGMNDPPRSSVKFAIDQFLQ 596
            LRVLAFA ++   S          L E D ++  L F GLIG+ DPPR     A+ +F Q
Sbjct: 600  LRVLAFANKSYPKSDVNEEKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQ 659

Query: 597  GGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLAN 646
             GI++ M+TGD   TA  IA+++GI           V+D  + V++G + + +++D++ N
Sbjct: 660  AGINVRMLTGDFPGTAKAIAQEVGILPTNLYHYSKEVVD--IMVMTGKQFDNLSEDEIDN 717

Query: 647  VIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVA 706
            +     + AR +P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DVA
Sbjct: 718  LPVLPLVIARCSPQTKVRMIEALHRREKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVA 777

Query: 707  KEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN-- 764
            K+ASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +  AF      
Sbjct: 778  KDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGK 837

Query: 765  ---PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLI---- 817
               PL  +++LWI ++    PA  LG+E   H++M +PP      I T E++  +     
Sbjct: 838  SVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAHDLMDRPPNDSKAGIFTWEIIVDMFVYGV 897

Query: 818  -GTASCIILGTVYVFVKEMAEDGQVTARD----------------TTMTFTCFVF----F 856
               ASC+      ++ ++    GQ   RD                 TMT+   +      
Sbjct: 898  WMAASCMATFVTIIYGRDHGNLGQNCNRDYSESCHDVFRARSAAFATMTWCALILAWEVI 957

Query: 857  DMFNALACRH-----TTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIPFFQA-IFKTES 910
            D+  +    H       K  F+   + NK    +V F        +YIP     +F  + 
Sbjct: 958  DLRRSFFRMHPDTDAPVKQFFK-DIYGNKFLFYSVVFGFASVFPVVYIPVINTDVFLHKP 1016

Query: 911  LAFSDLIFLAMISSSVFIIDEIRKYW 936
            + +   I +A  S   +I  E+ KY+
Sbjct: 1017 IGWEWGIAIAF-SVCFWIGCELHKYF 1041

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score =  358 bits (920), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 277/927 (29%), Positives = 456/927 (49%), Gaps = 150/927 (16%)

Query: 38  TKPNPSLE---YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVK 94
           TK N + E   Y TL+ EE    + T    GL+  +E   R +  G N +  DD +   K
Sbjct: 6   TKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQ-DEFVHRLKTVGENTLG-DDTKIDYK 63

Query: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALN 154
             + + V + +I++L+ S IIS  + +      I+  I + V +G VQEY++ K++ +L 
Sbjct: 64  AMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLK 123

Query: 155 KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGET 214
            L     H+IR G+   + + ++VPGD+   ++GD IPAD+R+IE  +   DES LTGE+
Sbjct: 124 NLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGES 183

Query: 215 DPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVF 274
            PV K    +    +  +  +   V +R N+A+  + V +G  +GIV+ T   +  G + 
Sbjct: 184 LPVSKDANLV----FGKEEET--SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIA 237

Query: 275 EMMSS------------------IEKPK-----------TPLQLTMDKLGKDLSLASFXX 305
           + +                    I   K           TPL   + KL   L   +   
Sbjct: 238 KSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLF 297

Query: 306 XXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 365
                          + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L 
Sbjct: 298 AIIVMASQKFDVDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLD 355

Query: 366 SVETLGSVNVICSDKTGTLTSNHMTVSKIWC--LGSMA----------NKLNV------- 406
           S+E LG+VN ICSDKTGTLT   M   +IW    G++           N+ NV       
Sbjct: 356 SLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFS 415

Query: 407 -LSLDKNKGGN---LKNY--------LTDDVKTTLL-----CGNLCNNASYSQEHA---- 445
                 N+ G+   L+N+        L +D+   L         L N A+  ++ A    
Sbjct: 416 PYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCW 475

Query: 446 KYLGNPTDVALLEQLQKFELAD---------------------------VRSEYTKVKEL 478
           K  G+PT++A+     K +L                               +++  + E 
Sbjct: 476 KAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEF 535

Query: 479 SFNSKRKMMATKIQDNEKKT-TLFIKGAFERILDKSSSYLTEKG-KIEKLTAGHRETIID 536
            F+S  K M++   +N  +T  ++ KGAFE I+   SS+  + G KI  LT    ETI  
Sbjct: 536 PFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRK 595

Query: 537 CANTLASEGLRVLAFAKRAMTDSSSKLVEDDI------------SDLVFTGLIGMNDPPR 584
              +L++EGLRVL FA ++ T      V DD             SDLVF GLIG+ DPPR
Sbjct: 596 NVYSLSNEGLRVLGFASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPR 652

Query: 585 SSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGD 634
           +    A+ +F Q GI++ M+TGD   TA  IA+++GI           ++D    V++G 
Sbjct: 653 NETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGS 710

Query: 635 KLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADI 694
           + + ++++++ ++     + AR +P+ K+ ++ AL RR     MTGDGVND+P+LK+A++
Sbjct: 711 QFDGLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANV 770

Query: 695 GVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLV 754
           G++MG  G+DV+KEASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    +
Sbjct: 771 GIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYL 830

Query: 755 ALSTAFMLPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILT 809
            +   F   N     PL+ +++LWI ++    PA  LG+E    ++M +PP      I T
Sbjct: 831 IIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFT 890

Query: 810 AELL-----KRLIGTASCI--ILGTVY 829
            E++       +I T SC+    G++Y
Sbjct: 891 WEVIIDTFAYGIIMTGSCMASFTGSLY 917

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score =  358 bits (920), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 272/913 (29%), Positives = 452/913 (49%), Gaps = 133/913 (14%)

Query: 45  EYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESL-VKKFLSNFVED 103
           ++  L   E    L TD + GL++ EEA  R +  G N  ++ ++E + V+  L   + +
Sbjct: 20  DFHALPAHEVARLLGTDLRRGLTA-EEARARLEVVGDN--TLGEEEGINVRAILLKQMCN 76

Query: 104 RLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHL 163
            +IL+L+ S +I++ + +      I   + + V++G  QEY + K++ +L  L      +
Sbjct: 77  AMILVLIISMVIALAIKDWISGGVIAFVVALNVSIGAYQEYNACKTMNSLKDLSTPSARV 136

Query: 164 IRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKA 223
           IR G +  + +  +VPGD+V+ R+GD +PAD+R++E  +L  DE+ LTGE  PV K   A
Sbjct: 137 IRNGEDVVMASAQVVPGDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKDPAA 196

Query: 224 LSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMS----- 278
           +             PV +R N+A+  + V +G   GIVV TG  +  G + E +      
Sbjct: 197 VFEQD--------TPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248

Query: 279 -SIEKPKTPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISV--------- 328
            S ++ K+ LQ T+  L    S+ SF              +  L +F I+V         
Sbjct: 249 ISRDENKSGLQNTV--LTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMAT 306

Query: 329 --------------SLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 374
                          +A++ IP  L +++T+T++ G   M+ R  IVRRL S+E LG+VN
Sbjct: 307 QKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVIVRRLDSLEALGAVN 366

Query: 375 VICSDKTGTLTSNHMTVSKIWC--LGSMANKLNVLSLDKNKG------------------ 414
            ICSDKTGTLT   M + ++W    G++    + +  D   G                  
Sbjct: 367 DICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEYQHDEE 426

Query: 415 ------GNLKNYLTDD----------VKTTLLCGNLCNNA-----SYSQEHAKYLGNPTD 453
                  N K     +           ++ L    L N A     S S+E   + G+PT+
Sbjct: 427 EDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDSKEWRAH-GDPTE 485

Query: 454 VAL-------------LEQLQKFELADVRSE------YTKVKELSFNSK-RKMMATKIQD 493
           +A+             L   Q  E +D   +      Y    E  F+S  ++M A  I  
Sbjct: 486 IAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSSIKRMSAVYINL 545

Query: 494 NEKKTT-LFIKGAFERILDKSSSYLTEKGK--IEKLTAGHRETIIDCANTLASEGLRVLA 550
            +K T  +F KGAFER+L   + +  + G      LT    E I    +TL++EGLRVLA
Sbjct: 546 RDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVDTLSNEGLRVLA 605

Query: 551 FAKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHII 602
           FA + +    ++ + + +        SDL+F GL+G+ DPPR     A+ +  + GI++ 
Sbjct: 606 FATKTIPAEEAESLGERLTKDRDFVESDLIFQGLVGIYDPPRVETAGAVKKCHRAGINVH 665

Query: 603 MITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLANVIDHVN 652
           M+TGD   TA  IA+++GI           V+D  + V++  + + +TD++L  +     
Sbjct: 666 MLTGDFPGTAKAIAQEVGILPHNLYHYPKEVVD--IMVMTATQFDSLTDEELDQLPVLPL 723

Query: 653 IFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDM 712
           + AR  P+ K+ ++ AL RR    AMTGDGVND+P+LK A++G++MG  G+DVAK+ASD+
Sbjct: 724 VIARCAPQTKVRMIDALHRREKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDI 783

Query: 713 ILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN-----PLN 767
           +L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + L   F+  +     PL+
Sbjct: 784 VLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAANVAQAIYLMLGLTFLDEDKLSVFPLS 843

Query: 768 AMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGT 827
            +++LWI ++    PA  LG+E    ++M+KPP      I T E++  +I     + +  
Sbjct: 844 PVEVLWIIVVTSCLPAMGLGLEKAAPDIMEKPPNDSKAGIFTWEVIVDMIVYGLVMAVCC 903

Query: 828 VYVFVKEMAEDGQ 840
           +  FV  + +DG 
Sbjct: 904 LGCFVSIIYKDGH 916

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score =  358 bits (919), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 267/899 (29%), Positives = 440/899 (48%), Gaps = 128/899 (14%)

Query: 40  PNPSLEYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSN 99
           P    ++  L+  +    L T    GL++ + A +R    G N +  DD +  +K  L +
Sbjct: 13  PYARNDFHVLTAPQVEKLLSTHINQGLNNTQIA-ERLSLVGENTLG-DDTKINIKGILIS 70

Query: 100 FVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQ 159
            + + +I++L+ S +I++ + +      +   + I V +G  QEY + K++ +L  L   
Sbjct: 71  QICNAMIMVLIISMVITLAIKDWISGGVLAFVVGINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 160 ECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHK 219
             H+IR G +  + +  LVPGD+   ++GD +PAD+R++E  +L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLESINLETDEALLTGESLPVAK 190

Query: 220 SY-KALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMS 278
           S+ +   +D+         PV +R N+A+  + V +G   GIV+ T   T  G + + + 
Sbjct: 191 SHSEVYEKDT---------PVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLK 241

Query: 279 S----IEKPK-------------------------TPLQLTMDKLGKDLSLASFXXXXXX 309
           S    I K +                         TPL   + +L   L + +       
Sbjct: 242 SETSFISKDENKSFGQNLWITLKETIGSFLGTNVGTPLHRKLSQLAILLFVVAVIFAIVV 301

Query: 310 XXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVET 369
                 +    + ++ I V  A++ IP  L +++T+T++ G   MA R  IVR+L S+E 
Sbjct: 302 MGTQKYRVNKQVAIYAICV--AISMIPSSLVVVLTITMSAGAKVMATRNVIVRKLDSLEA 359

Query: 370 LGSVNVICSDKTGTLTSNHMTVSKIWC--LGSMANKLNVLSLDKNKGG-------NLKNY 420
           LG+VN ICSDKTGTLT   M   ++W    G++  + +    +   G        +   Y
Sbjct: 360 LGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQY 419

Query: 421 LTDD---------VKTTLLCG-----------------NLCNNASYSQ----EHAKYLGN 450
             DD          K+  L G                  L N A+  Q    +  K  G+
Sbjct: 420 KHDDEEDVGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGD 479

Query: 451 PTDVALLEQLQKFEL---------------ADVRSEYTKVKELSFNSKRKMMATKIQDNE 495
           PT++A+     + +L               A   S +  V E  F+S  K M+   ++ E
Sbjct: 480 PTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMSAIYKNTE 539

Query: 496 KKTT----LFIKGAFERILDKSSS-YLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLA 550
              T    +F KGAFER+L    S Y T  GK   L+    ETI    +TL+SEGLRVLA
Sbjct: 540 DPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLA 599

Query: 551 FAKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHII 602
           FAK++  +S     +D +          L F GLIG+ DPPR     A+ +  Q GI++ 
Sbjct: 600 FAKKSFNESEFNANKDKLLKERDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVH 659

Query: 603 MITGDSENTAVNIARQIGI--------PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIF 654
           M+TGD   TA +IA+++GI        P       V++    + ++D ++ ++     + 
Sbjct: 660 MLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALSDQEIDDLRVLPLVI 719

Query: 655 ARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714
           AR  P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD++L
Sbjct: 720 ARCAPQTKVRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVL 779

Query: 715 TDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN-----PLNAM 769
           +DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F+        PL+ +
Sbjct: 780 SDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFVDKEGFSVFPLSPV 839

Query: 770 QILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAE-----LLKRLIGTASCI 823
           ++LWI ++    PA  LG+E    +VM+KPP+     + T E     L+  +I  A C+
Sbjct: 840 EVLWIIVVTSCFPAMGLGLEKASVDVMEKPPKDAKAVVFTWEVIIDMLVYGVIMAACCM 898

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  358 bits (919), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 273/916 (29%), Positives = 453/916 (49%), Gaps = 147/916 (16%)

Query: 46  YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRL 105
           Y TL+ EE    + T    GL+  +E+ +R +  G N +  DD +   K  + + V + +
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGLTQ-DESLRRLKAVGENTLG-DDTKIDYKAMVLHQVCNAM 74

Query: 106 ILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIR 165
           I++L+ S  IS  + +      I+  I + V +G VQEY++ K++ +L  L     H+IR
Sbjct: 75  IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 166 GGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALS 225
            G+   + + ++VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K    + 
Sbjct: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV- 193

Query: 226 RDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSS------ 279
              +  +  +   V +R N+A+  + V +G  +GIV+ T   +  G + + +        
Sbjct: 194 ---FGKEEET--SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 280 ------------IEKPK-----------TPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQ 316
                       I   K           TPL   + KL   L   +              
Sbjct: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308

Query: 317 GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 376
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 377 CSDKTGTLTSNHMTVSKIWC--LGSMA----------NKLNV--------LSLDKNKGGN 416
           CSDKTGTLT   M   +IW    G++           N+ NV             N+ G+
Sbjct: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 417 ---LKNY--------LTDDVKTTLL-----CGNLCNNASYSQEHA----KYLGNPTDVAL 456
              L+N+        L +D+   L         L N A+  ++ A    K  G+PT++A+
Sbjct: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 457 LEQLQKFELAD---------------------------VRSEYTKVKELSFNSKRKMMAT 489
                K +L                               +++  + E  F+S  K M++
Sbjct: 487 QVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 490 KIQDNEKKT-TLFIKGAFERILDKSSSYLTEKG-KIEKLTAGHRETIIDCANTLASEGLR 547
              +N  +T  ++ KGAFE I+   SS+  + G KI  LT    ETI     +L++EGLR
Sbjct: 547 VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606

Query: 548 VLAFAKRAMTDSSSKLVEDDI------------SDLVFTGLIGMNDPPRSSVKFAIDQFL 595
           VL FA ++ T      V DD             SDLVF GLIG+ DPPR+    A+ +F 
Sbjct: 607 VLGFASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFH 663

Query: 596 QGGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLA 645
           Q GI++ M+TGD   TA  IA+++GI           ++D    V++G + + ++++++ 
Sbjct: 664 QAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSEEEVD 721

Query: 646 NVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDV 705
           ++     + AR +P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DV
Sbjct: 722 DLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDV 781

Query: 706 AKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN- 764
           +KEASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F   N 
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENG 841

Query: 765 ----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELL-----KR 815
               PL+ +++LWI ++    PA  LG+E    ++M +PP      I T E++       
Sbjct: 842 KSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYG 901

Query: 816 LIGTASCI--ILGTVY 829
           +I T SC+    G++Y
Sbjct: 902 IIMTGSCMASFTGSLY 917

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score =  358 bits (918), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 273/916 (29%), Positives = 453/916 (49%), Gaps = 147/916 (16%)

Query: 46  YCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRL 105
           Y TL+ EE    + T    GL+  +E+ +R +  G N +  DD +   K  + + V + +
Sbjct: 17  YHTLTTEEAAEFIGTSLTEGLTQ-DESLRRLKAVGENTLG-DDTKIDYKAMVLHQVCNAM 74

Query: 106 ILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIR 165
           I++L+ S  IS  + +      I+  I + V +G VQEY++ K++ +L  L     H+IR
Sbjct: 75  IMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIR 134

Query: 166 GGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALS 225
            G+   + + ++VPGD+   ++GD IPAD+R+IE  +   DES LTGE+ PV K    + 
Sbjct: 135 NGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLV- 193

Query: 226 RDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSS------ 279
              +  +  +   V +R N+A+  + V +G  +GIV+ T   +  G + + +        
Sbjct: 194 ---FGKEEET--SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS 248

Query: 280 ------------IEKPK-----------TPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQ 316
                       I   K           TPL   + KL   L   +              
Sbjct: 249 RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFD 308

Query: 317 GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVI 376
               + ++ I V+L++  IP  L +++T+T+++G   M  R  IVR+L S+E LG+VN I
Sbjct: 309 VDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDI 366

Query: 377 CSDKTGTLTSNHMTVSKIWC--LGSMA----------NKLNV--------LSLDKNKGGN 416
           CSDKTGTLT   M   +IW    G++           N+ NV             N+ G+
Sbjct: 367 CSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGD 426

Query: 417 ---LKNY--------LTDDVKTTLL-----CGNLCNNASYSQEHA----KYLGNPTDVAL 456
              L+N+        L +D+   L         L N A+  ++ A    K  G+PT++A+
Sbjct: 427 VGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAI 486

Query: 457 LEQLQKFELAD---------------------------VRSEYTKVKELSFNSKRKMMAT 489
                K +L                               +++  + E  F+S  K M++
Sbjct: 487 QVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSS 546

Query: 490 KIQDNEKKT-TLFIKGAFERILDKSSSYLTEKG-KIEKLTAGHRETIIDCANTLASEGLR 547
              +N  +T  ++ KGAFE I+   SS+  + G KI  LT    ETI     +L++EGLR
Sbjct: 547 VYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLR 606

Query: 548 VLAFAKRAMTDSSSKLVEDDI------------SDLVFTGLIGMNDPPRSSVKFAIDQFL 595
           VL FA ++ T      V DD             SDLVF GLIG+ DPPR+    A+ +F 
Sbjct: 607 VLGFASKSFTKDQ---VNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFH 663

Query: 596 QGGIHIIMITGDSENTAVNIARQIGI----------PVIDPKLSVLSGDKLNEMTDDQLA 645
           Q GI++ M+TGD   TA  IA+++GI           ++D    V++G + + ++++++ 
Sbjct: 664 QAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSM--VMTGSQFDGLSEEEVD 721

Query: 646 NVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDV 705
           ++     + AR +P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DV
Sbjct: 722 DLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDV 781

Query: 706 AKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN- 764
           +KEASD++L+DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F   N 
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENG 841

Query: 765 ----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELL-----KR 815
               PL+ +++LWI ++    PA  LG+E    ++M +PP      I T E++       
Sbjct: 842 KSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYG 901

Query: 816 LIGTASCI--ILGTVY 829
           +I T SC+    G++Y
Sbjct: 902 IIMTGSCMASFTGSLY 917

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score =  350 bits (898), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 257/883 (29%), Positives = 433/883 (49%), Gaps = 121/883 (13%)

Query: 40  PNPSLEYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSN 99
           P    ++ +LSV      L T    GL++ + A +R    G N +  DD +  +K    +
Sbjct: 13  PYARDDFHSLSVSRVETLLSTHINQGLNTTQIA-ERLGLIGENTLG-DDSKINIKGIFIS 70

Query: 100 FVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQ 159
            + + +I++L+ S +IS  + +      I   + I V +G  QEY + K++ +L  L   
Sbjct: 71  QICNAMIMVLIISMVISFAIKDWISGGVIAFVVFINVVIGAYQEYNASKTMNSLKSLSTP 130

Query: 160 ECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHK 219
             H+IR G +  + +  LVPGD+   R+GD +PAD+R+ E  +L  DE+ LTGE+ PV K
Sbjct: 131 SAHVIRAGNDLTIESKELVPGDICIIRVGDTVPADLRLFEAINLETDEALLTGESLPVAK 190

Query: 220 SYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSS 279
           S+  +             PV +R N+A+  + V +G   GIV+ T   T  G + + + S
Sbjct: 191 SHGEVYEQD--------TPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKIAKSLKS 242

Query: 280 ----IEKPK-------------------------TPLQLTMDKLGKDLSLASFXXXXXXX 310
               I + K                         TPL   + +L   L + +        
Sbjct: 243 EASLISRDKSKSFGRNLWITLRESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVVM 302

Query: 311 XXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETL 370
                +    + ++ I V+L++  IP  L +++T+T++ G   MA R  I+R+L S+E L
Sbjct: 303 GTQKFKVNKQVAIYAICVALSM--IPSSLVVVLTITMSAGAKVMATRHVIIRKLDSLEAL 360

Query: 371 GSVNVICSDKTGTLTSNHMTVSKIW------------------CLGSMA-----NKLNVL 407
           G+VN ICSDKTGTLT   M   ++W                   +G +      +     
Sbjct: 361 GAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKFSPYQYK 420

Query: 408 SLDKNKGGNLKN----YLTDDV--------KTTLLCGNLCNNASY----SQEHAKYLGNP 451
             D+   G + +    Y  D++           L    L N A+       +  K  G+P
Sbjct: 421 HDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDP 480

Query: 452 TDVALLEQLQKFELA-------------DVRSEYT--KVKELSFNSKRKMMATKIQDNEK 496
           T++A+     + +L              ++ ++ T   V E  F+S  K M+   ++ E+
Sbjct: 481 TEIAIQVFATRMDLPRRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVKRMSAIYKNVEE 540

Query: 497 KTT----LFIKGAFERILDKSSS-YLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAF 551
                  +F KGAFER+L   +S Y T  G  + LT    ET+    +TL+SEGLRVLAF
Sbjct: 541 PKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLRVLAF 600

Query: 552 AKRAMTDSSSKLVEDDI--------SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIM 603
           AK+   +S   + +D +        ++L F GL+G+ DPPR     A+ +    GI++ M
Sbjct: 601 AKKTFNESQFTINKDKLLKERDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHM 660

Query: 604 ITGDSENTAVNIARQIGI--------PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFA 655
           +TGD   TA +IA+++GI        P       V++    + ++D ++  +     + A
Sbjct: 661 LTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDALSDKEIDELPVLPLVIA 720

Query: 656 RATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILT 715
           R  P+ K+ ++ AL RR    AMTGDGVND+P+LK+A++G++MG  G+DVAK+ASD++L+
Sbjct: 721 RCAPQTKVRMIEALHRRNRFCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLS 780

Query: 716 DDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN-----PLNAMQ 770
           DD+F++IL A+EEG+ + +NIQ F+   L+ ++A    + +   F+        PL+ ++
Sbjct: 781 DDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVE 840

Query: 771 ILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELL 813
           +LW+ ++    PA  LG+E  + +VM+KPP+     I T E++
Sbjct: 841 VLWVIVVTSCFPAMGLGLEKANVDVMEKPPKDAKAVIFTWEVI 883

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score =  289 bits (739), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 280/1016 (27%), Positives = 456/1016 (44%), Gaps = 173/1016 (17%)

Query: 11   KDKDAGGSSASLNSQEKEILEATNAALTKPNPSLEYCTL---SVEETLHKLDTDAKLGLS 67
            +++  G  S+   + E  I     + L  P     YC L   S       L TD K GL+
Sbjct: 8    ENQGPGRRSSRQLAPEFTITPTQLSELHNPKSLAAYCALFGHSENGLCDALKTDKKNGLA 67

Query: 68   SVEEA---TKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLG---- 120
              +E    T R + +G N +        ++     F +D+ +++LM +A+IS  LG    
Sbjct: 68   LADEEVRETARCRRFGANRVPERTARGFLRLMWEAF-KDKTMIVLMVAAVISFSLGLYEA 126

Query: 121  -----NIDD------------AISITMAIVIVVTVGFVQEYRSEKSLEALN-KLVPQECH 162
                  +DD             ++I  A+ +VV V    +Y+ E+    LN K    E  
Sbjct: 127  IGQPPELDDDGTPMAQVDYVEGLAIMAAVAVVVLVTAANDYQKERQFARLNRKKEDTEVV 186

Query: 163  LIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYK 222
            ++R G +  +   +L+ GDL+  + GD +P D  ++E      DES +TGE+D + K   
Sbjct: 187  VVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVE-GKCECDESGITGESDTIKKVSL 245

Query: 223  ALSRDSY--------------NDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRET 268
            A+S   Y              +D  +S+VP      +   G+ +  G G  +V   G  +
Sbjct: 246  AMSLQVYRTVAADNPSADIGSSDNGHSLVP----DPMLISGSKLLSGIGHAVVTAVGPHS 301

Query: 269  SFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSL----ASF---------------XXXXXX 309
              G +   + S E   TPLQ  ++ L  D+S+    A+F                     
Sbjct: 302  VHGKMMLALKS-EPETTPLQERLNTLADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYH 360

Query: 310  XXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVET 369
                  +G  ++++F  +V++ V A+PEGLP+ VT+ LA    RM K   +VR L + ET
Sbjct: 361  DLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRACET 420

Query: 370  LGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG------NLKNYLTD 423
            +GS   +CSDKTGTLT N M V K + LGS  +  + +S D N         ++  +  +
Sbjct: 421  MGSATTVCSDKTGTLTQNKMVVVKGF-LGS--SHFDDISEDSNCAQSDALRQDMSQHTLN 477

Query: 424  DV-----------------------------KTTLLCGNLCNNASYS-------QEHAKY 447
            D+                             + +L   +  N   Y        Q    +
Sbjct: 478  DILANIALNSTAFENKQVADPVITENPYHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFF 537

Query: 448  LGNPTDVALLE----QLQKFELADVRSE------YTKVKELSFNSKRKMMATKIQDNEKK 497
            +G+ T+ ALL      L    L  +R +       + V+ + F S RK     ++  +  
Sbjct: 538  IGSKTEAALLSLAKGSLGLESLQALRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGN 597

Query: 498  TTLFIKGAFERILDKSSSYL-TEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAM 556
               FIKGA E I  KS  Y+ +    + KL+      I    N LAS+ LR ++ A +  
Sbjct: 598  YRFFIKGASETIF-KSCHYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDF 656

Query: 557  TDSSS---------------------------------KLVEDDISDLVFTGLIGMNDPP 583
            TD SS                                  ++ ++ S L+  G++G++DP 
Sbjct: 657  TDISSWPPAELRDASDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPL 716

Query: 584  RSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----PVIDPKLSVLSGDKLNEM 639
            R  VK ++    Q G+ + MITGD+  T   IAR  GI       D + + + G    ++
Sbjct: 717  RPGVKESVKNCQQSGVTVRMITGDNITTGRAIARACGILSESEYADHECA-MEGPVFRKL 775

Query: 640  TDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMG 699
            +  Q+ +    + + AR++PE K   V  L++  +VVA+TGDG NDAPAL LAD+G SMG
Sbjct: 776  SRRQMMDAAPKLKVLARSSPEDKRIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMG 835

Query: 700  RMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTA 759
              GT VA+EASD+IL  DDF++I+ AI+ G+ +  +I+ F+ FQL+ +I A++L  ++  
Sbjct: 836  ISGTGVAREASDIILMTDDFTSIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAV 895

Query: 760  FML-PNP-LNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLI 817
                 NP L A+Q+LW+N++MD   A +L  +  D  ++++ P  R   ++     K ++
Sbjct: 896  TSTEENPVLTAVQLLWVNLIMDTLAALALATDKPDPHILERIPTGRDSPLIAVSTWKMIL 955

Query: 818  GTA--SCIILGTVYVFVKEMAEDGQV--TARDT----TMTFTCFVFFDMFNALACR 865
            G A    II   ++   +++    QV  T RD     T+TF  FV+   F  +  R
Sbjct: 956  GQAVLQLIIAFVLHYGGRKLFYPHQVPFTGRDQKRLDTLTFNTFVWLQFFKLIVTR 1011

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score =  275 bits (704), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 263/975 (26%), Positives = 435/975 (44%), Gaps = 165/975 (16%)

Query: 50  SVEETLHKLDTDAKLGLSSVEEAT----KRRQYYGPNEISVDDDESLVKKFLSNFVEDRL 105
           S E    +L TD   G+++ ++A     KRR  YG N +     +S        F +DR 
Sbjct: 23  SAEALARRLSTDLANGIATDKDAELPPLKRRDAYGSNRLPERAPKSFWALVREAF-QDRT 81

Query: 106 ILLLMGSAIISVFLG-------------------NID--DAISITMAIVIVVTVGFVQEY 144
           +LLL G+A++S  LG                    +D  + ++I MA+++VV V    +Y
Sbjct: 82  MLLLTGAAVVSFTLGIYEVLTQPPELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDY 141

Query: 145 RSEKSLEALN-KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRII--ECN 201
           + E   + LN K   ++  ++R   ES +   NL+ GDL++ + GD +PAD  ++  EC 
Sbjct: 142 QKELQFQQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECE 201

Query: 202 DLTIDESNLTGETDPVHK-------SYKAL--SRDSYNDQPNSIVPVAERTN----IAYM 248
               DES LTGE++ + K        Y +    RD  +   +     A+ +     +   
Sbjct: 202 ---TDESALTGESNTIKKLPLADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLIS 258

Query: 249 GTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSLASFXXXXX 308
           G+ V  G    IV   G  +  G     +   +   TPLQ+ + +L  ++S+        
Sbjct: 259 GSRVLSGLASAIVTNVGVNSVHGKTMASLKE-DSEDTPLQMRLSQLTDNISVYGCVAAIT 317

Query: 309 XXXXX--------------------XXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA 348
                                      +G  ++++F  ++++ V A+PEGLP+ VT+ LA
Sbjct: 318 LFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALA 377

Query: 349 LGVLRMAKRKAIVRRLPSVETLGSVNVICS-----------------------DKTGTLT 385
               RM K   +VR L S ET+GS   +CS                       D  G   
Sbjct: 378 FATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADP 437

Query: 386 SNHMTVSKIWCLGSMANK------LNVLSLDKNKGGNLKNYLT-DDVKTTLLCG------ 432
           S    V K  C   +         LN  + +     +  NY + DD +   L        
Sbjct: 438 SKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTL 497

Query: 433 ---------NLCNNASYSQEHAKYLGNPTDVALLEQLQKF------ELADVRSEYTK--- 474
                    NL  +A+  ++   Y+G+ T+ ALL   +K        L   R    K   
Sbjct: 498 QKKKPDDEENLLAHAAEGRQEP-YIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPT 556

Query: 475 ----VKELSFNSKRKMMATKIQ-----DNE-KKTTLFIKGAFERILDKSSSYLTEKGKIE 524
               V+ + F S RK  A  ++     +NE KK  L++KGA E +    +        I 
Sbjct: 557 VETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGIS 616

Query: 525 KLTAGHRETIIDCANTLASEGLRVLAFAK----------RAMTDSSS-------KLVED- 566
           ++    ++ I +   +LA + LR ++ A           + + D  +       KL++  
Sbjct: 617 EIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPK 676

Query: 567 --DISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI--- 621
              +  L    ++G+ DP R +VK ++ Q  + G+ + M+TGD+  TA  IAR  GI   
Sbjct: 677 KPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSS 736

Query: 622 PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGD 681
             ++     + G    +++D +   ++  + + AR++PE K  +VRAL+  G+VVA+TGD
Sbjct: 737 KSLNDSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGD 796

Query: 682 GVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLS 741
           G NDAPALKLAD+G SMG  GT+VA+EASD+IL  DDFS I+ AI+ G+ +  +I+ F+ 
Sbjct: 797 GTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQ 856

Query: 742 FQLSTSIAALSLVALSTAFM--LPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKP 799
           FQL  ++ A+ L  +++     + + L A+Q+LW+N++MD   A +L  +  D  +M + 
Sbjct: 857 FQLIVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMDRK 916

Query: 800 PRKRTDKILTAELLKRLIGTA--------SCIILGTVYVFVKEMAE-DGQVTARDTTMTF 850
           P+ R+  ++T    K +IG A        +    G  Y F K   +  G    +   M F
Sbjct: 917 PKGRSTPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKPKEDLPGHEHQQINAMIF 976

Query: 851 TCFVFFDMFNALACR 865
             FV+   F  L  R
Sbjct: 977 NTFVWLQWFTLLVSR 991

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score =  270 bits (689), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 267/955 (27%), Positives = 424/955 (44%), Gaps = 156/955 (16%)

Query: 58   LDTDAKLGLSSVEE---ATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAI 114
            L TD   GL+  +E   + +R Q YG N I     +S ++     F  D+ ++LL  +A+
Sbjct: 114  LQTDRTNGLTIQDEDIESLERTQVYGLNRIPERKGKSFLRLVWEAF-NDKTMILLTVAAV 172

Query: 115  ISVFLG---NIDDAISITMAIVIVVTVGFVQ------------------EYRSEKSLEAL 153
            IS  LG    +            +V V +V+                  +Y+ E     L
Sbjct: 173  ISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLVGAINDYQKELQFAKL 232

Query: 154  NKLVP-QECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRII----ECNDLTIDES 208
            NK    ++  +IR G E  +   +L+ GD++  + GD +PAD  +I    EC     DES
Sbjct: 233  NKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAVLISGSCEC-----DES 287

Query: 209  NLTGETD--------PVHKSYKAL-SRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRG 259
             LTGE+D        P  + YK +  +D   D  +  V       +   G+ +  G G  
Sbjct: 288  ALTGESDTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNA 347

Query: 260  IVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSLASFXXX------------- 306
            ++   G  +  G +  M    E   TPLQ  +  L  ++S+                   
Sbjct: 348  VITSVGENSVNGRIM-MALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLT 406

Query: 307  ------XXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
                           +G  ++ +F  +V++ V A+PEGLP+ VT+ LA    RM K   +
Sbjct: 407  YLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL 466

Query: 361  VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIW------------------------- 395
            VR L + ET+GS   ICSDKTGTLT N MTV K +                         
Sbjct: 467  VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVLRS 526

Query: 396  -CLGSM-ANKLNVLSLD----KNKGGNLKNYLTDD-----VKTTLLCGNLCNNASY---- 440
             C  S+  + L+ +SL+    +NK    K+   D+      + +L   +  N  S     
Sbjct: 527  NCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQLIAD 586

Query: 441  --SQEHAKYLGNPTDVALLEQLQK-FELADVRSEYTK---------VKELSFNSKRKMMA 488
               +   ++LG+ T+ ALL   QK   + DV    TK         V+ + F S RK  A
Sbjct: 587  AMKENDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKPSDLGIDKVVQVIPFESSRKWGA 646

Query: 489  TKIQ--DNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGL 546
              +Q  DN K    + KGA E +L   S+       I  +     +        +AS  L
Sbjct: 647  IAVQLADN-KGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHAL 705

Query: 547  RVLAFAKRAMTDSSSKLVEDDIS------DLV----------------FTGLIGMNDPPR 584
            R ++   R   +   K   D         DLV                   ++G+ DP R
Sbjct: 706  RTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLR 765

Query: 585  SSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----PVIDPKLSVLSGDKLNEMT 640
              VK +++Q  + G+ + M+TGD+  TA  I+R   I       DP+ + + G    ++ 
Sbjct: 766  EGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGYNDPECA-MEGPTFRKLP 824

Query: 641  DDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGR 700
              ++  VI  + + AR++PE K  +V  L++ G+VVA+TGDG NDAPALKLAD+G SMG 
Sbjct: 825  YKKMLRVIPKLRVLARSSPEDKRILVETLKKMGEVVAVTGDGTNDAPALKLADVGFSMGI 884

Query: 701  MGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAA--LSLVALST 758
             GT+VA+EASD+IL  DDF+ I+ AI+ G+ +  +I+ F+ FQL+ +I A  L+ V+   
Sbjct: 885  SGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLTVNITAVILTFVSAVA 944

Query: 759  AFMLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIG 818
            +    + L A+Q+LW+N++MD   A +L  +  D  ++ + P+ R   ++     K ++G
Sbjct: 945  SAEETSVLTAVQLLWVNLIMDTLAALALATDKPDEFILDRKPKGRDAPLIAVSTWKMILG 1004

Query: 819  TASCIILGTVYVFV--KEM--AEDGQVTARD----TTMTFTCFVFFDMFNALACR 865
             A+  +  T  +    KE+       +TA +      MTF  FV+   F  +  R
Sbjct: 1005 QAALQLTVTFVLHFRGKEIFFPNKRTITAHEQEQLNAMTFNTFVWLQFFKLIVTR 1059

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score =  237 bits (605), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 196/725 (27%), Positives = 343/725 (47%), Gaps = 77/725 (10%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E  KRR+ YG N+++ D+ ESLV KF+  FV   +  ++  +AI++ 
Sbjct: 80  LQTDPSYGLTS-DEVLKRRKKYGLNQMA-DEKESLVVKFVMFFV-GPIQFVMEAAAILAA 136

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   +++   VGFVQE+++   ++ L K +     +IR G+   + A  +
Sbjct: 137 GLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEV 196

Query: 178 VPGDLVRFRIGDRIPADIRII--ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNS 235
           VPGD+++   G  IP D RI+  +C  L ID+S +TGE+  V K Y         DQ   
Sbjct: 197 VPGDILQLEDGTVIPTDGRIVTEDCF-LQIDQSAITGESLAVDKHY--------GDQ--- 244

Query: 236 IVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG 295
                      +  + VK G G  +V  TG  T  G    +++     +      ++ +G
Sbjct: 245 ----------TFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIG 294

Query: 296 KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355
             L +               +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 295 IILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLA 354

Query: 356 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG 415
           K++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                      
Sbjct: 355 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE---------------------- 392

Query: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELA-DVRSEYTK 474
               Y  + V    L    C  AS  ++      +  D A L+ L+++  A D  ++Y  
Sbjct: 393 ---PYTVEGVSPDDLMLTACLAASRKKKGL----DAIDKAFLKSLKQYPKAKDALTKYKV 445

Query: 475 VKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETI 534
           ++   F+   K +   ++  E +  + +KGA   +L      + E   I +    + E  
Sbjct: 446 LEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKT----VEEDHPIPEDVHENYENK 501

Query: 535 IDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQF 594
           +     LAS G R L  A++        L           G++   DPPR      + + 
Sbjct: 502 V---AELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVSEA 547

Query: 595 LQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIF 654
              G+ + M+TGD+   A    RQ+G+         L      +M   +LA+ +++ + F
Sbjct: 548 RHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGF 607

Query: 655 ARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714
           A   P+HK  +V  L+ RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D++ 
Sbjct: 608 AEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVF 666

Query: 715 TDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWI 774
                S I+ A++  + IF+ + +++ ++++ S+     + L  A +L N L+   I++I
Sbjct: 667 LAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA-ILDNSLDIDLIVFI 725

Query: 775 NILMD 779
            I  D
Sbjct: 726 AIFAD 730

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score =  236 bits (603), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 194/724 (26%), Positives = 339/724 (46%), Gaps = 75/724 (10%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E ++RR+ YG N++S + +ES++ KF+  FV   +  ++  +AI++ 
Sbjct: 61  LQTDPSYGLTS-DEVSRRRKKYGLNQMS-EANESMILKFVMFFV-GPIQFVMEAAAILAA 117

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L    D   I   +++   VGF+QE+++   +E L K +     +IR G    + A  +
Sbjct: 118 GLEEWIDFGIICALLLLNAAVGFIQEFQAGSIVEELKKTLANSAVVIRDGSLVEIPANEV 177

Query: 178 VPGDLVRFRIGDRIPADIRII-ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSI 236
           VPGD+++   G  IPAD RI+ E   + ID+S +TGE+  V K Y               
Sbjct: 178 VPGDILQLEDGVIIPADGRIVTEGCFVQIDQSAITGESLAVDKRYG-------------- 223

Query: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK 296
                  +  +  + VK G G  IV  TG  T  G    +++            ++ +G 
Sbjct: 224 -------DATFSSSTVKRGEGFMIVTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGT 276

Query: 297 DLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 356
            L +               +    + + + ++++ V  +P GLP +VT T+A+G   +AK
Sbjct: 277 ILLILVILTLLVVYVACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 357 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGN 416
           +KAIV++L ++E+L  V ++CSDKTGTLT N +++ +                       
Sbjct: 337 KKAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE----------------------- 373

Query: 417 LKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVK 476
              Y  + V+   L    C  AS  ++      +  D A L+ L  +  A       KV 
Sbjct: 374 --PYTVEGVEADDLMLTACLAASRKKKGL----DAIDKAFLKSLINYPRAKAALTKYKVL 427

Query: 477 ELS-FNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETII 535
           E   F+   K +   ++  E +  + +KGA   +L        E+  +  +    +E   
Sbjct: 428 EFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKT-----VEENHL--IPEDVKENYE 480

Query: 536 DCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFL 595
           +    LAS G R L  A++        L           G++   DPPR      +++  
Sbjct: 481 NKVAELASRGYRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVNEAR 529

Query: 596 QGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFA 655
             G+ + M+TGD+   A    RQ+G+         L      +M   +LA+ +++ + FA
Sbjct: 530 HLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFA 589

Query: 656 RATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILT 715
              P+HK N+V  L++RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D++  
Sbjct: 590 EVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVFL 648

Query: 716 DDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWIN 775
               S I+ A++  + IF+ + +++ ++++ S+     + L  A +L   LN   +++I 
Sbjct: 649 APGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA-ILNQSLNVHLVVFIA 707

Query: 776 ILMD 779
           I  D
Sbjct: 708 IFAD 711

>Kwal_47.17522
          Length = 899

 Score =  231 bits (589), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 196/727 (26%), Positives = 343/727 (47%), Gaps = 81/727 (11%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E TKRR+ YG N+++ ++ ESLV KFL  F+   +  ++  +AI++ 
Sbjct: 61  LQTDPSYGLTS-DEVTKRRKKYGLNQMA-EESESLVVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   + +   VGF+QEY++   ++ L K +     ++R G    + A  +
Sbjct: 118 GLEDWVDFGVILGLLFLNAGVGFIQEYQAGSIVDELKKSLANSAVVVRDGNLVEIPANEV 177

Query: 178 VPGDLVRFRIGDRIPADIRII--ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNS 235
           VPGD+++   G  I AD R++  EC  L ID+S +TGE+  V K Y              
Sbjct: 178 VPGDIMQLEDGVVICADGRLVTEECF-LQIDQSAITGESLAVDKHYG------------- 223

Query: 236 IVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG 295
                   +  +  + VK G G  IV  TG  T  G    +++     +      ++ +G
Sbjct: 224 --------DTTFSSSTVKRGEGFMIVTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIG 275

Query: 296 KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355
             L +               +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 276 TILLVLVIVTLLLVWTACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLA 335

Query: 356 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG 415
           K++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                      
Sbjct: 336 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE---------------------- 373

Query: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKV 475
               Y  + V+   L    C  AS  ++      +  D A L+ L ++  A  ++  TK 
Sbjct: 374 ---PYTVEGVEPDDLMLTACLAASRKKKGL----DAIDKAFLKSLIQYPRA--KNALTKY 424

Query: 476 KELSFNS---KRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRE 532
           K L F+      K +   ++  E +  + +KGA   +L      + E   I +    + E
Sbjct: 425 KVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKT----VEEDHPIPEDVHENYE 480

Query: 533 TIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAID 592
             +     LAS G R L  A++        L           G++   DPPR      + 
Sbjct: 481 NKV---AELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVH 526

Query: 593 QFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVN 652
           +  + G+ + M+TGD+   A    RQ+G+         L      +M   +LA+ +++ +
Sbjct: 527 EARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENAD 586

Query: 653 IFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDM 712
            FA   P+HK ++V  L++RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D+
Sbjct: 587 GFAEVFPQHKYSVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADI 645

Query: 713 ILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQIL 772
           +      S I+ A++  + IF+ + +++ ++++ S+     + L  A +L   LN   I+
Sbjct: 646 VFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA-ILNQSLNIDLIV 704

Query: 773 WINILMD 779
           +I I  D
Sbjct: 705 FIAIFAD 711

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score =  229 bits (583), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 199/726 (27%), Positives = 343/726 (47%), Gaps = 79/726 (10%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E TKRR+ YG N++S ++ E+L  KFL  F+   +  ++  +AI++ 
Sbjct: 61  LQTDPSYGLTS-DEVTKRRKKYGLNQMS-EETENLFVKFLMFFI-GPIQFVMEAAAILAA 117

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   + +   VGF+QEY++   ++ L K +     +IR G    V +  +
Sbjct: 118 GLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANSAVVIRDGNLVEVPSNEV 177

Query: 178 VPGDLVRFRIGDRIPADIRII-ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSI 236
           VPGD+++   G  IPAD R++ E   + ID+S +TGE+  V K +     DS        
Sbjct: 178 VPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAVDKRFG----DS-------- 225

Query: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK 296
                     +  + VK G    IV  TG  T  G    +++            ++ +G 
Sbjct: 226 ---------TFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGT 276

Query: 297 DLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 356
            L +               +    + + + ++++ +  +P GLP +VT T+A+G   +AK
Sbjct: 277 ILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAK 336

Query: 357 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGN 416
           ++AIV++L ++E+L  V ++CSDKTGTLT N +         S+     V  +D      
Sbjct: 337 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKL---------SLHEPYTVEGVDP----- 382

Query: 417 LKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVK 476
                 DD+  T      C  AS  ++      +  D A L+ L  +  A  ++  TK K
Sbjct: 383 ------DDLMLTA-----CLAASRKKKGL----DAIDKAFLKSLISYPRA--KAALTKYK 425

Query: 477 ELSFNS---KRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRET 533
            L F+      K +   ++  E +  + +KGA   +L      + E+  I +     RE 
Sbjct: 426 LLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKT----VEEEHPIPEDV---REN 478

Query: 534 IIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQ 593
             +    LAS G R L  A++        L           G++   DPPR      +++
Sbjct: 479 YENKVAELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTVNE 527

Query: 594 FLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNI 653
               G+ + M+TGD+   A    RQ+G+         L      +M   +LA+ +++ + 
Sbjct: 528 ARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADG 587

Query: 654 FARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMI 713
           FA   P+HK N+V  L++RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D++
Sbjct: 588 FAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIV 646

Query: 714 LTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILW 773
                 S I+ A++  + IF+ + +++ ++++ S+     + L  A +L   LN   +++
Sbjct: 647 FLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA-ILNRSLNIDLVVF 705

Query: 774 INILMD 779
           I I  D
Sbjct: 706 IAIFAD 711

>Scas_688.1
          Length = 913

 Score =  229 bits (583), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 200/730 (27%), Positives = 348/730 (47%), Gaps = 87/730 (11%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GLSS +E  +RR+ YG N++S +++ESLV KF+  FV   +  ++  +AI++ 
Sbjct: 75  LQTDPAYGLSS-DEVARRRKKYGLNQMS-EENESLVVKFIMFFV-GPIQFVMEAAAILAA 131

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   +++   VGFVQE+++   +E L K +     +IR G+   V A  +
Sbjct: 132 GLSDWVDFGVICGLLLLNAGVGFVQEFQAGSIVEELKKTLANSAIVIRDGQLVEVPANEV 191

Query: 178 VPGDLVRFRIGDRIPADIRII--ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNS 235
           VPGD+++   G  IPAD RI+  +C  + ID+S +TGE+    K Y         DQ   
Sbjct: 192 VPGDILQLEDGVIIPADGRIVTEDCF-VQIDQSAITGESLAADKHY--------GDQ--- 239

Query: 236 IVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG 295
                      +  + VK G    ++  TG  T  G    +++     +      ++ +G
Sbjct: 240 ----------TFSSSTVKRGEAFMVITATGDNTFVGRAAALVNKASGGQGHFTEVLNGIG 289

Query: 296 KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355
             L +               +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 290 IILLVLVIVTLLLVWTASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLA 349

Query: 356 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG 415
           K++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                      
Sbjct: 350 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE---------------------- 387

Query: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKV 475
               Y  + V    L    C  AS  ++      +  D A L+ L ++  A  ++  TK 
Sbjct: 388 ---PYTVEGVSADDLMLTACLAASRKKKGL----DAIDKAFLKSLAQYPAA--KNALTKY 438

Query: 476 KELSFNS---KRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKI-EKLTAGHR 531
           K L F+      K +   ++  E +  + +KGA   +L      + E   I E +   + 
Sbjct: 439 KVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKT----VEEDHPIPEDIHENYE 494

Query: 532 ETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAI 591
             + +    LAS G R L  A++        L           G++   DPPR      +
Sbjct: 495 NKVAE----LASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTGETV 539

Query: 592 DQFLQGGIHIIMITGDSENTAVNIARQIGIP--VIDPKLSVLSGDKLNEMTDDQLANVID 649
            +  + G+ + M+TGD+   A    RQ+G+   V + +   LSG    +M   +LA+ ++
Sbjct: 540 AEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNVYNAERLGLSGG--GDMPGSELADFVE 597

Query: 650 HVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEA 709
           + + FA   P+ K  +V  L+ RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A
Sbjct: 598 NADGFAEVFPQDKYRVVEILQTRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSA 656

Query: 710 SDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAM 769
           +D++      S I+ A++  + IF+ + +++ ++++ SI     + L  A +L N L+  
Sbjct: 657 ADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSIHLEIFLGLWIA-ILNNSLDIN 715

Query: 770 QILWINILMD 779
            I++I I  D
Sbjct: 716 LIVFIAIFAD 725

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score =  229 bits (584), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 191/724 (26%), Positives = 341/724 (47%), Gaps = 75/724 (10%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E  +RR+ YG N+++ +++ESL+ KFL  FV   +  ++  +AI++ 
Sbjct: 109 LSTDPAYGLTS-DEVARRRKKYGLNQMA-EENESLIVKFLMFFV-GPIQFVMEAAAILAA 165

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   +++  +VGF+QE+++   ++ L K +     +IR G+   + A  +
Sbjct: 166 GLSDWVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEV 225

Query: 178 VPGDLVRFRIGDRIPADIRII-ECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSI 236
           VPG++++   G   PAD RI+ E   L ID+S +TGE+    K Y         D+    
Sbjct: 226 VPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLAAEKHY--------GDE---- 273

Query: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK 296
                     +  + VK G    +V  TG  T  G    ++      +      ++ +G 
Sbjct: 274 ---------VFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGI 324

Query: 297 DLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 356
            L +               +    + + + ++ + +  +P GLP +VT T+A+G   +AK
Sbjct: 325 ILLVLVIATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 384

Query: 357 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGN 416
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                       
Sbjct: 385 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE----------------------- 421

Query: 417 LKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELA-DVRSEYTKV 475
              Y  + V    L    C  AS  ++      +  D A L+ L ++  A D  ++Y  +
Sbjct: 422 --PYTVEGVSPDDLMLTACLAASRKKKGL----DAIDKAFLKSLIEYPKAKDALTKYKVL 475

Query: 476 KELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETII 535
           +   F+   K +   ++  E +  + +KGA   +L      + E   I +    + E  +
Sbjct: 476 EFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKT----VEEDHPIPEDVHENYENKV 531

Query: 536 DCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFL 595
                LAS G R L  A++        L           G++   DPPR      I++  
Sbjct: 532 ---AELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAQTINEAR 577

Query: 596 QGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFA 655
             G+ I M+TGD+   A    RQ+G+         L      +M   +LA+ +++ + FA
Sbjct: 578 NLGLRIKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFA 637

Query: 656 RATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILT 715
              P+HK  +V  L+ RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D++  
Sbjct: 638 EVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVFL 696

Query: 716 DDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWIN 775
               S I+ A++  + IF+ + +++ ++++ S+     + L  A +L N L+   I++I 
Sbjct: 697 APGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEIFLGLWIA-ILNNSLDINLIVFIA 755

Query: 776 ILMD 779
           I  D
Sbjct: 756 IFAD 759

>Scas_710.41
          Length = 904

 Score =  227 bits (578), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 185/725 (25%), Positives = 338/725 (46%), Gaps = 75/725 (10%)

Query: 57  KLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIIS 116
           +L TD  +GL++ +E  +RR+ YG N++  +++E+ + KFL  FV   +  ++  +AI++
Sbjct: 66  QLKTDPGIGLTT-DEVVRRRKKYGLNQMK-EENENFIVKFLMYFV-GPIQFVMEAAAILA 122

Query: 117 VFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATN 176
             L +  D   I   +++  +VGF+QE+++   +E L K +     +IR G    + A  
Sbjct: 123 AGLSDWVDFGVICGLLMLNASVGFIQEFQAGSIVEELKKTLANTARVIRDGTLQEIPANE 182

Query: 177 LVPGDLVRFRIGDRIPADIRIIECND-LTIDESNLTGETDPVHKSYKALSRDSYNDQPNS 235
           +VPGD++    G  IPAD R++  N  L +D+S +TGE+  V K+Y              
Sbjct: 183 IVPGDILELDEGTIIPADGRLVTENRFLQVDQSAITGESLAVDKNYG------------- 229

Query: 236 IVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG 295
                   ++ +  + VK G    +V  TG  T  G    ++      +      ++ +G
Sbjct: 230 --------DVTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVGEASGGQGHFTDILNDIG 281

Query: 296 KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355
             L +               +    + + + ++ + +  +P GLP +VT T+A+G   +A
Sbjct: 282 TILLVLVIITLLLVWTACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLA 341

Query: 356 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG 415
           K++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                      
Sbjct: 342 KKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE---------------------- 379

Query: 416 NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELA-DVRSEYTK 474
               Y  + V    L    C  A+  ++      +  D A L+ L ++  A +   +Y  
Sbjct: 380 ---PYTVEGVSADDLMLTACLAATRKKKGL----DAIDRAFLKSLNQYPKAMNALPKYKI 432

Query: 475 VKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETI 534
           ++   F+   K +   ++  E +T   +KGA   +L        +    E +   +   +
Sbjct: 433 LEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVEE---DHPVPEDVHENYENKV 489

Query: 535 IDCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQF 594
            +    LAS G R L  A++        L           G++   DPPR      I + 
Sbjct: 490 AE----LASRGFRSLGVARKRGEGYWEIL-----------GVMPCMDPPRDDTARTIAEA 534

Query: 595 LQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIF 654
              G+ + M+TGD+   A   +RQ+G+ V       L      +M   +LA+ +++ + F
Sbjct: 535 RTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYNAEKLGLGGGGDMPGSELADFVENADGF 594

Query: 655 ARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714
           A   P+HK  +V  L+ RG +VAMTGDGVNDAP+LK AD G+++    TD A+ A+D++ 
Sbjct: 595 AEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGATDAARSAADIVF 653

Query: 715 TDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWI 774
                S I+  ++  + IF+ + +++ ++++ S+       L  A +L   LN   I++I
Sbjct: 654 LAPGLSAIIDGLKTSRQIFHRMYSYVVYRIALSLHLEIFFGLWIA-ILNRSLNIELIVFI 712

Query: 775 NILMD 779
            I  D
Sbjct: 713 AIFAD 717

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score =  211 bits (537), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 189/724 (26%), Positives = 342/724 (47%), Gaps = 75/724 (10%)

Query: 58  LDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISV 117
           L TD   GL+S +E   RR+ YG N+++ D+ ES++ KF+  FV   +  ++  +AI++ 
Sbjct: 64  LQTDPSYGLTS-DEVAHRRKKYGLNQMA-DERESMIVKFVMFFV-GPIQFVMEAAAILAA 120

Query: 118 FLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNL 177
            L +  D   I   +++   VGF+QE+++   ++ L K +     +IR G+   V A  +
Sbjct: 121 GLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTLANVAVVIRDGQLVEVPANEV 180

Query: 178 VPGDLVRFRIGDRIPADIRIIECND-LTIDESNLTGETDPVHKSYKALSRDSYNDQPNSI 236
           VPGD+++   G  IPAD R++  N  L +D+S +TGE+  V K Y         DQ    
Sbjct: 181 VPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGESLAVDKGY--------GDQ---- 228

Query: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK 296
                     +  + VK G    +V  TG  T  G    +++     +      ++ +G 
Sbjct: 229 ---------TFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNGIGI 279

Query: 297 DLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 356
            L +               +  + +++ + ++ + +  +P GLP +VT T+A+G   +AK
Sbjct: 280 LLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAK 339

Query: 357 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGN 416
           ++AIV++L ++E+L  V ++CSDKTGTLT N +++ +                       
Sbjct: 340 KQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE----------------------- 376

Query: 417 LKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELA-DVRSEYTKV 475
              Y  + V    L    C  AS  ++      +  D A L+ L  +  A D  ++Y  +
Sbjct: 377 --PYTVEGVSADDLMLTACLAASRKKKGL----DAIDKAFLKSLINYPKAKDALTKYKVI 430

Query: 476 KELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETII 535
           +   F+   K +   ++  E +  + +KGA   +L      + E   I +    + E  +
Sbjct: 431 EFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKT----VEEDHPIPEDVHENYENKV 486

Query: 536 DCANTLASEGLRVLAFAKRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFL 595
                LAS G R L  A++        L           G++   DPPR      +++  
Sbjct: 487 ---AELASRGFRALGVARKRGEGHWEIL-----------GVMPCMDPPRDDTAETVNEAR 532

Query: 596 QGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFA 655
           + G+ + M+TGD+   A    RQ+G+         L      +M   +LA+ +++ + FA
Sbjct: 533 RLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFA 592

Query: 656 RATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILT 715
              P+HK  +V  L+ RG +VAMTGDGVNDAP+LK AD G+++    +D A+ A+D++  
Sbjct: 593 EVFPQHKYKVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAV-EGASDAARSAADIVFL 651

Query: 716 DDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWIN 775
               S I+ A++  + IF+ + +++ ++++ S+  L L       +L + L+   I++I 
Sbjct: 652 APGLSAIIDALKTSRQIFHRMYSYVVYRIALSL-HLELFLGLWIIILNHSLDIELIVFIA 710

Query: 776 ILMD 779
           I  D
Sbjct: 711 IFAD 714

>Kwal_47.17547
          Length = 1240

 Score =  210 bits (534), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 141/488 (28%), Positives = 242/488 (49%), Gaps = 57/488 (11%)

Query: 434  LCNNASYSQEHAKYLGNPTDVALLEQLQK----FELADVRSE------YTKVKELSFNSK 483
            L  NA+  Q    +LG+ T+ ALL   QK      L   R E         V+ + F S 
Sbjct: 536  LVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIPFESS 595

Query: 484  RKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLAS 543
            RK     ++        +IKGA E +L +         K+  ++    +        LA+
Sbjct: 596  RKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAA 655

Query: 544  EGLRVLAFAKR--------------------------------AMTDSSSKLVEDDISDL 571
            E LR ++ A R                                + +DS S+  ++ +S +
Sbjct: 656  EALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPM 715

Query: 572  VFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----PVIDPK 627
            V  G++G+ DP R  V+ +++Q  + G+ + M+TGD+  TA  IA++  I       +P+
Sbjct: 716  VLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQAENPE 775

Query: 628  LSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAP 687
             S + G +  ++++ +   ++ ++ + AR++PE K  +V  L++ GDVVA+TGDG NDAP
Sbjct: 776  -SSMEGPRFRKLSNKERVRILPNLRVLARSSPEDKRILVETLKKMGDVVAVTGDGTNDAP 834

Query: 688  ALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTS 747
            ALKLAD+G SMG  GT+VA+EASD+IL  DDFS I+ AI+ G+ +  +I+ F+ FQL+ +
Sbjct: 835  ALKLADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVN 894

Query: 748  IAA--LSLVALSTAFMLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTD 805
            + A  L+ V+   +    + L A+Q+LW+N++MD   A +L  +  D  ++++ P+ R  
Sbjct: 895  VTAVVLTFVSAVASSEEASVLTAVQLLWVNLIMDTLAALALATDKPDENILERKPKGREA 954

Query: 806  KILTAELLKRLIGTASCIIL--------GTVYVFVKEMAEDGQVTARDTTMTFTCFVFFD 857
             ++T    K ++G ++  ++        G    F  +    G    +   MTF  FV+  
Sbjct: 955  VLITVSTWKMILGQSTLQLIVTFILHFAGKQIFFPGKATITGHEQQQLNAMTFNAFVWLQ 1014

Query: 858  MFNALACR 865
             F  +  R
Sbjct: 1015 FFKLIVTR 1022

 Score =  145 bits (365), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 184/388 (47%), Gaps = 55/388 (14%)

Query: 58  LDTDAKLGLSSVEE---ATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAI 114
           L TD   GL+  +E    T+R Q YG N I     +S ++     F +DR+++LL  +A+
Sbjct: 61  LKTDRNAGLTIADEDITQTERYQLYGDNRIPQRKPKSFLQLAWIAF-QDRIMILLTVAAV 119

Query: 115 ISVFLG-------------------NID--DAISITMAIVIVVTVGFVQEYRSEKSLEAL 153
           +S  LG                    +D  + ++I +A+++V+ VG   +Y+ E     L
Sbjct: 120 VSFALGLYEVLGQPPEHDAEGKKITKVDWVEGVAIMIAVLVVILVGSANDYQKELQFSKL 179

Query: 154 N-KLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTG 212
           N K   +E  ++R G E  +   +++ GD++  + GD +PAD  +++      DES LTG
Sbjct: 180 NDKKNDREVIVLRNGDEHLISIHDILVGDILSLQTGDVVPADCILVK-GSCECDESALTG 238

Query: 213 ETDPVHKS-----YKALSRDSYNDQPNSI-VPVAERTNIAYM--GTLVKEGNGRGIVVGT 264
           E+  + K+     Y+   + S  D    I  P AE+     +  G+ +  G GR +V   
Sbjct: 239 ESATIKKAAIDVCYEKYKQLSATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSV 298

Query: 265 GRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLS------------------LASFXXX 306
           G  +  G    M   +E   TPLQ  +D L   +S                  LA+    
Sbjct: 299 GVNSMHGRTL-MALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKG 357

Query: 307 XXXXXXXXXQ-GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLP 365
                    Q G  ++ +F + +++ V A+PEGLP+ VT+ LA    RMAK   +VR L 
Sbjct: 358 GELHDLTPAQKGSRFMNIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDGNLVRVLR 417

Query: 366 SVETLGSVNVICSDKTGTLTSNHMTVSK 393
           + ET+GS   +CSDKTGTLT N MTV K
Sbjct: 418 ACETMGSATAVCSDKTGTLTENRMTVVK 445

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score =  206 bits (525), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 140/445 (31%), Positives = 232/445 (52%), Gaps = 44/445 (9%)

Query: 458  EQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTT-----LFIKGAFERILDK 512
            + ++KF +  V      V+ + F S RK     ++  E K        FIKGA E I+ K
Sbjct: 599  QPMEKFNIEKV------VQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAE-IVSK 651

Query: 513  SSSY-LTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSS---------- 561
            + SY       +E++   +++   D    LAS+ LR ++ A +   +  S          
Sbjct: 652  NCSYKRNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKD 711

Query: 562  -------KLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVN 614
                    L+ +    L+  GL+G+ DP R+ V+ ++ Q  + G+ + M+TGD+  TA  
Sbjct: 712  SPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKA 771

Query: 615  IARQIGIPVID---PKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRR 671
            IAR   I   D      S + G +  ++T ++   ++ ++ + AR++PE K  +V  L+ 
Sbjct: 772  IARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRILPNLRVLARSSPEDKRLLVETLKG 831

Query: 672  RGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKG 731
             GDVVA+TGDG NDAPALKLAD+G SMG  GT+VA+EASD+IL  DDFS I+ AI+ G+ 
Sbjct: 832  MGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFSAIVNAIKWGRC 891

Query: 732  IFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNP--LNAMQILWINILMDGPPAQSLGVE 789
            +  +I+ F+ FQL  +I A+ L  +S+         L A+Q+LWIN++MD   A +L  +
Sbjct: 892  VSVSIKKFIQFQLIVNITAVILTFVSSVASSDETSVLTAVQLLWINLIMDTLAALALATD 951

Query: 790  PVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGT--VYVFVKEM---AEDGQVTAR 844
              D  +M + PR R+  +++    K ++  A+  ++ T  ++ +  E+     + ++T+ 
Sbjct: 952  KPDPNIMDRKPRGRSTSLISVSTWKMILSQATLQLIVTFILHFYGPELFFKKHEDEITSH 1011

Query: 845  D----TTMTFTCFVFFDMFNALACR 865
                   MTF  FV+   F  L  R
Sbjct: 1012 QQQQLNAMTFNTFVWLQFFTMLVSR 1036

 Score =  130 bits (328), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 117/433 (27%), Positives = 197/433 (45%), Gaps = 64/433 (14%)

Query: 58  LDTDAKLGLSSVE----EATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSA 113
           L TD   G+S  E      T R + YG N +     +S ++   + F  D+ + LL  +A
Sbjct: 66  LKTDKNAGISLPEISNYRKTNRYKNYGDNSLPERIPKSFLQLVWAAF-NDKTMQLLTVAA 124

Query: 114 IISVFLG-------------------NID--DAISITMAIVIVVTVGFVQEYRSEKSLEA 152
           ++S  LG                    +D  + ++I +A+ +VV V    +Y+ E     
Sbjct: 125 VVSFVLGLYELWMQPPQYDPEGNKIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAK 184

Query: 153 LNKLVP-QECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLT 211
           LNK    ++  +IR  +E  +   +++ GD++  + GD +PAD  +I       DES++T
Sbjct: 185 LNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQTGDVVPADCVMIS-GKCEADESSIT 243

Query: 212 GETD-----PVHKSYKALSR----DSYN-DQPNSIVPVAERTN-----IAYMGTLVKEGN 256
           GE++     PV  S +   +    DS+N  +P  I  V E  N     +   G+ +  G 
Sbjct: 244 GESNTIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGSRILSGL 303

Query: 257 GRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSLASFXXXXXXXXXX--- 313
           GRG++   G  + +G     +++ E   TPLQL + +L  ++S+                
Sbjct: 304 GRGVITSVGINSVYGQTMTSLNA-EPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTR 362

Query: 314 -----------------XXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAK 356
                              +G  ++ +F  S+++ V A+PEGLP+ VT+ LA    RM K
Sbjct: 363 YLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTK 422

Query: 357 RKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGN 416
              +VR L S ET+GS   +CSDKTGTLT N MTV + +   S  +    L + + +  N
Sbjct: 423 DGNLVRVLRSCETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLN 482

Query: 417 LKNYLTDDVKTTL 429
            K    ++  ++L
Sbjct: 483 SKKVFEENCSSSL 495

>Scas_297.1
          Length = 800

 Score =  154 bits (389), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/275 (36%), Positives = 155/275 (56%), Gaps = 17/275 (6%)

Query: 606 GDSENTAVNIARQIGI----PVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEH 661
           GD+  TA  IAR   I      + P+ ++  G K   +T  +   ++ ++ + AR++PE 
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAI-EGPKFRTLTKQERIKMLPNLRVMARSSPED 59

Query: 662 KLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFST 721
           K  +V  L+  GDVVA+TGDG NDAPALKLAD+G SMG  GT+VA+EASD+IL  DDF+ 
Sbjct: 60  KRLLVETLKGMGDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFAA 119

Query: 722 ILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNP--LNAMQILWINILMD 779
           I+ AI+ G+ +  +I+ F+ FQL  +I A+ L  +S+         L A+Q+LWIN++MD
Sbjct: 120 IVDAIKWGRCVSISIKKFIQFQLIVNITAVILAFVSSIASEDETSVLTAVQLLWINLIMD 179

Query: 780 GPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIILGTVYVFV---KEMA 836
              A +L  +  D  +M + PR R+  ++     K +I + SC+ L   ++     KE+ 
Sbjct: 180 TLAALALATDKPDPNIMDRKPRGRSTPLIFPSTWK-MILSQSCLQLIVTFILHFNGKEIF 238

Query: 837 EDG--QVTARD----TTMTFTCFVFFDMFNALACR 865
             G  ++T  +      MTF  FV+   F  L  R
Sbjct: 239 FRGRDEITGHEQQQLNAMTFNTFVWLQFFTLLVSR 273

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 80/312 (25%), Positives = 138/312 (44%), Gaps = 49/312 (15%)

Query: 27  KEILEATNAALTKPNPSLEYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISV 86
           K + +  N     P    +Y   S+++ +   +T+ K         T+R + Y  N I  
Sbjct: 450 KSLTQFKNLFQDDPQNLFKYLNSSLQDGIKLTETETK-----NYRHTQRXKLYSDNRIP- 503

Query: 87  DDDESLVKKFLSNFVE---DRLILLLMGSAIISVFLG-------------------NID- 123
              E + K FL    E   D+ +LLL  +A++S  LG                    +D 
Sbjct: 504 ---ERVPKTFLQLIWEAFNDKTMLLLTAAAVVSFVLGLYEALYTPPEYDPEGNPIKKVDW 560

Query: 124 -DAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVP-QECHLIRGGRESNVLATNLVPGD 181
            + I+I +A+++VV VG V +Y+ E     LNK    ++  +IR  +E      NL+ GD
Sbjct: 561 IEGIAIMIAVIVVVFVGAVNDYQKELQFARLNKKKENRKIIVIRNSQELLTSIHNLLVGD 620

Query: 182 LVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVH--------KSYKALSRDSYNDQP 233
           ++  + GD IPAD  ++E     +DES++TGE+D +         K++  ++    NDQ 
Sbjct: 621 IITLQTGDVIPADGVLVE-GQCEVDESSITGESDTIKKVKVFNALKTFDVINEGKSNDQI 679

Query: 234 NSI---VPVAERTNIAYM--GTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQ 288
             I    P  ++     +  G+ +  G G+ I+   G  +  G    M   +E   TPLQ
Sbjct: 680 LDIGFKTPNGDKIPDCMLISGSKLLSGLGKAIITSVGTNSIHGRTM-MALKVEPESTPLQ 738

Query: 289 LTMDKLGKDLSL 300
             + +L   +S+
Sbjct: 739 QRLSQLADSISV 750

>Scas_569.0d
          Length = 468

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/189 (38%), Positives = 121/189 (64%), Gaps = 5/189 (2%)

Query: 630 VLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPAL 689
           V++G + +E+T +Q+ N+     + AR +P+ K+ ++ AL RR    AMTGDGVND+P+L
Sbjct: 81  VMTGSQFDELTPEQIDNLPVLPLVIARCSPQTKVRMIEALHRRDKFCAMTGDGVNDSPSL 140

Query: 690 KLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIA 749
           K+A++G++MG  G+DVAK+ASD++L+DD+F++IL AIEEG+ + +NIQ F+   L+ ++A
Sbjct: 141 KMANVGIAMGINGSDVAKDASDIVLSDDNFASILNAIEEGRRMSDNIQKFVLQLLAENVA 200

Query: 750 ALSLVALSTAFMLPN-----PLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRT 804
               +    AF         PL  +++LWI ++    PA  LG+E    ++M +PP    
Sbjct: 201 QALYLICGLAFQDKEGKSVFPLAPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSK 260

Query: 805 DKILTAELL 813
             I T E++
Sbjct: 261 SGIFTWEII 269

>Scas_665.30
          Length = 1439

 Score =  122 bits (307), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 187/855 (21%), Positives = 334/855 (39%), Gaps = 157/855 (18%)

Query: 114  IISVFLGNIDD----AISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRE 169
            I S+ L ++D+    A  I +  ++ +    V+  R++KSL  ++     E  + R    
Sbjct: 279  IFSIILWSLDEYYYYAGCIFLISILSIVDTLVETRRTQKSLADMSHFA-CEVRVFRDEFW 337

Query: 170  SNVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHK------ 219
            +NV + +LVPGD+  + I D      P D  ++   D  ++ES LTGE+ PV K      
Sbjct: 338  TNVNSADLVPGDI--YEISDPSLTVFPCD-SLLLSGDCIVNESMLTGESVPVSKFPAEPE 394

Query: 220  SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEM 276
            +   L  D  N Q +S +    +   T I        +     +VV TG  T+ G++   
Sbjct: 395  TMLQLLDDFQNTQISSYLSKSFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRS 454

Query: 277  MSSIEKPKTPLQLTMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAA 334
            M    KP T  +   D  K    ++L +              G     M   ++ +    
Sbjct: 455  MV-FPKP-TGFKFYEDSFKYIGVMALIALFGFSISCIQFIKIGLDKRTMILRALDIITIV 512

Query: 335  IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKI 394
            +P  LP  +T+     + R+ K+         V   G ++++C DKTGTLT N + V  +
Sbjct: 513  VPPALPATLTIGTGFALSRLKKKGIFCISPTRVNIGGKIDILCFDKTGTLTENGLDVLGV 572

Query: 395  -WCLGSMANKLNVLSLDK-----------NKGGNLKNYLTDDVKTTLL-CGNL------- 434
              C+ S  N      L +           N   + ++Y   +   +LL C +L       
Sbjct: 573  QLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSSPRDYRAKNFFISLLTCHSLRVVDNEL 632

Query: 435  -----------CNNASYSQE------HAKYLGNPTDVALLEQL---------------QK 462
                           SY ++      H+ Y     D AL E +                 
Sbjct: 633  IGDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENT 692

Query: 463  FELADVRSEYTKVKELSFNSKRKMMATKIQ-DNEKKTTLFIKGAFERILDKSSSYLTEKG 521
            F   D  +    ++   F S+ + M+  ++  NE     F KGA E I        T+  
Sbjct: 693  FIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVI--------TQIC 744

Query: 522  KIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTGL 576
                L A   E +    N    +G RV+A A R +  +    S K+  +++ S++ F G 
Sbjct: 745  NKATLPANFEEML----NYYTHKGYRVIACAGRVLPRNTWLYSQKVSREEVESNMEFLGF 800

Query: 577  IGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----PVIDPKLS--- 629
            I   +  +      +    +  I  +M TGD+  TA+++ RQ  +     V  P L    
Sbjct: 801  IIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEID 860

Query: 630  ---------------------------------------------VLSGDKLNEMTDDQL 644
                                                         ++ GD+ N +++D +
Sbjct: 861  STGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYI 920

Query: 645  ANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTD 704
              V+    I+AR +P+ K  ++  L+R    V   GDG ND  ALK AD+G+S+      
Sbjct: 921  NTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFCGDGANDCGALKAADVGISLSEAEAS 980

Query: 705  VAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPN 764
            VA   +  +    D S +L  I+EG+     + +F  FQ  +  +A+  + ++  +   +
Sbjct: 981  VAAPFTSQVF---DISCVLDVIKEGRACL--VTSFSCFQYMSLYSAIQFITITVLYSRGS 1035

Query: 765  PLNAMQILWINILMDGPPAQSLGV-EPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCI 823
             L   Q L+I++L+  P A  +   +P D  V K+P    +  +++ ++L  L+ +   +
Sbjct: 1036 NLGDFQFLYIDLLLIVPIAIFMSWSKPYDKIVKKRP----SANLVSPKILIPLLASIVVV 1091

Query: 824  ILGTVYVFVKEMAED 838
            +L  +  ++    E+
Sbjct: 1092 LLFQIIPWIIVQGEE 1106

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  122 bits (306), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 199/862 (23%), Positives = 346/862 (40%), Gaps = 172/862 (19%)

Query: 67   SSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLGNIDDAI 126
            SS++E   R   +G N ++      L +K ++  + D  +       I S+ L   DD  
Sbjct: 451  SSIQE--DRTLAFGKNSVN------LKQKTVTEILFDEALHPFYVFQIFSIILWLADDYY 502

Query: 127  SITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQECHL--IRGGRESNVLATNLVPGDLV 183
                 I ++  +  +     ++K+ E L  +    C +   +    + V +++LVPGDL 
Sbjct: 503  YYAGCIFLISVLSIIDTVIETKKNSEKLADISHFNCEVRVYKDRFWTQVNSSDLVPGDL- 561

Query: 184  RFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHKSYKA-------LSRDSYNDQ 232
             F I D     +P D  +I   D  ++ES LTGE+ PV K Y A       L +D  + Q
Sbjct: 562  -FEISDPSLVVLPCDAVLIS-GDCIVNESMLTGESVPVSK-YAATEATMAQLLQDFKSSQ 618

Query: 233  PNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQL 289
             +S V    +   T I  +     +G    +V+ TG  T+ G++   M    KP    + 
Sbjct: 619  VSSFVSKSFLFNGTKIIRVRNQPGQGMALALVIRTGFSTTKGSLVRSMV-FPKP-VGFKF 676

Query: 290  TMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTL 347
              D  K    ++L +              G  +  M   ++ +    +P  LP  +T+  
Sbjct: 677  YEDSFKYIGFMTLIAMFGFSISCIQFIRLGLEYKVMILRALDIITIVVPPALPATLTIGT 736

Query: 348  ALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVL 407
            +  + R+ K+         V   G V+++C DKTGTLT   + V     LG        +
Sbjct: 737  SFALGRLKKKGIFCISPTRVNVGGKVDMMCFDKTGTLTEEGLDV-----LG--------I 783

Query: 408  SLDKNKGGNLKNYLTD---DVKTTLLCGNL--CNNAS--------------YSQEH--AK 446
               K +G +    L+D   D    L    L  CN+A               +S +H   +
Sbjct: 784  HFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFKAKNFLVSLLTCHSLKHIDGE 843

Query: 447  YLGNPTDVALLE----------QLQKFELADVRSEYTK---------------------- 474
             LG+P D+ + E          +  KF+ A+ ++  +                       
Sbjct: 844  LLGDPLDLKMFEFTKWAYEEGYESWKFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGV 903

Query: 475  VKELSFNSKRKMMATKIQDNEKKTTL-FIKGAFERILDKSSSYLTEKGKIEKLTAGHRET 533
            ++   F S+ + M+  ++  ++ T   F KGA E I D  +     K   E L   H  T
Sbjct: 904  IRSFEFLSELRRMSVIVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELL---HHYT 960

Query: 534  IIDCANTLASEGLRVLAFAKRAMTDSS----SKLVEDDISD-LVFTGLIGMNDPPRSSVK 588
                       G R++A A + +  SS     K+  +++ D L F G I   +  +S  K
Sbjct: 961  ---------HNGFRIIACAGKTLPKSSWLYSQKVSREEVEDNLEFLGFIVFENKLKSRTK 1011

Query: 589  FAIDQFLQGGIHIIMITGDSENTAVNIARQIGI--------------------------- 621
             A+ +     I  +M TGD+  TAV++ R  G+                           
Sbjct: 1012 AALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDV 1071

Query: 622  -------------PVIDPKLS---VLSGDKL-----NE--MTDDQLANVIDHVNIFARAT 658
                         P+ DP+ S    ++GD       N+  + DD ++ V+   +I+AR +
Sbjct: 1072 DEEGSVLDAVTLKPLNDPEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMS 1131

Query: 659  PEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718
            P+ K  +V  L++    V   GDG ND  ALK A+IG+S+      VA   +  +    D
Sbjct: 1132 PDEKHELVEQLQKLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVF---D 1188

Query: 719  FSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILM 778
             S +L  I+EG+     + +F  FQ  +  +A+  + ++  +   + L   Q L+I++L+
Sbjct: 1189 ISCVLDVIKEGRASL--VTSFSCFQYMSLYSAIQFITITILYSRGSNLGDFQFLYIDLLL 1246

Query: 779  DGPPAQSLGVEPVDHEVMKKPP 800
              P A S+     + +++KK P
Sbjct: 1247 IVPIAISMSWSKPNSKLVKKRP 1268

>Kwal_26.9207
          Length = 1469

 Score =  115 bits (288), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 212/941 (22%), Positives = 368/941 (39%), Gaps = 158/941 (16%)

Query: 53   ETLHKLD---TDAK-LGLSSVEEA------TKRRQYYGPNEISVDDDESLVKKFLSNFVE 102
            E L K++   TDA  L LSS+++         R   +G N I++    SL   F      
Sbjct: 444  EDLFKINSNWTDADWLSLSSIQKGLPTSVVEDRMLAFGRNNINLKQKTSLEILF------ 497

Query: 103  DRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQEC 161
            D ++       I S+ L   D+       I I+  +  +     ++K+ + L ++    C
Sbjct: 498  DEVLHPFYVFQIFSILLWLADNYYYYAACIFIISMLSIIDTLVETKKTSQRLAEVSHSHC 557

Query: 162  --HLIRGGRESNVLATNLVPGDLVRFRIGD----RIPADIRIIECNDLTIDESNLTGETD 215
               + R G    V ++ LVPGD+  + I D      P D  ++   D  ++ES LTGE+ 
Sbjct: 558  EVRVYRDGFWVQVSSSELVPGDV--YEISDPSLSTFPCD-SLLLSGDCIVNESMLTGESV 614

Query: 216  PVHK------SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGR 266
            PV K      +   L  D    Q ++ +    +   T I  +    ++     +VV TG 
Sbjct: 615  PVSKIPASDETIYQLLEDFQKTQISNFLAKSFLFNGTKIIRVRIGGEQSTALAMVVRTGF 674

Query: 267  ETSFGNVFEMMSSIEKPKTPLQLTMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEMF 324
             T+ G++   M    KP +  +   D  K    ++L +              G ++  M 
Sbjct: 675  STTKGSLLRSMI-FPKP-SGFKFYEDSFKYIGFMTLIALAGFSISCINFIRLGLAYKVMI 732

Query: 325  QISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTGT 383
              ++ +    +P  LP  +++  +  + R+ K+K I    P+ V   G ++V+C DKTGT
Sbjct: 733  LRALDIITIVVPPALPATLSIGASFAIARL-KKKGIFCIAPTRVNVSGKIDVMCFDKTGT 791

Query: 384  LTSNHMTVSKIWCLGSMANK-LNVLSLDKNKGGNLKNY-LTD-----DVKTTLLCGNLCN 436
            LT + + V  +       ++     +L  N  G    Y L D     D K+     +L  
Sbjct: 792  LTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKYSLNDCGSPIDFKSRNFLVSLLT 851

Query: 437  NASYSQEHAKYLGNPTDVALL--------EQLQKFELADVRSEYTKVKELSFNS------ 482
              S      + LG+P D  +         E  Q F+   +  E      L  N+      
Sbjct: 852  CHSLRVVDGELLGDPLDFKMFQFTNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAV 911

Query: 483  ---KRKMMATKIQDNEKKTTLFIKGAFERI--LDKSSSYLTEKGK--IEKLTAGHRETII 535
                 +    K  +N+    L +  +FE +  L + S  +   G+      T G  E I 
Sbjct: 912  VHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVIS 971

Query: 536  DCAN-------------TLASEGLRVLAFAKRAMTDSSSKLV-----EDDISDLVFTGLI 577
            +  N                  G RV+A A + +   + +       E+  S++ F G +
Sbjct: 972  EICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWRFAQKVSREEVESNMEFLGFV 1031

Query: 578  GMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIG--------IPVI----D 625
               +  + S    +      GI  IM TGD+  TA+++ R+ G        +P I    D
Sbjct: 1032 VFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMD 1091

Query: 626  PKLSVL------------------------------SGD------KLNEMTDDQLAN-VI 648
            P   ++                              +GD      K NE+  +   N V+
Sbjct: 1092 PNEDLIIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL 1151

Query: 649  DHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKE 708
               +I+AR +P+ K  +V  L+    VV   GDG ND  ALK AD+GVS+      VA  
Sbjct: 1152 LKSSIYARMSPDEKHELVGQLQGLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAAP 1211

Query: 709  ASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNA 768
             +  +    + S IL  I+EG+       +F  FQ  +  +A+  V ++  +     L  
Sbjct: 1212 FTSSVF---EISCILDVIKEGRASLTT--SFSCFQYMSLYSAIQFVTVTMLYSRGINLGD 1266

Query: 769  MQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCIIL--G 826
             Q L+I++ +  P A  +      H+++KK P   +  +++ ++L  L+   + I++   
Sbjct: 1267 FQFLYIDLFLIVPIAIFMSWSKPYHKLVKKRP---SANLVSPKILAPLVANIAIILVFQA 1323

Query: 827  TVYVFVKEM--------AEDGQVTARDTTMTFTCFVFFDMF 859
            T ++ V+ M          D  V + D T+ F    FF  F
Sbjct: 1324 TPWLVVQAMRWYQAPVVGGDDAVQSSDNTVLF----FFSNF 1360

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 142/595 (23%), Positives = 231/595 (38%), Gaps = 147/595 (24%)

Query: 145 RSEKS--LEALNKLVPQECHLIRGGRESNVLATNLV-PGDLVRFRIGDRIPADIRIIECN 201
           +SE S  +  L  L P  C ++     +  ++  L+ P D+V    G +IPAD  +I  N
Sbjct: 391 KSETSTAMSKLISLTPSSCSIVLPDGSTREISVELLQPNDIVEVVPGMKIPADGVVIR-N 449

Query: 202 DLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIV 261
           +  +DES +TGE+  V K   +       + P      A R                   
Sbjct: 450 ETEVDESLITGESMLVEKIVGSQVIGGSVNGPGHFYFRAIRV------------------ 491

Query: 262 VGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK-------DLS--------LASFXXX 306
              G +T   N+   M   +  K P+Q   DK+          LS        L S+   
Sbjct: 492 ---GEDTKLANIIATMKKAQLSKAPIQKYADKMAGIFVPFVISLSAITFITWMLVSYTMK 548

Query: 307 XXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS 366
                     G+ ++ M Q+S+S+ + A P  L +     + +G    A    +++    
Sbjct: 549 TPPLIFNSENGKFFMCM-QMSISVIIVACPCALGLAAPTAIMVGTGVGASHGVLIKGGDV 607

Query: 367 VETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVK 426
           +E   ++     DKTGTLT+  M+V                        N  NY      
Sbjct: 608 LEKCSALQTFLFDKTGTLTTGRMSVE-----------------------NFINY------ 638

Query: 427 TTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTKVKELSFNSKRKM 486
                     N+  S  H K       ++L E + +  +A     Y      S  +K  +
Sbjct: 639 ----------NSDVSDLHWKM------ISLCESIGEHPVAKAIVNYAD----SHVNKSSI 678

Query: 487 MATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGL 546
               + + E    L  KG    I DK++S      KI  +T G+++              
Sbjct: 679 FDLDLSNEE---VLIGKGISCNITDKNTS------KIHTITIGNKKL------------- 716

Query: 547 RVLAFAKRAMTD-SSSKLVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604
               F   +++D +SS L E  +S D    G   ++D  +    F ++     GI   M+
Sbjct: 717 ----FPDESLSDIASSTLTESYVSIDGSLVGKFEISDRVKEDAHFVVEYLQNLGIKCCMV 772

Query: 605 TGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLN 664
           TGD+  +A+ +A+Q+GI   D                           +F+  TPE K +
Sbjct: 773 TGDAHQSALKVAQQLGISAND---------------------------VFSEVTPEQKRD 805

Query: 665 IVRALRRRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718
           IV  L+  G + VA  GDG+ND+PAL  AD+G+S+   GTD+A EA+D+++ D D
Sbjct: 806 IVIQLQNNGTERVAFVGDGINDSPALVEADLGISISS-GTDIAIEAADIVILDSD 859

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 172/755 (22%), Positives = 308/755 (40%), Gaps = 127/755 (16%)

Query: 160  ECHLIRGGRESNVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETD 215
            E  ++R G  S++ ++ LVPGD+  + I D     +P D  I+   D  ++ES LTGE+ 
Sbjct: 540  EVRVLREGFWSSIHSSELVPGDI--YEISDPNLNLLPCD-SILLSGDCIVNESMLTGESV 596

Query: 216  PVHKSYKALSR---DSYNDQPNSIVPVAERTNIAYMGTLV---KEGNGRGIV----VGTG 265
            PV K Y A        ++D  ++ +      +  + GT +   K  NG  +     V TG
Sbjct: 597  PVSK-YPASEETILQLFDDFQSTQISTFLSKSFLFNGTTLIRAKIPNGGSVALAMAVRTG 655

Query: 266  RETSFGNVFEMMSSIEKPKTPLQLTMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEM 323
              T+ G++   M    KP +  +   D  K    +++ +F             G     M
Sbjct: 656  FSTTKGSLIRSMV-FPKP-SGFKFYSDSFKYIGFMAIIAFFGFSISCINFIKLGLDKRTM 713

Query: 324  FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPS-VETLGSVNVICSDKTG 382
               ++ +    +P  LP  +T+  +  + R+ K K I    P+ V   G ++V+C DKTG
Sbjct: 714  ILRALDIITIVVPPALPATLTIGTSFALNRL-KEKGIFCIAPTRVNIGGKIDVMCFDKTG 772

Query: 383  TLTSNHMTV--SKIWCLGSMANKLNVLSLDKNKGGNLKNYL------TDDVKTTLLCGNL 434
            TLT + + V   ++ C  +  NK +   L  +       +        DD K      +L
Sbjct: 773  TLTEDGLDVLGVRVSC-AATRNKASFSDLISDTHDIFPKFSLKDCSNPDDYKRRNFLISL 831

Query: 435  CNNASYSQEHAKYLGNPTDVALLE-----QLQKFELADVRSEYTKVKE-LSFNSKRKMMA 488
                S      + LG+P D  + +       + F+     S Y +  E  +F     ++ 
Sbjct: 832  LTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIP 891

Query: 489  TKIQDNEK-KTTLFIKGAFERILD--KSSSYLTEKGKIEKL------------TAGHRET 533
              +  N+  +   F++     IL   +S  +L+E  ++  +            T G  E 
Sbjct: 892  AIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEV 951

Query: 534  IIDCAN--TLASE-----------GLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTG 575
            IID  N  TL S+           G RV+A A + +  +    S K+  +++ S++ F G
Sbjct: 952  IIDICNPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLG 1011

Query: 576  LIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI-------------- 621
             I   +  + +    + +     I  +M TGD+  TA+++ ++  +              
Sbjct: 1012 FIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYS 1071

Query: 622  -----PVID------------------------PKLSVLSGDKLNEMTDDQLANVIDHVN 652
                 PVI                         P    ++G+    +  +Q     ++VN
Sbjct: 1072 DMTVQPVIHWNEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVN 1131

Query: 653  -------IFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDV 705
                   IFAR +P+ K  +V  L++    V   GDG ND  ALK AD+G+S+      V
Sbjct: 1132 EILLKGSIFARMSPDEKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASV 1191

Query: 706  AKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNP 765
            A   +  I    D + +L  I+EG+     + +F  FQ  +  +A+  ++++  +   + 
Sbjct: 1192 AAPFTSKIF---DITCVLDVIKEGRASL--VTSFACFQYMSLYSAIQFISITILYSRGSN 1246

Query: 766  LNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPP 800
            L   Q L+I++L+  P A ++      HE+ KK P
Sbjct: 1247 LGDFQFLYIDLLLIIPIAVTMSWSKPYHELAKKRP 1281

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  109 bits (272), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 201/869 (23%), Positives = 344/869 (39%), Gaps = 156/869 (17%)

Query: 114  IISVFLGNIDDAISITMAIVIVVTVGFVQEY-RSEKSLEALNKLVPQEC--HLIRGGRES 170
            I S+ L   D        I I+  +  +     +++S E L++L    C   + R G  S
Sbjct: 491  IFSIILWMFDAYYYYATCIFIISVLSVIDTLVETKQSSERLSELSQFYCDVRVYRDGFWS 550

Query: 171  NVLATNLVPGDLVRFRIGDR----IPADIRIIECNDLTIDESNLTGETDPVHK------S 220
             V +++LVPGD+  + + D     +P D  I+   D  ++ES LTGE+ PV K      +
Sbjct: 551  QVPSSDLVPGDI--YELTDPSLSLLPCD-SILISGDCLVNESMLTGESVPVSKVAATRET 607

Query: 221  YKALSRDSYNDQPNSIVPVAERTNIAYMGT---LVKEGNGRGIVVG----TGRETSFGNV 273
               L  D  + Q +S V      +  + GT    V+   G+ I +G    TG  T+ G++
Sbjct: 608  MLQLLDDFMDTQLSSFV----SKSFLFNGTKLIRVRATAGQSIALGMVARTGFSTTKGSL 663

Query: 274  FEMMSSIEKPKTPLQLTMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLA 331
               M    KP T  +   D  K    +S+ +              G     M   ++ + 
Sbjct: 664  VRSMV-FPKP-TGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRLGLDKRTMILRALDII 721

Query: 332  VAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 391
               +P  LP  +++     + R+ K+         V   G ++V+C DKTGTLT + + V
Sbjct: 722  TVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNVGGKIDVMCFDKTGTLTEDGLDV 781

Query: 392  SKIWCLGSMANKLNVLSL-----DKNKGGNLKNYL-TDDVKTTLLCGNLCNNASYSQEHA 445
              +  +  +  ++ +  L     D  +  +L + + T D+K      +L    S      
Sbjct: 782  LGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSDCVSTRDMKAKNFLVSLLTCHSLRMVDG 841

Query: 446  KYLGNPTDVALLEQLQKFELAD------VRSEYTKVKELSFNSKRKMMATKIQ------- 492
            + LG+P D  ++ Q  K+   +      V S Y +  + S   +    A  I        
Sbjct: 842  ELLGDPFDFKMV-QFTKWSDEEETGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGR 900

Query: 493  --DNEKKTTLFIKGAFERILDKSSSYLTEKGKIE----KLTAGHRETIID-CA------- 538
              + E    + I  +FE + +     +  K   E      T G  E I + C+       
Sbjct: 901  FIEREPSNVIGIVRSFEFLSNLRRMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLD 960

Query: 539  -----NTLASEGLRVLAFAKRAMTDSS----SKLVEDDI-SDLVFTGLIGMNDPPRSSVK 588
                 +     G RV+A A + +T  S     K+  ++I S+L F G I   +  + + K
Sbjct: 961  YEALLHHYTHNGYRVIACAGKKLTRQSWLYSQKVSREEIESNLEFLGFIIFENKLKGTTK 1020

Query: 589  FAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSV------------------ 630
              ++   +  I  IM TGD+  TA+++ R+ G+ V  P++ V                  
Sbjct: 1021 ETLESLHRADIRTIMCTGDNVLTAISVGREAGL-VESPRVFVSVINDIDTSQEGDIITWQ 1079

Query: 631  ----------------LSGD-------------KLNEMTD-DQLANVIDHV----NIFAR 656
                            LSGD             +L   TD  Q+  VI+++    +I+AR
Sbjct: 1080 NVANSSDTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYAR 1139

Query: 657  ATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTD 716
             +P+ K  +V  L+  G  V   GDG ND  ALK ADIG+S+      VA   +  +   
Sbjct: 1140 MSPDEKHELVERLQSIGYQVGFCGDGANDCGALKAADIGISLSEAEASVAAPFTSRLF-- 1197

Query: 717  DDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINI 776
             + S +L  ++EG+     + +F  FQ  +  +A   V +   +   + L   Q L+I++
Sbjct: 1198 -EISCVLDVMKEGRAAL--VTSFACFQYMSLYSATQFVTILILYSRGSNLGDFQFLYIDL 1254

Query: 777  LMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELL--KRLIGTASCIILGTVYVFVKE 834
             +  P A  +        + KK P        TA L+  K LI     I++  V+  V  
Sbjct: 1255 FLIVPLAVFMSWSKPYEVLAKKRP--------TANLVSPKILIPLLVHIVILFVFQLVPW 1306

Query: 835  MA-------------EDGQVTARDTTMTF 850
            +A             +D  V + D T+ F
Sbjct: 1307 LAVQHMKWYRQPVVGDDEHVASSDNTILF 1335

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 193/875 (22%), Positives = 333/875 (38%), Gaps = 157/875 (17%)

Query: 114  IISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEA-LNKLVPQEC--HLIRGGRES 170
            + S+ L  ID+       I ++  +        +K +   L ++    C   ++R    +
Sbjct: 503  VFSIILWGIDEYYYYAACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWT 562

Query: 171  NVLATNLVPGDLVRFRIGDRIPADIRIIECN------DLTIDESNLTGETDPVHK----- 219
             + ++ LVPGD+  + + D    +I I+ C+      D  ++ES LTGE+ PV K     
Sbjct: 563  TISSSELVPGDI--YEVSD---PNITILPCDSILLSSDCIVNESMLTGESVPVSKFPATE 617

Query: 220  -SYKALSRDSYNDQPNSIVP---VAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFE 275
             +   L  D  + Q +S V    +   TNI        +     +VV TG  T+ G++  
Sbjct: 618  ETMYQLCDDFQSTQISSFVSKSFLYNGTNIIRARIAPGQTAALAMVVRTGFSTTKGSLVR 677

Query: 276  MMSSIEKPKTPLQLTMD--KLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVA 333
             M    KP T  +   D  K    +SL +              G     M   ++ +   
Sbjct: 678  SMV-FPKP-TGFKFYRDSFKYIGFMSLIAIFGFCVSCVQFIKLGLDKKTMILRALDIITI 735

Query: 334  AIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393
             +P  LP  +T+     + R+ ++         +   G ++V+C DKTGTLT + + V  
Sbjct: 736  VVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNISGKIDVMCFDKTGTLTEDGLDV-- 793

Query: 394  IWCLGSMANKLNVLSLDKNKGGNL---------KNYLTD-----DVKTTLLCGNLCNNAS 439
               LG   ++ N   +   K G L         K  L D     D K+     +L    S
Sbjct: 794  ---LGVQISEPN--GVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFKSRNFFMSLLTCHS 848

Query: 440  YSQEHAKYLGNPTDVALL--------EQLQKFELA---------DVRSEYTKVKELSFNS 482
                    LG+P D  +         E  QK             DV  E +++     + 
Sbjct: 849  LRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHP 908

Query: 483  KRKMMATKIQDNEKKTTLFIKGAFERILD-KSSSYLTEKGK---IEKLTAGHRETIIDCA 538
                      DN+    L +  +FE + + +  S + +          T G  E I +  
Sbjct: 909  DSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNNDDVYWSFTKGAPEVISEIC 968

Query: 539  N--TLASE-----------GLRVLAFAKRAMTDS----SSKLVEDDI-SDLVFTGLIGMN 580
            N  TL ++           G RV+A A + +       S K+  +++ S+L F G I   
Sbjct: 969  NKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQKVSREEVESNLEFLGFIIFQ 1028

Query: 581  DPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI------------------- 621
            +  +      +       I  IM TGD+  TA+++ R+ G+                   
Sbjct: 1029 NKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGE 1088

Query: 622  PVI------DP------------KLS--------------VLSGDKL-------NEMTDD 642
            PVI      +P            KL                +SGD         NE+ ++
Sbjct: 1089 PVIVWRDVNEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEE 1148

Query: 643  QLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGRMG 702
             L  ++ + +I+AR +P+ K  ++  L++    V   GDG ND  ALK AD+G+S+    
Sbjct: 1149 YLNEILLNSSIYARMSPDEKHELMIQLQKLDYTVGFCGDGANDCGALKAADVGISLSEAE 1208

Query: 703  TDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFML 762
              VA   +  I    + S +L  I EG+     + +F  FQ  +  +A+  + ++  +  
Sbjct: 1209 ASVAAPFTSKIF---NISCVLDVIREGRAAL--VTSFACFQYMSLYSAIQFITITILYSR 1263

Query: 763  PNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKR--TDKILTAEL----LKRL 816
             + L   Q L+I++L+  P A  +       ++ KK P     + KIL   L    L  L
Sbjct: 1264 GSNLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPSANLVSPKILVPLLISVFLVFL 1323

Query: 817  IGTASCIILGTVYVFVKEM-AEDGQVTARDTTMTF 850
                  II+  +  ++K +   D  V + D T+ F
Sbjct: 1324 FQFIPWIIVQKMSWYIKPIVGGDDAVQSSDNTVLF 1358

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 95.5 bits (236), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 155/719 (21%), Positives = 276/719 (38%), Gaps = 149/719 (20%)

Query: 73  TKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITM-A 131
           T  R+ YG NE  +      +  FL  F E  +  L +   +  V L  +D+   +++  
Sbjct: 169 THLRRLYGNNEFDIP-----IPTFLELFKEHAVAPLFVFQ-VFCVALWLLDEYWYLSLFN 222

Query: 132 IVIVVTVGFVQEYRSEKSLEALNKL--VPQECHLIRGGRESNVLATNLVPGDLV---RFR 186
           + +++++     ++   +L+    +   P   +++R G+   +    L+P D+V   R  
Sbjct: 223 LFMILSMEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVVSVVRTA 282

Query: 187 IGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIA 246
               +P D+ +++     ++E+ L+GE+ P+ K    L   +   Q    +   ++ ++ 
Sbjct: 283 EDSALPCDLILVD-GTCIVNEAMLSGESTPLLKESIRLRPGNEELQ----IEGTDKISVL 337

Query: 247 YMGTLV---------------KEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTM 291
           + GT V                +G    IV  TG ETS G++  +M            + 
Sbjct: 338 HGGTKVLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMI----------YSS 387

Query: 292 DKLGKDLSLASFXXXXXXXXXXXXQGRSWLE---MFQISVSLAV-------AAIPEGLPI 341
           +++G D   A +                W+E   M ++   L +       + +P  LP+
Sbjct: 388 ERVGVDNKEALYFILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPM 447

Query: 342 IVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMA 401
            +T+ +   +  ++K          +   G ++V C DKTGTLT   +    +  L S  
Sbjct: 448 ELTMAVNSSLSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGLSSDP 507

Query: 402 NKLNVLSLDKNKGGNLKNYLTDDV--KTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQ 459
             +  L            Y   D    T+L+ G    +A    E  + +G+P + A L+ 
Sbjct: 508 KDIRHL------------YSATDCPNSTSLVVG--AAHALVRLEDGEIVGDPMEKATLKA 553

Query: 460 LQKFELADVRSEYTKVK-ELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLT 518
           L+          +T  K +  FN K             + T+  +  F   L +SSS  T
Sbjct: 554 LK----------WTVEKGDKVFNEKNG-----------QVTILRRFQFSSALKRSSSVAT 592

Query: 519 EKGKIEKLTAGHRETIIDCANTLAS-----------EGLRVLAFAKRAMTDSSSKLVEDD 567
             GK+     G  ETI +   T+ +            G RVLA A + +   S   +ED 
Sbjct: 593 HDGKLYSAVKGAPETIRERLFTIPANYDEIYKSFTRSGSRVLALASKKLEKMSQSQIEDA 652

Query: 568 -----ISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI- 621
                  DL F G +  + P +      I    +     +MITGD+  TAV++A+++GI 
Sbjct: 653 DREHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIV 712

Query: 622 -----------------------------------------PVIDPKLSVLSGDKLNEMT 640
                                                     + D     ++G  L  + 
Sbjct: 713 KGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHALEALK 772

Query: 641 -DDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSM 698
              QL ++I H  I+AR +P  K  I+  L+  G    M GDG ND  ALK A +GV++
Sbjct: 773 GHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMCGDGTNDVGALKQAHVGVAL 831

>Kwal_55.21575
          Length = 989

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 143/591 (24%), Positives = 232/591 (39%), Gaps = 153/591 (25%)

Query: 145 RSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT 204
           ++  SL  L  L P  C +I  G+   +    L  GD V  + G +IP D  IIE  +  
Sbjct: 395 KTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIE-GESE 453

Query: 205 IDESNLTGET--DPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVV 262
           +DES +TGE+   P +K +  ++  S N  PN  +  A                      
Sbjct: 454 VDESLITGESLMVPRYKGFPVIA-GSING-PNRFLLTA---------------------T 490

Query: 263 GTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKD-------LSLASFXXXXXXXXXXXX 315
             G +T    + + M   +  K P+Q   D L          L++ +F            
Sbjct: 491 SVGDDTKLAQIIQTMKQAQLSKAPIQHYADYLASKFVPSVLVLAMITFVTWTILSRVLSN 550

Query: 316 --------QGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSV 367
                    G+ ++   ++++S+ V A P  L +     + +G    AK   +++    +
Sbjct: 551 PPSIFDSPNGKFFI-CLEMTISVIVVACPCALGLAAPTAIMVGTGLGAKHGVLIKGGDIL 609

Query: 368 ETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVKT 427
           E   S+     DKTGTLT+ HMTV +   +G                      + D++ T
Sbjct: 610 EKCSSLETFLFDKTGTLTTGHMTVEQFVPMG----------------------VRDNLTT 647

Query: 428 TLLCGNLCNNASYS-QEHAKYLGNPTDVALLEQLQKF-ELADVRSEYTKVKELSFNSKRK 485
             L   LC NAS +  EH      P   A++E      E  D  +  TK       SK  
Sbjct: 648 EEL---LCINASEAVSEH------PVGKAIVEFTDSLIEDCDRTAVVTK-------SKTI 691

Query: 486 MMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEG 545
           +    I D E              LD         GK   +  G+R  + D   +L+++ 
Sbjct: 692 LGGGLICDCE--------------LD---------GKAYHVVIGNRNVMQD--MSLSADA 726

Query: 546 LRVLAFAKRAMTDSSSKLVED-DISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604
              LA+ K      + +LV   +ISD +           +      +    + G  + M+
Sbjct: 727 SSTLAYVK-----INGELVGRFEISDFI-----------KKDAAEVVQYLTEKGHRVCMV 770

Query: 605 TGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLN 664
           TGD+  +A+ +A ++GI                       AN     N+++  TP  K  
Sbjct: 771 TGDNHKSAMKVALELGIE----------------------AN-----NVYSELTPADKNQ 803

Query: 665 IVRALRRRGDV-VAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714
           +V+ L+  G   VA  GDG+ND+PAL  +D+GVS+   GTD+A EA+D+I+
Sbjct: 804 LVQDLQDGGRKNVAFIGDGINDSPALVTSDLGVSIS-TGTDIAMEAADVII 853

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 167/757 (22%), Positives = 299/757 (39%), Gaps = 171/757 (22%)

Query: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVG---FVQEYRSEKSLE 151
           KF  N      +++ +  A+ ++ +G +   I + +A V+ VT+         R  +  E
Sbjct: 195 KFFYNLY---FLVVALSQAVPALRIGYLSSYI-VPLAFVLTVTMAKEAIDDIQRRRRDRE 250

Query: 152 ALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDE 207
           + N+L     H+I   R  ++ + +L  GDL++   GDRIPAD+ +++ ++ +    I  
Sbjct: 251 SNNELY----HVI--TRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKT 304

Query: 208 SNLTGETD----------------------------PVHKSYKALSRDSYNDQPNSIVPV 239
             L GETD                            P    +K L + +Y D  ++  P+
Sbjct: 305 DQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN--PL 362

Query: 240 AERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP-LQLTMDKLGKDL 298
           +    +     L   G     VV TGR+T       M ++  K KT  L+L ++ + K L
Sbjct: 363 SVDNTLWANTVLASSGFCIACVVYTGRDTRQA----MNTTTAKVKTGLLELEINSISKIL 418

Query: 299 SLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK 358
               F                W       + L    IP  L + + +  ++   ++   K
Sbjct: 419 CACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDK 478

Query: 359 ----AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVL------- 407
                IVR     E LG +  + SDKTGTLT N M + KI  LG+++     L       
Sbjct: 479 TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYV 537

Query: 408 -SLDKNKGGNLKNY----------LTDDVKTTLLCGNLCNNA--SYSQEHAKY-LGNPTD 453
            SL  +K  +L N           ++  V+  +L   +C+N   ++  +   Y   +P +
Sbjct: 538 QSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDE 597

Query: 454 VALLEQLQKFELADVRSE----------------YTKVKELSFNSKRKMMATKIQDNEKK 497
           +A+++  +   L+  + +                Y  ++   FNS  K M   ++D +  
Sbjct: 598 IAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD 657

Query: 498 TTLFIKGAFERILDK---SSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR 554
              F++   + ++ K   S+ +L E+                    +A EGLR L   ++
Sbjct: 658 EYWFMQKGADTVMSKIVESNDWLEEE-----------------TGNMAREGLRTLVIGRK 700

Query: 555 AM------------TDSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSVKFAI 591
            +             D+S  ++  D             DL   GL G+ D  +  VK +I
Sbjct: 701 KLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSI 760

Query: 592 DQFLQGGIHIIMITGDSENTA--VNIARQI---------GIPVIDPKLS----------- 629
           +     GI I M+TGD   TA  V+I+ ++            V  P+ +           
Sbjct: 761 ELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINR 820

Query: 630 ----VLSGDKLN---EMTDDQLANVIDHVN--IFARATPEHKLNIVRALRR-RGDVVAMT 679
               ++ G+ L    +  + +  +V+ H+   I  R TP+ K ++   +R+  G  V   
Sbjct: 821 NACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCI 880

Query: 680 GDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715
           GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 881 GDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 916

>KLLA0C08393g 734655..738101 highly similar to sp|P40527
           Saccharomyces cerevisiae YIL048w NEO1 ATPase whose
           overproduction confers neomycin resistance, start by
           similarity
          Length = 1148

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 161/753 (21%), Positives = 284/753 (37%), Gaps = 169/753 (22%)

Query: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVG------FVQEYRSEK 148
           KF  N      +++ +  AI  + +G +   I + +A V+ VT+         +  R  +
Sbjct: 198 KFFFNLY---FLIVALSQAIPQLRIGYLSSYI-VPLAFVLTVTMSKEAMDDINRRKRDRE 253

Query: 149 SLEALNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT---- 204
           +   L ++V + C          + + +L  GD+++ + G R+PAD+ +++ N+      
Sbjct: 254 ANNELYEVVNKPC---------PIPSKDLKVGDIIKLKKGARVPADVVVLQTNEPNGESF 304

Query: 205 IDESNLTGETD----------------------------PVHKSYKALSRDSYNDQPNSI 236
           I    L GETD                            P H  +  L + +Y D  +S 
Sbjct: 305 IKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFLGKITYKDSTSS- 363

Query: 237 VPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPL-QLTMDKLG 295
            P++    +     L         +V TGRET       + ++  K KT L +L ++ L 
Sbjct: 364 -PLSVDNTMWENTVLASSAACICCIVYTGRETRQA----LNTTKSKAKTGLLELEINGLS 418

Query: 296 KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMA 355
           K L    F                W       + L    IP  L + + +  ++   ++ 
Sbjct: 419 KILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE 478

Query: 356 KRK----AIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMA---------- 401
             K     IVR     E LG +  + SDKTGTLT N M + KI  LG+++          
Sbjct: 479 HDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTNETMDIVT 537

Query: 402 ------NKLNVLSLDKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDV 454
                 N     S       N+ + + D V T  +C N+    ++      Y   +P ++
Sbjct: 538 DFIQSMNSRTSNSTPTTTRKNISDRVIDLVTTLAICHNV--TPTFEDGELTYQAASPDEI 595

Query: 455 ALLEQLQKFELADVRS----------------EYTKVKELSFNSKRKMMATKIQDNEKKT 498
           A+++  +   L+  R                 EY       FNS  K M   I D  K+ 
Sbjct: 596 AIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQE 655

Query: 499 TLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTD 558
             F++   + ++   SS +     +E+ T+            +A+EGLR L   ++ ++ 
Sbjct: 656 YWFLQKGADTVM---SSIVVRNDWLEEETSN-----------MATEGLRTLVIGRKKLST 701

Query: 559 SSSKLVEDDIS-----------------------DLVFTGLIGMNDPPRSSVKFAIDQFL 595
           +  +  E + S                       DL   GL G+ D  +  VK +I+   
Sbjct: 702 NLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLR 761

Query: 596 QGGIHIIMITGDSENTA---------------VNIARQIGIP-----------VIDPKLS 629
             GI I M+TGD   TA               V+   ++  P           V      
Sbjct: 762 NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCL 821

Query: 630 VLSGDKLN---EMTDDQLANVIDHVN--IFARATPEHKLNIVRALRR-RGDVVAMTGDGV 683
           ++ G+ L    +   D+  +++ ++   +  R TP+ K ++   +R+  G  V   GDG 
Sbjct: 822 LIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGG 881

Query: 684 NDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715
           ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 882 NDVSMIQCADVGVGIVGKEGKQ-ASLAADFSIT 913

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 141/621 (22%), Positives = 242/621 (38%), Gaps = 120/621 (19%)

Query: 158 PQECHLIRGGRESNVLATNLVPGDLVRF-RIGDR--IPADIRIIECNDLTIDESNLTGET 214
           P   ++ R  +   +    L+P DLV   R  +   IP D+ +++ + + ++E+ L+GE+
Sbjct: 253 PYTINVFRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILLDGSAI-VNEAMLSGES 311

Query: 215 DPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLV---------------KEGNGRG 259
            P+ K    L     N Q + +    ++  + + GT                  +G    
Sbjct: 312 TPLLKESIKLRPSEDNLQLDGV----DKIAVLHGGTKALQVTPPEHKSDIPPPPDGGALA 367

Query: 260 IVVGTGRETSFGNVFE-MMSSIEK----PKTPLQLTMDKLGKDLSLASFXXXXXXXXXXX 314
           IV  TG ETS G++   M+ S E+     K  L   +  L   + +AS+           
Sbjct: 368 IVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFAV-IASWYVWVEGTKMGR 426

Query: 315 XQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVN 374
            Q +  L+   I  S+    +P  LP+ +T+ +   +  +AK          +   G ++
Sbjct: 427 IQSKLILDCILIITSV----VPPELPMELTMAVNSSLAALAKFYVYCTEPFRIPFAGRID 482

Query: 375 VICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVKTTLLCGNL 434
           V C DKTGTLT   +              L  +S D     +L +       T L+ G  
Sbjct: 483 VCCFDKTGTLTGEDLVF----------EGLAGISADSENIRHLYSAAEAPESTILVIG-- 530

Query: 435 CNNASYSQEHAKYLGNPTDVALLEQLQKFELADVRSEYTK-------VKELSFNSKRKMM 487
             +A    E    +G+P + A L+ +  + +    S Y +       ++   F+S  K  
Sbjct: 531 AAHALVKLEDGDIVGDPMEKATLKAV-GWAVERKNSNYREGTGKLDIIRRFQFSSALKRS 589

Query: 488 ATKIQDNEKKTTLF--IKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEG 545
           A+    N+    LF  +KGA E I ++ S       +I K              +    G
Sbjct: 590 ASIASHND---ALFAAVKGAPETIRERLSDIPKNYDEIYK--------------SFTRSG 632

Query: 546 LRVLAFAKRAMTDSSSKLVED----DI-SDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIH 600
            RVLA A +++   S   ++D    D+ S+L F G +  + P +      I    +    
Sbjct: 633 SRVLALASKSLPKMSQSKIDDLNRDDVESELTFNGFLIFHCPLKDDAIETIKMLNESSHR 692

Query: 601 IIMITGDSENTAVNIARQIGIPV-----------------------------IDPKLSVL 631
            IMITGD+  TAV++A+++GI                                DP     
Sbjct: 693 SIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTF 752

Query: 632 SGDKLNEMTD--------------DQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVA 677
              KL +  D               QL +++ H  ++AR +P  K  ++  L+  G    
Sbjct: 753 DHSKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTL 812

Query: 678 MTGDGVNDAPALKLADIGVSM 698
           M GDG ND  ALK A +G+++
Sbjct: 813 MCGDGTNDVGALKQAHVGIAL 833

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH]
           (544854..548354) [3501 bp, 1166 aa]
          Length = 1166

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 155/677 (22%), Positives = 258/677 (38%), Gaps = 161/677 (23%)

Query: 172 VLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDESNLTGETDPVHKSYKALSRD 227
           V + NL  GDLV+     RIPAD+ +++ ++ +    +    L GETD   +   +L+++
Sbjct: 283 VPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQN 342

Query: 228 SYNDQPNSIVPVA----ERTNIAYMGTLVKEGNGR---------------------GIVV 262
              D+  + V +     E++   + G L  +G+                         V+
Sbjct: 343 LTQDEMLTKVHITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACVI 402

Query: 263 GTGRETSFGNVFEMMSSIEKPKTPL-QLTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWL 321
            TG +T       M +S    KT L +L ++ L K L +  F                W 
Sbjct: 403 YTGTDTRQA----MNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWY 458

Query: 322 EMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSV 373
               + +   +      +P+ + V L LG    A++          IVR     E LG +
Sbjct: 459 ----VDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRI 514

Query: 374 NVICSDKTGTLTSNHMTVSKIWCLGSMA----------NKLNVLSLDKNKGG-------- 415
             + SDKTGTLT N M + KI  LG+++          + +  L+   N G         
Sbjct: 515 EYLLSDKTGTLTQNDMQLRKI-HLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGS 573

Query: 416 --NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQLQK----------- 462
              +   + D V T   C N+  N     E A    +P ++A+++  ++           
Sbjct: 574 RKEVSQRVRDLVVTLATCHNVTPNFE-DNELAYQAASPDEIAIVKFTERVGLSLFKRDRH 632

Query: 463 -----FELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDK---SS 514
                 E + V  +Y  +    F S  K M   ++D  K    F++   + ++ K   S+
Sbjct: 633 SLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSN 692

Query: 515 SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT------------DSSSK 562
            +L E+                  + +A EGLR L  A++ ++            D+S  
Sbjct: 693 DWLEEE-----------------VSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735

Query: 563 LVEDDIS-----------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611
           ++  D +           +L   GL G+ D  +  VK +I+     G+ I M+TGD   T
Sbjct: 736 MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795

Query: 612 AVN-------IARQIGIPVI------DPKLSVLSGDKLNE-----MTDDQLANVIDH--- 650
           A         I+R   +  I      D  LS L   K N      +  D LA  + H   
Sbjct: 796 ARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA 855

Query: 651 ----------VNIFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM- 698
                     V I  R TP+ K ++   +R   G  V   GDG ND   ++ AD+GV + 
Sbjct: 856 EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIV 915

Query: 699 GRMGTDVAKEASDMILT 715
           G+ G   A  A+D  +T
Sbjct: 916 GKEGKQ-ASLAADYSIT 931

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
           cerevisiae YIL048w NEO1 ATPase whose overproduction
           confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 151/670 (22%), Positives = 259/670 (38%), Gaps = 135/670 (20%)

Query: 167 GRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDESNLTGETD------- 215
           GR   V + +L  GDL++   G R+PAD+ +++ ++ +    I    L GETD       
Sbjct: 254 GRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIAC 313

Query: 216 ---------------------PVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGT-LVK 253
                                P    +  L R +Y D   S + +    N  +  T L  
Sbjct: 314 TLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGLTI---DNTLWANTVLAS 370

Query: 254 EGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP-LQLTMDKLGKDLSLASFXXXXXXXXX 312
            G   G V+ TGR+T       M ++  K KT  L+L ++ + K L    F         
Sbjct: 371 SGFCIGCVIYTGRDTRQA----MNTTSAKVKTGLLELEINDISKILCACVFILSILLVVF 426

Query: 313 XXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRK----AIVRRLPSVE 368
                  W       + L    IP  L + + +  ++   ++   K     IVR     E
Sbjct: 427 AGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPE 486

Query: 369 TLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLN--------VLSLDKNKGGNLKN- 419
            LG +  + SDKTGTLT N M + K+  LG+++            +  + ++K  ++ N 
Sbjct: 487 DLGRIEYLLSDKTGTLTQNDMQLKKV-HLGNVSYTTETADIVSDYIQGMIESKNDSVTNL 545

Query: 420 ------------YLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDVALLEQLQKFELA 466
                       ++ D + T  +C N+    ++  +   Y   +P ++A+++  +   L+
Sbjct: 546 GPRSTTRKDAATHVIDLITTLAICHNV--TPTFEDDELTYQAASPDEIAIVKFTESVGLS 603

Query: 467 DVRSE----------------YTKVKELSFNSKRKMMATKIQDNEKKTTLFI-KGA---F 506
             + +                Y  +    FNS  K M   + D +K    F+ KGA    
Sbjct: 604 LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVM 663

Query: 507 ERILDKSSSYLTEKGKIEK-----LTAGHRETIIDCANTLASEGLRVLAFA---KRAMTD 558
            RI+  +     E G + +     L  G ++           E   V A     ++ M +
Sbjct: 664 NRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMAN 723

Query: 559 SSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA------ 612
           + SK +E D+  L   GL G+ D  +  VK +I+     GI I M+TGD   TA      
Sbjct: 724 TISKYLEHDLELL---GLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 780

Query: 613 ---------VNIARQIGIP-----------VIDPKLSVLSGDKLN---EMTDDQLANVID 649
                    V++  ++  P           V      ++ G+ L    +    +  +V+ 
Sbjct: 781 AKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVV 840

Query: 650 HVN--IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDV 705
           H+   I  R TP+ K ++   +R   G  V   GDG ND   ++ AD+GV + G+ G   
Sbjct: 841 HLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ- 899

Query: 706 AKEASDMILT 715
           A  A+D  +T
Sbjct: 900 ASLAADFSIT 909

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 173/772 (22%), Positives = 294/772 (38%), Gaps = 205/772 (26%)

Query: 95  KFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGF-----VQEYRSEKS 149
           KF  N      +L+ +  AI ++ +G +   I + +A V++VT+       +Q  + +K 
Sbjct: 191 KFFFNLY---FLLVALSQAIPALRIGYLSSYI-VPLAFVLMVTMSKEAMDDIQRRQRDKE 246

Query: 150 -----LEALNK--LVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECND 202
                 E LNK  LVP +               +L  GDL++   G RIPAD+ +++ ++
Sbjct: 247 SNNELYEVLNKAQLVPSK---------------DLKVGDLIKIHKGTRIPADLVLLQSSE 291

Query: 203 LT----IDESNLTGETD----------------------------PVHKSYKALSRDSYN 230
            +    I    L GETD                            P    ++ L + +Y 
Sbjct: 292 PSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLTYK 351

Query: 231 DQPNSIVPVAERTNIAYMGT-LVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPL-Q 288
           D  ++ + V    N  +  T L   G+  G VV TG +T       M +++   KT L +
Sbjct: 352 DSSSNALSV---DNTMWANTVLASVGSCIGCVVYTGTDTRQA----MNTTMSSVKTGLLE 404

Query: 289 LTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLA 348
           L ++ L K L    F              + W     + +   +      +P+ + V L 
Sbjct: 405 LEINSLSKILCACVFVLSIVLVAFAGFGNKDWY----VDIMRYLILFSTIIPVSLRVNLD 460

Query: 349 LGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSM 400
           LG    A++          IVR     E LG +  + SDKTGTLT N M + K+  LG++
Sbjct: 461 LGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKL-HLGTV 519

Query: 401 ANKLNVLSL------------------DKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQ 442
           +  ++ + +                        +L N + D V T  +C N+    ++  
Sbjct: 520 SYTMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNV--TPTFED 577

Query: 443 EHAKY-LGNPTDVALLEQLQKFELA----DVRS------------EYTKVKELSFNSKRK 485
               Y   +P ++A+++  +   L+    D  S            EY  ++   FNS  K
Sbjct: 578 GELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTK 637

Query: 486 MMATKIQDNEKKTTLFI-KGA---FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTL 541
            M   + D  K    F+ KGA     RI+ +S+ +L E+                    +
Sbjct: 638 RMGIIVYDKVKGEHWFMQKGADTVMARIV-QSNDWLDEE-----------------VGNM 679

Query: 542 ASEGLRVLAFAKRAMTDSSSKLVEDDISD-----------------------LVFTGLIG 578
           A EGLR L   ++ ++  S +    +  D                       L   GL G
Sbjct: 680 AREGLRTLVIGRKKLSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTG 739

Query: 579 MNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA---------------VNIARQIGIPV 623
           + D  ++ VK +I+     G+ I M+TGD   TA               V+   ++  P 
Sbjct: 740 VEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRP- 798

Query: 624 IDPKLSVLSGDKLNEMT-----------------DDQLANVIDHVNIFA-RATPEHKLNI 665
            +  L+ L   K+N+ +                  +    V+D   + A R TP+ K ++
Sbjct: 799 -EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADV 857

Query: 666 VRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMILT 715
              +R   G  V   GDG ND   ++ AD+GV + G+ G   A  A+D  +T
Sbjct: 858 ALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSVT 908

>Scas_583.14*
          Length = 875

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 102/425 (24%), Positives = 167/425 (39%), Gaps = 95/425 (22%)

Query: 335 IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKI 394
           +P  LP+ +T+ +   +  ++K          +   G ++V C DKTGTLT   +    +
Sbjct: 97  VPPELPMELTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGL 156

Query: 395 WCLGSMANKLNVLSLDKNKGGNLKNYLTDDV--KTTLLCGNLCNNASYSQEHAKYLGNPT 452
             L   +  +  L            + ++D   +T L+ G    +A    +  + +G+P 
Sbjct: 157 AGLSDKSEDVRHL------------FSSEDASQETILVVG--AAHALVKLDDGEIVGDPM 202

Query: 453 DVALLEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDK 512
           + A L+ L             KV+   F S+ K           K  +  +  F   L +
Sbjct: 203 EKATLKALG-----------WKVEGNDFTSRPKT---------GKLQILRRFQFSSALKR 242

Query: 513 SSSYLTEKGKIEKLTAGHRETIID-----------CANTLASEGLRVLAFAKRAMTDSSS 561
           SSS  + K K+     G  ETI +              +    G RVLA A +++ + SS
Sbjct: 243 SSSVASHKDKLFTAVKGAPETIRERLAVVPKNYDEIYKSFTRSGSRVLALASKSLPNLSS 302

Query: 562 KLVEDDISD-----LVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIA 616
           K ++D   D     L F G +  + P +      I    +     IMITGD+  TAV++A
Sbjct: 303 KQLDDLDRDEIETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVA 362

Query: 617 RQIGI------------PVIDPKL------------------------------SVLSGD 634
           +++ I             V D KL                                ++G 
Sbjct: 363 KEVAIVTGETLILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGY 422

Query: 635 KLNEMTD-DQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLAD 693
            LN + D  QL ++I H  ++AR +P  K  I+  L+  G    M GDG ND  ALK A 
Sbjct: 423 ALNLLEDHSQLKDLIRHTWVYARVSPSQKEFILNNLKEMGYQTLMCGDGTNDVGALKQAH 482

Query: 694 IGVSM 698
           +GV++
Sbjct: 483 VGVAL 487

>Kwal_23.5789
          Length = 1133

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 177/787 (22%), Positives = 296/787 (37%), Gaps = 189/787 (24%)

Query: 76  RQYYGPNEIS--VDDDESLVKKFLSN----FVEDRLILLLMGSAIISVFLGNIDDAISIT 129
           R  Y PN IS    +  + + K L      F     +L+ +  AI ++ +G +   I + 
Sbjct: 153 RYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYI-VP 211

Query: 130 MAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLA-TNLVP------GDL 182
           +A V+ VT+          S EAL+ +  +            VL+ + LVP      GDL
Sbjct: 212 LAFVLTVTM----------SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDL 261

Query: 183 VRFRIGDRIPADIRIIECND----LTIDESNLTGETD-------PVHKSYKALSRDSYND 231
           ++   G R PAD+ +++ ++    + I    L GETD       P+ +    LS+D    
Sbjct: 262 IKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQH---LSQDDLLY 318

Query: 232 QPNSIVPVAERTNIAYMGTL----------------------VKEGNGRGIVVGTGRETS 269
           + +    V E++   ++G L                         G     VV TG +T 
Sbjct: 319 RISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTR 378

Query: 270 FGNVFEMMSSIEKPKTPL-QLTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISV 328
                 M +S+   KT L +L ++ L K L    F                W     + +
Sbjct: 379 QA----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWY----VDI 430

Query: 329 SLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDK 380
              +      +P+ + V L LG    A +        + IVR     E LG +  + SDK
Sbjct: 431 MRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDK 490

Query: 381 TGTLTSNHMTVSKIWCLGS-----------------MANKLNVLSLDKNKGGNLKNYLTD 423
           TGTLT N M + K+  LG+                 M++ LN  ++      +L   + D
Sbjct: 491 TGTLTQNDMELKKL-HLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRD 549

Query: 424 DVKTTLLCGNLCNNASYSQEHAKY-LGNPTDVALLEQLQKFELADVRS------------ 470
            V T  LC  +    ++      Y   +P ++A+++  +   L   R             
Sbjct: 550 LVLTLALCHQV--TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQS 607

Query: 471 ----EYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKL 526
               EY  +    FNS  K M   I D +K    F++   + ++ K    + +K    + 
Sbjct: 608 GTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSK----IVQKNDWLEE 663

Query: 527 TAGHRETIIDCANTLASEGLRVLAFAKRAMT------------DSSSKLVEDDIS----- 569
             G+          LA EGLR L   ++ ++            D+S  ++  +++     
Sbjct: 664 ETGN----------LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVI 713

Query: 570 ------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA----------- 612
                 DL   GL G+ D  +  VK +I+     GI I M+TGD   TA           
Sbjct: 714 SKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVS 773

Query: 613 ----VNIARQIGIPVIDPKLSVLSGDKLN----------------EMTDDQLANVIDHVN 652
               V+   ++  P  +  L+ L   K+N                E    Q   ++ ++ 
Sbjct: 774 RGQYVHTVTKVNKP--EGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLP 831

Query: 653 --IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKE 708
             I  R TP+ K ++   +R   G  V   GDG ND   ++ AD+GV + G+ G   A  
Sbjct: 832 AVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQ-ASL 890

Query: 709 ASDMILT 715
           A+D  +T
Sbjct: 891 AADFSIT 897

>Scas_704.38
          Length = 1161

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 153/687 (22%), Positives = 257/687 (37%), Gaps = 176/687 (25%)

Query: 172 VLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDESNLTGETD------------ 215
           V + +L  GDL++   GDR+PAD+ +++ ++ +    I    L GETD            
Sbjct: 275 VPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQN 334

Query: 216 ----------------PVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRG 259
                           P    +  L + +Y D  ++  P++    +     L   G   G
Sbjct: 335 LTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN--PLSIDNTLWANTVLASTGFCIG 392

Query: 260 IVVGTGRETSFGNVFEMMSSIEKPKTPL-QLTMDKLGKDLSLASFXXXXXXXXXXXXQGR 318
            VV TGR+T       M ++    KT L +L ++ + K L  + F               
Sbjct: 393 CVVYTGRDTRQA----MNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNS 448

Query: 319 SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETL 370
            W     + V   +      +P+ + V L L     A +        + IVR     E L
Sbjct: 449 DWY----LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDL 504

Query: 371 GSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSL-------------DKNKGG-- 415
           G +  + SDKTGTLT N M + KI  LG+++     L +               N  G  
Sbjct: 505 GRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKS 563

Query: 416 -------NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDVALLEQLQKFELAD 467
                  +L   + D V T  +C N+    ++  +   Y   +P ++A+++  +   L+ 
Sbjct: 564 VPSTSRKDLSARVRDMVVTLAICHNV--TPTFEDDELTYQAASPDEIAIVKFTESVGLSL 621

Query: 468 VRSE----------------YTKVKELSFNSKRKMMATKIQDNEKKTTLFI-KGA---FE 507
            + +                Y  ++   FNS  K M   + D +K    F+ KGA     
Sbjct: 622 FKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMA 681

Query: 508 RILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT---------- 557
           RI++ +     E G                   +A EGLR L   ++ ++          
Sbjct: 682 RIVENNDWLEEETG------------------NMAREGLRTLVVGRKKLSRNIYDQFKKD 723

Query: 558 --DSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604
             D+S  +V  D             DL   GL G+ D  ++ VK +I+     GI I M+
Sbjct: 724 YDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWML 783

Query: 605 TGDSENTA---------------VNIARQIGIPVIDPKLSVLSGDKLNE-----MTDDQL 644
           TGD   TA               V+I  ++  P  +  L+ L   K+N+     +  + L
Sbjct: 784 TGDKVETARCVSISAKLISRGQYVHIITKLTKP--EGALNQLEYLKVNKGACLLIDGESL 841

Query: 645 ANVIDHVN-------------IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALK 690
              + +               +  R TP+ K ++   +R   G  V   GDG ND   ++
Sbjct: 842 GMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQ 901

Query: 691 LADIGVSM-GRMGTDVAKEASDMILTD 716
            AD+GV + G+ G   A  A+D  +T+
Sbjct: 902 CADVGVGIVGKEGKQ-ASLAADFSITE 927

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 139/626 (22%), Positives = 239/626 (38%), Gaps = 129/626 (20%)

Query: 158 PQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTID------ESNLT 211
           P   ++ R  +   +    L+P DL+     D   A    + C+ + +D      E+ L+
Sbjct: 253 PYGINVFRDSKWQLLQTNELLPMDLISVTRTDEDSA----LSCDMILVDGTCIVNEAMLS 308

Query: 212 GETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLV----------------KEG 255
           GE+ P+ K    L       Q   +    ++ ++ + GT V                 +G
Sbjct: 309 GESTPLLKESVKLRSSEEKLQVEGL----DKNSVLHGGTKVLQVTAPEKGSSSIPAPPDG 364

Query: 256 NGRGIVVGTGRETSFGNVFE-MMSSIEK----PKTPLQLTMDKLGKDLSLASFXXXXXXX 310
               +V  TG ETS G +   M+ S E+     K  L   +  L   ++ AS+       
Sbjct: 365 GALAVVSKTGFETSQGALVRVMIYSSERVSVGNKEALYFILFLLIFAIA-ASWYVWVEGT 423

Query: 311 XXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETL 370
                Q +  L+   I  S+  + +P  L + V  +LA+    ++K          +   
Sbjct: 424 RMGRVQSKLILDCILIITSVVPSELPMELTMAVNNSLAV----LSKFYVYCTEPFRIPLA 479

Query: 371 GSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVKTTLL 430
           G ++V C DKTGTLT   +    +  L      +N L     KG  +       + T L+
Sbjct: 480 GRIDVCCFDKTGTLTGEDLVFEGLAGLAGKNQPVNHLF----KGTEVP------LDTNLV 529

Query: 431 CGNLCNNASYSQEHAKYLGNPTDVALL----------EQLQKFELADVRSEYTKVKELSF 480
            G    +A    +  + +G+P + A L          + L   ++ D+    + ++   F
Sbjct: 530 IG--AAHALVRLDDDEVVGDPMEKATLAATGWKVGVKDSLSNEKVGDI----SILRRFQF 583

Query: 481 NSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANT 540
           +S  K  +T    N++  +  +KGA E I ++ S   T+  ++ K              +
Sbjct: 584 SSALKRSSTIAVHNKQHYSA-VKGAPETIRERLSQVPTDYDQVYK--------------S 628

Query: 541 LASEGLRVLAFAKRAMTDSSSKLVED-----DISDLVFTGLIGMNDPPRSSVKFAIDQFL 595
               G RVLA A + +   S K +E        SDL F G +  + P +      I    
Sbjct: 629 FTRAGSRVLALASKKLPSMSIKQIEKLEREAVESDLEFKGFLVFHCPLKDDAIETIKMLN 688

Query: 596 QGGIHIIMITGDSENTAVNIARQIGI----------PV-------------------IDP 626
           +     IMITGD+  TAV++A+++ I          P+                    +P
Sbjct: 689 ESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFRNIEETIVNPFNP 748

Query: 627 KLSVLSGDKLNEMTD--------------DQLANVIDHVNIFARATPEHKLNIVRALRRR 672
           +       KL    D               QL  +I H  ++AR +P  K  I+ +L+  
Sbjct: 749 EKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLNELIRHTWVYARVSPAQKEFIMNSLKDM 808

Query: 673 GDVVAMTGDGVNDAPALKLADIGVSM 698
           G    M GDG ND  ALK A +G+++
Sbjct: 809 GYQTLMCGDGTNDVGALKQAHVGIAL 834

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 153/707 (21%), Positives = 270/707 (38%), Gaps = 126/707 (17%)

Query: 73  TKRRQYYGPNEISVDDDESLVKKFLSNFVEDRLILLLMGSAIISVFLGNIDDAISITM-- 130
           T  ++ YG N   +      +  FL  F E  +    +   +  V L   DD    ++  
Sbjct: 170 THHKRLYGENSFDIP-----IPTFLELFKEHAVAPFFIFQ-LFCVALWLFDDLWYYSLFN 223

Query: 131 --AIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESNVLATNLVPGDLV---RF 185
              IV +      Q   + K    +  + P   ++ R G+   +    L P DLV   R 
Sbjct: 224 LFMIVAMEATSVFQRLTTLKEFRTMG-IKPYAINVFRDGKWVEMQTDKLFPMDLVSITRT 282

Query: 186 RIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNI 245
                IP D+ +I+     ++E+ L+GE+ P+ K  +++     NDQ    +   ++  +
Sbjct: 283 AEDSAIPCDLLLID-GSCIVNEAMLSGESTPLLK--ESIKLRPANDQLQ--LDGVDKNAV 337

Query: 246 AYMGTLV---------------KEGNGRGIVVGTGRETSFGNVFE-MMSSIEK----PKT 285
            + GT                  +G    +V  TG ETS G++   M+ S E+     K 
Sbjct: 338 LHGGTKALQVTAPENRTGVITPPDGGALAVVTKTGFETSQGSLVRVMIFSAERVDVGNKE 397

Query: 286 PLQLTMDKLGKDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTV 345
            L   +  L   + +AS+            Q +  L+   I  S+    +P  LP+ +T+
Sbjct: 398 ALYFILFLLIFAI-VASWYVWKEGTRMGRIQSKLILDCILIITSV----VPPELPMELTM 452

Query: 346 TLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLN 405
            +   +  ++K          +   G ++V C DKTGTLT+  +       L  + +  +
Sbjct: 453 AVNSSLAALSKFYVYCTEPFRIPYAGRIDVCCFDKTGTLTAEDLVFEG---LAGLHDGSD 509

Query: 406 VLSLDKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLE-QLQKFE 464
           + +L   K  N       D    +L      +A    +  + +G+P + A L+      +
Sbjct: 510 IRTL---KSAN-------DASQEVLSAIGAAHALVKLDDGEIVGDPMEKATLKASSWTVD 559

Query: 465 LADVRSEYTK-----VKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTE 519
             DV           ++   F+S  K  A+ I     +    +KGA E I ++ +S  ++
Sbjct: 560 FKDVVKRAGADNIRILRRFQFSSSLKRSAS-IASQSNRFFAAVKGAPETIRERLNSVPSD 618

Query: 520 KGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVE----DDI-SDLVFT 574
              I K              +    G RVLA A + +   S+  ++    D+I + L F 
Sbjct: 619 YDDIYK--------------SFTRSGSRVLALAYKDLPKMSNSQIDNIDRDEIETGLTFG 664

Query: 575 GLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGI----------PV- 623
             +  + P +      I    +     IMITGD+  TAV++A+++GI          P+ 
Sbjct: 665 AFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDEPID 724

Query: 624 ------------------IDPKLSVLSGDKLNEMTD--------------DQLANVIDHV 651
                              +P        ++ +  D               QL +VI H 
Sbjct: 725 GSSHALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDVIRHT 784

Query: 652 NIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSM 698
            I+AR +P  K  I+  L+  G    M GDG ND  ALK A +G+++
Sbjct: 785 WIYARVSPSQKEFILITLKDMGYQTLMCGDGTNDVGALKQAHVGIAL 831

>Scas_615.9
          Length = 942

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 87/178 (48%), Gaps = 41/178 (23%)

Query: 553 KRAMTDSSSKLVEDDISDLVFTGLIGMNDP------PRSSVK---FAIDQFLQGGIH--I 601
           K  MTDS      D+ SD      + +ND        R SVK     I Q+LQG +H  I
Sbjct: 664 KALMTDSMFDSNSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQG-LHYDI 722

Query: 602 IMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEH 661
            M+TGDS   A+ +A+Q+GI                       AN     N+++  TP  
Sbjct: 723 YMVTGDSHGAAMKVAQQVGIA----------------------AN-----NVYSGVTPSG 755

Query: 662 KLNIVRALRRRG-DVVAMTGDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDD 718
           K  IV +L+      VA  GDG+ND+P L  +DIGV++   GTD+A EA+D+++  +D
Sbjct: 756 KCEIVESLQADSVGGVAFVGDGINDSPVLVTSDIGVAL-STGTDIAMEAADIVVLGND 812

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 113/274 (41%), Gaps = 52/274 (18%)

Query: 145 RSEKSLEALNKLVPQECHLIRGGR---------ESNVLATNLVPGDLVRFRIGDRIPADI 195
           ++  SL  L +L P +C +++            E+N+L  N    D++  + G +IPAD 
Sbjct: 342 QTSSSLSKLIQLTPSKCIILQDKNNIQSSHIEIETNLLQRN----DIIEIKPGMKIPADG 397

Query: 196 RIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEG 255
            II+  +  IDES +TGE+  VHK                     ++ +    G+L   G
Sbjct: 398 IIIQ-GESEIDESLMTGESILVHK---------------------QKGSQVIAGSLNGPG 435

Query: 256 NGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK----------------DLS 299
           +     +  G +T    + + M S +  K P+Q   D L                   ++
Sbjct: 436 HFYFKAINIGDDTKLAQIIQTMKSAQLNKAPIQNNADYLASIFVPTILCLSIITFITWIT 495

Query: 300 LASFXXXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA 359
           L++              G+ +   FQI++S+ V A P  L +     + +G    A+   
Sbjct: 496 LSNLLTKPPVIFTNNNNGKFYTS-FQIAISVIVVACPCALGLATPTAIMVGTGIGAQHGV 554

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393
           +++    +E   ++  I  DKTGT+T+  MTV +
Sbjct: 555 LIKGGDILERFNTITKIVFDKTGTITTGQMTVQR 588

>ACR086C [1133] [Homologous to ScYDR270W (CCC2) - SH]
           (511968..514400) [2433 bp, 810 aa]
          Length = 810

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 32/170 (18%)

Query: 572 VFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVL 631
           V  G   ++D  R      +   L  G ++ M+TGD+   A++++  +GIP         
Sbjct: 578 VLLGRFDLSDSLREDAYEVVQALLSRGHYVGMVTGDNHEAAMHVSHALGIP--------- 628

Query: 632 SGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKL 691
               LN              N+F+   PE K +++R LR++ D VA  GDG+ND+ AL  
Sbjct: 629 ----LN--------------NVFSERLPEGKCDVLRQLRQKYDYVAFIGDGINDSVALAE 670

Query: 692 ADIGVSMGRMGTDVAKEASDMILTDDD----FSTILTAIEEGKGIFNNIQ 737
           +D+G+S+    +D+  +A+ +++ D       + IL AI+  +  FN ++
Sbjct: 671 SDLGISLSG-NSDIVADAAGIVVLDHSSAPPLTRILYAIDLARATFNRVK 719

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 35/188 (18%)

Query: 117 VFLGNIDDA---ISITMAIVIVVTVGFVQEYRSE-KSLEALNKLV---PQECHLIRGGRE 169
           V+LG+ D     +  T+ +V  + VG + E R+  ++ ++L ++V   P  C +   G +
Sbjct: 203 VWLGSADPPSTFLDTTVMLVAFICVGKLLESRARARAADSLARMVSSAPSMCTIRESGSD 262

Query: 170 SNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSY 229
             V    L  GD+V  R G ++PAD  ++E  +  +DES +TGE+  V K          
Sbjct: 263 REVEVELLQAGDVVVMRPGTKLPADGTVLE-GEAEVDESLMTGESTLVPK---------- 311

Query: 230 NDQPNSIVPVAERTNIA---YMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTP 286
              P S V        A   Y   LV            G ET    +   M   +  K P
Sbjct: 312 --YPGSRVLCGSVNGAAGFLYRADLV------------GEETRLAGIVAAMKQAQLAKAP 357

Query: 287 LQLTMDKL 294
           +Q   D L
Sbjct: 358 IQRYADFL 365

>Kwal_26.7070
          Length = 1315

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 174/466 (37%), Gaps = 139/466 (29%)

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKN 419
           +VR    VE LG +  I SDKTGTLT N M      C  S+A K  + ++ ++K    ++
Sbjct: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKAATTED 595

Query: 420 YLT------DDVKTTL-------------------LC----------GNLCNNASYSQEH 444
            +       D +K TL                    C          G++   A+   E 
Sbjct: 596 GIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEG 655

Query: 445 AKYLG-----------NPTDVA-LLEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQ 492
           A   G            P  V+ L+E L +        EY  +    FNS RK M+   +
Sbjct: 656 ALVEGAASLGYKFIIRKPNSVSVLIEDLGQ------EQEYQLLNICEFNSTRKRMSAIFR 709

Query: 493 DNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHR---ETIIDCANTLASEGLRVL 549
               +  LF KGA   IL             E+L AG     E  +      A+EGLR L
Sbjct: 710 LPNGEIKLFCKGADTVIL-------------ERLKAGENPYIEATLRHLEDYAAEGLRTL 756

Query: 550 AFAKRAMT-----------DSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSV 587
             A R +T           D++S  ++D              DL   G   + D  +  V
Sbjct: 757 CLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGV 816

Query: 588 KFAIDQFLQGGIHIIMITGDSENTAVNI-------ARQIGIPVID------------PKL 628
              I      GI + ++TGD + TAVNI       +  + + +I+             KL
Sbjct: 817 PETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKL 876

Query: 629 SVLSGDKLNEMTDDQLANVIDHVN-----------------------IFARATPEHKLNI 665
             +S  ++++   + LA VID  +                       I  R +P  K  +
Sbjct: 877 KAISDHQISQQDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALV 936

Query: 666 VRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709
           V+ ++R+ D + +  GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 937 VKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 135/589 (22%), Positives = 211/589 (35%), Gaps = 171/589 (29%)

Query: 360  IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKG----- 414
            +VR    VE LG +  I SDKTGTLT N M      C  S+A +  + S+ ++K      
Sbjct: 537  VVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKS--C--SIAGRCYIQSIPEDKDAAFDE 592

Query: 415  -------------------GNLKNYLTDDVKTTL-LC----------GNLCNNASYSQEH 444
                               G+    + D+  T L +C          G++   A+   E 
Sbjct: 593  GIEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEG 652

Query: 445  AKYLG-----------NPTDVALLEQLQKFELADVRSE--YTKVKELSFNSKRKMMATKI 491
            A   G            P  V +L +       D+  E  Y  +    FNS RK M+   
Sbjct: 653  ALVQGAADLGYKFIIRKPNSVTILRE-------DITEEVVYELLNICEFNSTRKRMSAIF 705

Query: 492  QDNEKKTTLFIKGA----FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLR 547
            +  +    L  KGA     ER+   S+ Y+         T  H E         A+EGLR
Sbjct: 706  RFPDNSIRLLCKGADTVILERLAATSNPYVAA-------TLRHLED-------YAAEGLR 751

Query: 548  VLAFAKRAMTDSS----SKLVE-------------DDISDLVFTGLI-----GMNDPPRS 585
             L  A R + +S     SKL +             D +++++  GL+      + D  + 
Sbjct: 752  TLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQD 811

Query: 586  SVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGD----------- 634
             V   I    Q GI + ++TGD + TA+NI     +   D  L +++ D           
Sbjct: 812  GVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLID 871

Query: 635  KLNEMTDDQ--------LANVID-----------------------HVNIFARATPEHKL 663
            KL  + D Q        LA VID                          I  R +P  K 
Sbjct: 872  KLRAINDHQISQQDMNTLALVIDGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKA 931

Query: 664  NIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTI 722
             +V+ ++RR   + +  GDG ND   ++ A +GV +  M    A  ++D  L    +   
Sbjct: 932  LVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKK 991

Query: 723  LTAIEEGKGIFNNIQNFLSFQLSTSIAALSLVALSTAFMLPNPLNAMQIL--WINILMD- 779
            L  +  G   +  I   + +    +IA   L      ++L N  +   I+  W     + 
Sbjct: 992  LLLV-HGSWSYQRISQAILYSFYKNIA---LYMTQFWYVLYNAFSGQSIMESWTLTFYNW 1047

Query: 780  ----GPPAQSLGVEPVDHEVMKKPPRKRTDKILTAELLKRLIGTASCII 824
                 PP                PP++R D+   + LL R     SC +
Sbjct: 1048 GGTAAPPG---------------PPKRR-DQFERSGLLNR--DAQSCTV 1078

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 80/151 (52%), Gaps = 33/151 (21%)

Query: 575 GLIGMNDPPRSSVKFAIDQFLQ-GGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG 633
           GL  +ND  +    +A  Q+LQ  G    MITGD+ + A  +AR++GI            
Sbjct: 757 GLFEINDEVKHD-SYATVQYLQRNGYETYMITGDNNSAAKRVAREVGI------------ 803

Query: 634 DKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRR--GDVVAMTGDGVNDAPALKL 691
                             N+++  +P  K ++V+ ++ +   + VA+ GDG+NDAPAL L
Sbjct: 804 ---------------SFENVYSDVSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALAL 848

Query: 692 ADIGVSMGRMGTDVAKEASDM-ILTDDDFST 721
           +D+G+++   GT++A EA+D+ IL  +D +T
Sbjct: 849 SDLGIAIST-GTEIAIEAADIVILCGNDLNT 878

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 104/269 (38%), Gaps = 43/269 (15%)

Query: 145 RSEKSLEALNKLVPQECHLIRG--GRESNVLATNLVP-GDLVRFRIGDRIPADIRIIECN 201
           ++  +L  L +L P  C +I      E+  +   L+   D+V  + G +IPAD  II   
Sbjct: 396 QTSTALSKLIQLTPSVCSIISDVERNETKEIPIELLQVNDIVEIKPGMKIPAD-GIITRG 454

Query: 202 DLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAERTNIAYM-GTLVKEGNGRGI 260
           +  IDES +TGE+                      + V ++T    + G++   G+    
Sbjct: 455 ESEIDESLMTGES----------------------ILVPKKTGFPVIAGSVNGPGHFYFR 492

Query: 261 VVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKD-------LSLASF---------X 304
               G ET   N+ ++M   +  K P+Q   D L          L++ +F          
Sbjct: 493 TTTVGEETKLANIIKVMKEAQLSKAPIQGYADYLASIFVPGILILAVLTFFIWCFILNIS 552

Query: 305 XXXXXXXXXXXQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRL 364
                      +  ++    Q + S+ + A P  L +     + +G    A+   +++  
Sbjct: 553 ANPPVAFTANTKADNFFICLQTATSVVIVACPCALGLATPTAIMVGTGVGAQNGVLIKGG 612

Query: 365 PSVETLGSVNVICSDKTGTLTSNHMTVSK 393
             +E   S+     DKTGTLT+  M V K
Sbjct: 613 EVLEKFNSITTFVFDKTGTLTTGFMVVKK 641

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2 P-type
           amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 104/459 (22%), Positives = 175/459 (38%), Gaps = 126/459 (27%)

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG---- 415
           +VR    VE LG +  I SDKTGTLT N M    +    S+A +  + ++ +++      
Sbjct: 545 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSV----SIAGRCYIETIPEDRRATVED 600

Query: 416 ----------NLKNYLTD----------DVKTTLLCGNLCNNASYSQEHAKY-LGNPTDV 454
                     +LK+ +TD          +  T L   +     + S    KY   +P + 
Sbjct: 601 GIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEG 660

Query: 455 ALLEQLQKFELA-DVRS--------------EYTKVKELSFNSKRKMMATKIQDNEKKTT 499
           AL++         D+R               EY  +    FNS RK M+   +  +    
Sbjct: 661 ALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIK 720

Query: 500 LFIKGAFERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT-- 557
           LF KGA   IL++  S   E     + T  H E         A+EGLR L  A R +   
Sbjct: 721 LFCKGADTVILERLDS---EFNPYVQSTLRHLED-------YAAEGLRTLCIASRTIPEK 770

Query: 558 -----------------------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQF 594
                                  D +++L+E    DL F G   + D  +  V   I   
Sbjct: 771 EYEEWSKIYEAASTTMKDRTEELDRAAELIE---HDLFFLGATAIEDKLQEGVPETIHHL 827

Query: 595 LQGGIHIIMITGDSENTAVNI-------ARQIGIPVID------------PKLSVLSGDK 635
            + G+ + ++TGD + TA+NI       +  + + +++             KL+ +   +
Sbjct: 828 QEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQ 887

Query: 636 LNEMTDDQLANVIDHVN-----------------------IFARATPEHKLNIVRALRRR 672
           +++   + LA VID  +                       I  R +P  K  +V+ ++R+
Sbjct: 888 ISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRK 947

Query: 673 -GDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709
              ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 948 TSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 986

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 28/137 (20%)

Query: 581 DPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMT 640
           D  +S  K  I         + M+TGD+  +A+ +A  + IP   P              
Sbjct: 763 DEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIP---PN------------- 806

Query: 641 DDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVSMGR 700
                      N+++  TP+ K   V  LR  G V+A  GDG+ND+ AL  +D+G+++  
Sbjct: 807 -----------NVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISS 855

Query: 701 MGTDVAKEASDMILTDD 717
            GT+VA EA+ +++ +D
Sbjct: 856 -GTEVAIEAAGIVILND 871

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 121/296 (40%), Gaps = 60/296 (20%)

Query: 129 TMAIVIVVTVG-FVQEYRSEKSLEALNKLV---PQECHLIRGGRES---NVLATNLVPGD 181
           ++ IV  +++G +++     K+  AL+KL+   P  C ++    +S    +    L  GD
Sbjct: 377 SVMIVAYISIGKYLENKAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGD 436

Query: 182 LVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKALSRDSYNDQPNSIVPVAE 241
           +   + G +IP+D  I+      +DES +TGET+ V K                      
Sbjct: 437 IAMVKPGAKIPSD-GIVTKGISEVDESLMTGETNLVVKE--------------------- 474

Query: 242 RTNIAYMGTLVKEG--NGRGI----VVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG 295
                 +G++V  G  NG G+    V   G +T   N+ ++M + +  K  +Q   D + 
Sbjct: 475 ------IGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKKASIQRYTDYVA 528

Query: 296 K-------DLSLASFXXXXXXXXX-----------XXXQGRSWLEMFQISVSLAVAAIPE 337
                    LSL +F                       + R ++   QI+ S+ + A P 
Sbjct: 529 SIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYM-CLQIATSVVIVACPC 587

Query: 338 GLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSK 393
            L +     + +G    ++   +++    +E    VN    DKTGTLT+ HMTV +
Sbjct: 588 ALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHMTVQQ 643

>CAGL0G06270g 598357..602343 highly similar to sp|P39524
           Saccharomyces cerevisiae YAL026c DRS2, start by
           similarity
          Length = 1328

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 116/465 (24%), Positives = 178/465 (38%), Gaps = 139/465 (29%)

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGG---- 415
           +V+    VE LG +  I SDKTGTLT N M      C  S+A +     + ++K      
Sbjct: 524 VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKS--C--SIAGRCYAEHIPEDKAATFED 579

Query: 416 ----------NLKNYLT---DDVKT-----TLLC------------GNLCNNASYSQEHA 445
                     +LK  LT   DD K      TLL             G++   A+   E A
Sbjct: 580 GIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGA 639

Query: 446 ----------KYL-GNPTDVALL---EQLQKFELADVRSEYTKVKELSFNSKRKMMATKI 491
                     K+L   P  V +L   E+ ++++L ++           FNS RK M+   
Sbjct: 640 LVEGGALLGYKFLIRKPNSVTILINEEEEREYQLLNI---------CEFNSTRKRMSAIF 690

Query: 492 QDNEKKTTLFIKGAFERILDKSSSYLTEKGKIE-KLTAGHRETIIDCANTLASEGLRVLA 550
           +  +    L  KGA   IL++    L+E G      T  H E         A+EGLR L 
Sbjct: 691 RFPDDSIKLLCKGADSVILER----LSETGNFYVDATTRHLED-------YATEGLRTLC 739

Query: 551 FA------------KRAMTDSSSKL----------VEDDISDLVFTGLIGMNDPPRSSVK 588
            A             +   D+++ L           E+  S L   G   + D  +  V 
Sbjct: 740 LATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVP 799

Query: 589 FAIDQFLQGGIHIIMITGDSENTAVNI-------ARQIGIPVI------------DPKLS 629
             I    + GI I ++TGD + TA+NI       +  + + +I            + KL+
Sbjct: 800 DTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLA 859

Query: 630 VLSGDKLNEMTDDQLANVID-HVNIFA----------------------RATPEHKLNIV 666
            L    L+E   + LA VID H   FA                      R +P  K  +V
Sbjct: 860 ALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVV 919

Query: 667 RALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709
           + ++R+ + + +  GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 920 KMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 964

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 51/120 (42%), Gaps = 31/120 (25%)

Query: 180 GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETDPVHKSYKAL------SRDSY 229
           GD++R    + IPADI I+  ++      I+ +NL GET+   K  +        SR+  
Sbjct: 288 GDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRELR 347

Query: 230 N-------DQPNSI--------------VPVAERTNIAYMGTLVKEGNGRGIVVGTGRET 268
           N       +QPNS               +P++    I    TL   G   GIV+ TG ET
Sbjct: 348 NIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRNTGWIFGIVIFTGHET 407

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
           Ca-ATPase (P-type) required for ribosome assembly and
           involved in late Golgi function, member of the cation
           transporting (E1-E2) P-type ATPase superfamily [4068 bp,
           1355 aa]
          Length = 1355

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 107/464 (23%), Positives = 165/464 (35%), Gaps = 126/464 (27%)

Query: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGS----------MANKLNVLSL 409
           +VR    VE LG +  I SDKTGTLT N M        G            A   + + +
Sbjct: 541 VVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEV 600

Query: 410 DKNKGGNLKNYLTD----------DVKTTLLCGNLCNNASYSQEHAKYLGNPTDVALLEQ 459
              K  +LK  L D          D  T L   +       S    KY     D   L Q
Sbjct: 601 GYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660

Query: 460 ----------LQK-------FELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFI 502
                     ++K        E      EY  +    FNS RK M+   +  +    LF 
Sbjct: 661 GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720

Query: 503 KGA----FERILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT- 557
           KGA     ER+ D+++ Y+       + T  H E         ASEGLR L  A R ++ 
Sbjct: 721 KGADTVILERLDDEANQYV-------EATMRHLED-------YASEGLRTLCLAMRDISE 766

Query: 558 ------------------------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQ 593
                                   D ++ L+E    +L+  G   + D  +  V   I  
Sbjct: 767 GEYEEWNSIYNEAATTLDNRAEKLDEAANLIE---KNLILIGATAIEDKLQDGVPETIHT 823

Query: 594 FLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG-----------DKLNEMTDD 642
             + GI I ++TGD + TA+NI     +   D  L +++            +K+N + + 
Sbjct: 824 LQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEH 883

Query: 643 QLAN--------VIDHVN-----------------------IFARATPEHKLNIVRALRR 671
           QL+         VID  +                       I  R +P  K  +V+ ++R
Sbjct: 884 QLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKR 943

Query: 672 RGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMIL 714
           +   + +    G ND   ++ A +GV +  M    A  ++D+ L
Sbjct: 944 KSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIAL 987

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 90/210 (42%), Gaps = 38/210 (18%)

Query: 574  TGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG 633
            T  + + D  R   K  +    + GI   MI+GD+   A  +A ++GI            
Sbjct: 1011 TLFLAVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGIK----------- 1059

Query: 634  DKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRR---RGDVVAMTGDGVNDAPALK 690
                              ++ A   PE K   ++ +R    +G  +AM GDG+NDAPA+ 
Sbjct: 1060 ------------------HVIADVLPEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIA 1101

Query: 691  LADIGVSMGRMGTDVAKEASDMIL--TDDDFSTILTAIEEGKGIFNNIQNFLSFQLSTSI 748
             AD+G+S+   G+D+A  + D +L    +  + I+  ++  K +F  ++    + L  +I
Sbjct: 1102 AADVGISLAS-GSDLAMISCDFVLLSKKNPLTGIVVLLQLSKKVFRRVKFNFVWALVYNI 1160

Query: 749  AALSLVALSTAFMLPNPLNAMQILWINILM 778
                 V ++   + P     +  +W +I M
Sbjct: 1161 IC---VPIAAGVLYPYKETRLSPVWASIAM 1187

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 324 FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGS-VNVICSDKTG 382
            + ++++ V A P G+ +     L +G    AK   + R   +   +GS V  +C DKTG
Sbjct: 805 LEFAIAVFVIACPCGIGLAAPTALFVGANIAAKYGILARGGSAAFQMGSKVTTVCFDKTG 864

Query: 383 TLT 385
           TLT
Sbjct: 865 TLT 867

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 52/101 (51%), Gaps = 7/101 (6%)

Query: 123 DDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIR--GGR----ESNVLATN 176
           D  + +T+ ++I   +  + + +  K+LE+L  L  +   L++  G R    E++V A  
Sbjct: 604 DSVVFLTLFLLIGRLLESLSKSKMVKTLESLTSLKQRTGILMQADGARDFKKETSVSAEM 663

Query: 177 LVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPV 217
           L  GD +  + G     D  I++  +   DES+LTGE+ P+
Sbjct: 664 LELGDHILIKPGASPAVDALIVQ-GETEFDESSLTGESRPI 703

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 111/243 (45%), Gaps = 39/243 (16%)

Query: 524  EKLTAGHRETIIDCANTLASEGLRVLAFAKR-------AMTDSSSKLVEDDISDLVFTGL 576
            E    G+   + D    L SE L++LA  K            S S    D+   ++   +
Sbjct: 868  EMAIVGNERLLRDYKCHLTSEQLKLLAEWKARGKSLMVTAIKSRSYFGNDNFYPVM---M 924

Query: 577  IGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKL 636
                D  R   K  I +  + GI   MI+GD+E TA  +A+++ I  +  ++        
Sbjct: 925  CAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVAQELDIDNVIAEV-------- 976

Query: 637  NEMTDDQLANV--IDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADI 694
              + +++ A V  I H NI A     HK            VVAM GDG+NDAPAL  AD+
Sbjct: 977  --LPEEKAAKVKWIQHNNIGANG--HHK------------VVAMVGDGINDAPALAAADV 1020

Query: 695  GVSMGRMGTDVAKEASDMILTD--DDFSTILTAIEEGKGIFNNIQNFLSFQLSTSIAALS 752
            G+++   G+++A  + D +L    +   ++L  ++  K +FN I+   ++ L  ++ AL 
Sbjct: 1021 GIALAS-GSELAMTSCDFVLLSPINTLVSLLALLKLSKTVFNRIKFNFTWALVYNMLALP 1079

Query: 753  LVA 755
            + A
Sbjct: 1080 IAA 1082

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 115/271 (42%), Gaps = 42/271 (15%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERILDKSSSYL 517
            E+  ++ E+  +  L FNS RK M+  I+      ++E +  L  KGA   I  + S+  
Sbjct: 822  EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKA 881

Query: 518  TEKGK--IEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSS-------------- 561
             E  +  +EK TA H E         A+EGLR L  A+R +T S                
Sbjct: 882  GENDETLLEK-TALHLEQ-------YATEGLRTLCLAQRELTWSEYTEWNARYDIAAASL 933

Query: 562  -------KLVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAV 613
                   ++V D I  DL+  G   + D  +  V  +I    + GI + ++TGD   TA+
Sbjct: 934  TNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAI 993

Query: 614  NIARQIGIPVIDPKLSVL--SGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRR 671
            NI     +   D +L V+  +G+ + E  +D    V   ++ + R       + +     
Sbjct: 994  NIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNA 1053

Query: 672  RGDVVAMTGDG--VNDAPALKLADIGVSMGR 700
            +GD     GD   V D  ALK+A  G  M R
Sbjct: 1054 KGDHSFPKGDFAVVIDGDALKIALTGDDMKR 1084

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 1099 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIA 1144

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%)

Query: 180 GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETD 215
           GD+VR    D IPADI ++  +D      ++  NL GET+
Sbjct: 400 GDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETN 439

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 95/223 (42%), Gaps = 38/223 (17%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERILDKSSSYL 517
            E+  V+ E+  +  L FNS RK M+  I+       +E K  L  KGA   I  +     
Sbjct: 871  EIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQ 930

Query: 518  TEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSS-SKLVE----------- 565
             +   +EK TA H E         A+EGLR L  A+R +T S   + V+           
Sbjct: 931  NDATLLEK-TALHLEE-------YATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTN 982

Query: 566  -----DDISD-----LVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNI 615
                 D ++D     L+  G   + D  +  V  +I    + GI + ++TGD   TA+NI
Sbjct: 983  REEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINI 1042

Query: 616  ARQIGIPVIDPKLSVL--SGDKLNEMTDDQLANVIDHVNIFAR 656
                 +   D +L V+  SG+ + E   D +  V + V  + R
Sbjct: 1043 GFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLR 1085

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 3/101 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMI 713
             R +P  K  +V+ +++  DV+ +  GDG ND   ++ AD+GV +       A   SD  
Sbjct: 1146 CRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYA 1205

Query: 714  LTDDDFSTILTAIEEGKGIFNNIQNFL-SFQLSTSIAALSL 753
            +    + T L  +  GK  +  +   +  F     I  LSL
Sbjct: 1206 IGQFRYVTRLVLV-HGKWCYKRLAEMIPQFFYKNVIFTLSL 1245

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 176 NLVPGDLVRFRIGDRIPADIRIIECNDL----TIDESNLTGETD 215
           N+  GD+VR    D IPAD+ ++  +D+     ++  NL GET+
Sbjct: 445 NVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETN 488

>Scas_576.8
          Length = 1591

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 95/213 (44%), Gaps = 44/213 (20%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGA----FERILDKS 513
            E+  V+ E+  +  L FNS RK M+  ++      D+E +  L  KGA    + R+  K+
Sbjct: 842  EVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSIIYSRLGTKN 901

Query: 514  SSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR------------------- 554
             +    +  +EK TA H E         A+EGLR L  A+R                   
Sbjct: 902  GA--NSENLLEK-TALHLEQ-------YATEGLRTLCIAQRELSWPEYLEWNKRYDIAAA 951

Query: 555  AMTDSSSKL--VEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611
            ++T+   +L  V D+I  +L   G   + D  +  V  +I    Q GI + ++TGD   T
Sbjct: 952  SVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVET 1011

Query: 612  AVNIARQIGIPVIDPKLSVL--SGDKLNEMTDD 642
            A+NI     +   D +L V+  +GD + E  +D
Sbjct: 1012 AINIGFSCNLLNNDMELLVVKTNGDDVQEFGND 1044

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 176 NLVPGDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETD 215
           N+  GD+VR    D IPADI ++  +D      ++  NL GET+
Sbjct: 416 NVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETN 459

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ +    DV+ +  GDG ND   ++ AD+GV + 
Sbjct: 1119 CRVSPAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIA 1164

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 75/178 (42%), Gaps = 39/178 (21%)

Query: 574  TGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSG 633
            T +  + D  R+     I+   Q GI + +++GD +    ++A ++G             
Sbjct: 1017 TAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLG------------- 1063

Query: 634  DKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRAL----------RRRGDVVAMTGDGV 683
                          I+  NI + ATP  K   ++ +          + +  VV   GDG 
Sbjct: 1064 --------------IESSNIRSHATPAEKSEYIKDIVEGRNCDSSSQSKRPVVVFCGDGT 1109

Query: 684  NDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIE-EGKGIFNNIQNFL 740
            NDA  L  A IGV +   G++VAK A+D+++     + ILT I    K +F    NFL
Sbjct: 1110 NDAIGLTQATIGVHINE-GSEVAKLAADVVMLKPKLNNILTMITVSQKAMFRVKLNFL 1166

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 119/279 (42%), Gaps = 47/279 (16%)

Query: 132 IVIVVTVG-FVQEYRSEKSLEALNKLVPQECHLI---RGGRESNVLATNLVPGDLVRFRI 187
           +V ++ VG FV E    +++++++    Q    I   + G+E+ +    L  GD+ +   
Sbjct: 665 LVTLIMVGRFVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIFKVLP 724

Query: 188 GDRIPADIRIIECNDLTIDESNLTGETDPVHKSYKAL-SRDSYNDQPNSIVPVAE---RT 243
             RIP D  +I      +DE+ +TGE+ PV K  +++    S N      V +++     
Sbjct: 725 DSRIPTDGTVIS-GSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLPGNN 783

Query: 244 NIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGK------- 296
            I+ + T+V E                       + + KPK  +Q   DK+         
Sbjct: 784 TISTIATMVDE-----------------------AKLTKPK--IQNIADKIASYFVPTII 818

Query: 297 DLSLASFXXXXXXXXXXXXQGRS--WLEMFQISVSLAVAAIPE--GLPIIVTVTLALGVL 352
            +++ +F            Q RS   ++    ++++ + + P   GL + +   +A GV 
Sbjct: 819 GITVVTFCVWIAVGIRVEKQSRSDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGV- 877

Query: 353 RMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTV 391
             AKR  I +   S+E   + + +  DKTGTLT   +TV
Sbjct: 878 -AAKRGVIFKSAESIEVAHNTSHVVFDKTGTLTEGKLTV 915

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 82/197 (41%), Gaps = 43/197 (21%)

Query: 553  KRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA 612
            +R   D+  +++E    DL   G IG+ D  +  V  AID+  + GI + M+TGD   TA
Sbjct: 985  RREQMDTVGEIIE---RDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETA 1041

Query: 613  VNIARQIGIPVIDPKLSVLS------GDKLNEMTDDQLANVIDH---------VNIF--- 654
            +NI     +      + +L+        K+  +T +  A  + H         + IF   
Sbjct: 1042 INIGYSCRLIHDYSTVIILAPNDENMASKITTITQEIEAGNVAHCVVVIDGATLTIFEGN 1101

Query: 655  -------------------ARATPEHKLNIVRALRR--RGDVVAMTGDGVNDAPALKLAD 693
                                R++P  K  +V  +R+  +  V    GDG ND   ++ AD
Sbjct: 1102 LTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLAIGDGANDIAMIQSAD 1161

Query: 694  IGVSM-GRMGTDVAKEA 709
            IGV + G+ G   ++ +
Sbjct: 1162 IGVDITGKEGLQASRSS 1178

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 367 VETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKG 414
           +E LG V+ I SDKTGTLT N M   K    G+ A + +V   D+  G
Sbjct: 495 LEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGT-AWEHDVARKDQETG 541

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 98/240 (40%), Gaps = 62/240 (25%)

Query: 532  ETIIDCANTLASEGLRVLAF-------------------AKRAMTDSSSKLVE---DDIS 569
            E  ++  +  ++EGLR L +                   AK ++T+ S+++ E      +
Sbjct: 938  EKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEVGGHIET 997

Query: 570  DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLS 629
            DL   G   + D  +  V  AI +  + GI + M+TGD   TA+NI     +      + 
Sbjct: 998  DLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIYDYSTVV 1057

Query: 630  VLSGDKLN----------EMTDDQLAN---VIDHVN------------------------ 652
            +L  +  N          E+   ++A+   VID  +                        
Sbjct: 1058 ILKKNDDNLISKMTALGEELDTGKIAHCVLVIDGASLAVFENNPTMMSVFIELCTKTDSV 1117

Query: 653  IFARATPEHKLNIVRALR-RRGDVVAMT-GDGVNDAPALKLADIGVSM-GRMGTDVAKEA 709
            I  RA+P  K  IV  +R +  D+V +  GDG ND   ++ ADIGV + G+ G   ++ +
Sbjct: 1118 ICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGITGKEGLQASRSS 1177

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 107/287 (37%), Gaps = 70/287 (24%)

Query: 176 NLVPGDLVRFRIGDRIPADIRII----ECNDLTIDESNLTGETD-----PVHKSYKALS- 225
           +L  G+ V     D +PADI ++    E N+  ++   L GET+     P+ +  K ++ 
Sbjct: 276 DLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTS 335

Query: 226 -------------RDSYNDQPN---------SIVPVAERTNIAYMGTLVKEGNG-RGIVV 262
                         D  ND  N          + P+    N+ Y G++++      GIV+
Sbjct: 336 ATGLSMHSATTTLEDPNNDLYNFEGTVEIDGELYPLGS-DNVVYRGSILRNTQSIVGIVI 394

Query: 263 GTGRETSFGNVFEMMSSIEKPKTP---LQ-------LTMDKLGKDLSLASFXXXXXXXXX 312
            TG ET        M++I+ P+T    LQ       L M  +   +++ S+         
Sbjct: 395 FTGEETKI-----RMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKN 449

Query: 313 XXXQGRSWLEMFQISVSLAVAA----------IPEGLPIIVTVTLALGVLRM-------- 354
                R+W  +FQ     A             IP  L +   +  A+    M        
Sbjct: 450 YVDNNRAWY-LFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYH 508

Query: 355 --AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGS 399
             +      R    +E LG V+ I SDKTGTLT N M   K    GS
Sbjct: 509 IESDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGS 555

>Scas_669.3
          Length = 1638

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 129/323 (39%), Gaps = 83/323 (25%)

Query: 452  TDVALLEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILD 511
            TD   ++ + +F L +V+    ++ E+  NS++ +   +++    + +L      E+  +
Sbjct: 895  TDEGPIDSIDQF-LDNVKRSDMEIDEVVLNSRKSLSKQQLEKYGPRLSLGSPSNKEKPGN 953

Query: 512  KSSS--YL----TEKGKIEK------------LTAGHR-ETIIDCANTLASEGLRVLAF- 551
            K ++  YL    TE  ++EK            L  G+  E  I   +  ++EGLR L + 
Sbjct: 954  KPNAKHYLKPVSTEDARVEKGMLEYIGSDDLLLNDGYVIEKTIQAIDEFSTEGLRTLVYS 1013

Query: 552  ------------------AKRAMTDSSSKLVE--DDI-SDLVFTGLIGMNDPPRSSVKFA 590
                              AK ++T+  SK+ E  ++I  DL   G   + D  +  V  A
Sbjct: 1014 YKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIEQDLQLLGATAIEDKLQEGVSEA 1073

Query: 591  IDQFLQGGIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLS-GD-----KLNEMTDD-- 642
            I++  + GI I M+TGD   TA+NI     +      + +L+ GD     K+N ++ +  
Sbjct: 1074 IEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTVVILAKGDENIISKMNAISQEVD 1133

Query: 643  ------------------------------QLANVIDHVNIFARATPEHKLNIVRALRRR 672
                                          +L    D V I  RA+P  K  +V  +R  
Sbjct: 1134 SGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSV-ICCRASPSQKSLMVTNIRNS 1192

Query: 673  GD--VVAMTGDGVNDAPALKLAD 693
                V    GDG ND   ++ AD
Sbjct: 1193 NKNLVTLAIGDGANDIAMIQSAD 1215

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 116/307 (37%), Gaps = 82/307 (26%)

Query: 165 RGGRESNVLATNLVPGDLVRFRIGDRIPADIRII----ECNDLTIDESNLTGETD-PVHK 219
            G R      +NL  GD V  +  + +PADI ++    + N+  ++   L GET+  V +
Sbjct: 276 HGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECFVETMALDGETNLKVKQ 335

Query: 220 SYKALSR----------------------DSYN---------DQPNSI--VPVAERTNIA 246
            +  L++                      D YN         +  NS+   PV    N+A
Sbjct: 336 PHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNNNNSLKKYPVGP-DNVA 394

Query: 247 YMGTLVKE-GNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDL------- 298
           Y G++++   N  G+V+ TG+ET        M+++  P+T       KL K++       
Sbjct: 395 YRGSIIRNTDNVIGMVIYTGKETKI-----RMNALNNPRT----KAPKLQKNINIIITFM 445

Query: 299 -------SLASFXXXXXXXXXXXXQGRSWLEMFQIS---------VSLAVAAIPEGLPII 342
                  SL S+            + ++W  + + +         + +    IP  L + 
Sbjct: 446 VFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTIIPLSLYVT 505

Query: 343 VTVTLALGVLRM----------AKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVS 392
           + +  A+    M                 R    +E LG V+ + SDKTGTLT N M   
Sbjct: 506 MEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTLTDNKMIFR 565

Query: 393 KIWCLGS 399
           K    GS
Sbjct: 566 KFSICGS 572

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 10/76 (13%)

Query: 463 FELADVRSEYTKVKELSFNSKRKMMAT--KIQDNEKKTTLFIKGA----FERILDKSSSY 516
           FE   +  +Y  +  + FNS+RK M+   K  D   K  L  KGA     ER+ D+  +Y
Sbjct: 767 FENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILERLQDRDLAY 826

Query: 517 LTEKGKIEKLTAGHRE 532
                K+E +    RE
Sbjct: 827 ----QKMEDINRNTRE 838

>Scas_636.16
          Length = 1554

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 90/215 (41%), Gaps = 48/215 (22%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKI------QDNEKKTTLFIKGAFERI---LDKSS 514
            E+  ++ E+  +  L FNS RK M+  +      + +E +  L  KGA   I   L +  
Sbjct: 805  EVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKP 864

Query: 515  SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT----------------- 557
             Y  ++  +EK TA H E         A+EGLR L   +R ++                 
Sbjct: 865  GY-NDETLLEK-TALHLEQ-------YATEGLRTLCVGQREISWSEYQEWNEKYNIAAAS 915

Query: 558  --------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSE 609
                    D  + L+E    DLV  G   + D  +  V  +I    + GI + ++TGD  
Sbjct: 916  LAGREEELDHVADLIE---RDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 972

Query: 610  NTAVNIARQIGIPVIDPKLSVL--SGDKLNEMTDD 642
             TA+NI     +   D +L V+  +G+ + E  DD
Sbjct: 973  ETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDD 1007

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+GV + 
Sbjct: 1082 CRVSPAQKAAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIA 1127

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 170 SNVLATNLVPGDLVRFRIGDRIPADIRIIECNDL----TIDESNLTGETD 215
           +N    N+  GD+VR    D IPAD+ ++  +D+     ++  NL GE++
Sbjct: 373 ANDFWKNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESN 422

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 42/185 (22%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGA----FERILDKS 513
            E+  ++ E+  +  L FNS RK M+  ++       +E +  L  KGA    + R+  +S
Sbjct: 826  EMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQS 885

Query: 514  SSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSK----------- 562
             S    +  +EK TA H E         A+EGLR L  A+R ++ S  +           
Sbjct: 886  GS--NSEAILEK-TALHLEQ-------YATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935

Query: 563  ----------LVEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611
                      +V D I  +L+  G   + D  +  V   I+   + GI + ++TGD   T
Sbjct: 936  SLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVET 995

Query: 612  AVNIA 616
            A+NI 
Sbjct: 996  AINIG 1000

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 20/74 (27%)

Query: 162 HLIRGGRESNVLATNLVP----------------GDLVRFRIGDRIPADIRIIECND--- 202
           +L +G  E+N++  +L P                GD+VR    D IPADI ++  +D   
Sbjct: 370 NLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDG 429

Query: 203 -LTIDESNLTGETD 215
              ++  NL GET+
Sbjct: 430 ACYVETKNLDGETN 443

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ AD+G+ + 
Sbjct: 1103 CRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIA 1148

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 116/279 (41%), Gaps = 60/279 (21%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKI------QDNEKKTTLFIKGAFERI---LDKSS 514
            E+  V+ E+  +  L FNS RK M+  +      ++++ K  L  KGA   I   LD+S 
Sbjct: 833  EIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLDRSR 892

Query: 515  SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR------------------AM 556
            +      K+ + TA H E         A+EGLR L  A+R                  A 
Sbjct: 893  N----DPKLLERTALHLEQ-------FATEGLRTLCVAQREIDWDEYLNWNERRELAAAS 941

Query: 557  TDSSSKLVE---DDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA 612
             D+  + +E   D I   LV  G   + D  +  V  +I      GI + ++TGD   TA
Sbjct: 942  LDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETA 1001

Query: 613  VNIARQIGIPVIDPKLSVL--SG---DKLNEMTDDQLANVID-----HVNIFARATPEHK 662
            +NI     +   D +L V+  SG   + L E   D +  +ID     H N+  + +PE  
Sbjct: 1002 INIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNM--KGSPEEL 1059

Query: 663  LNIVRALRRRGDVVAMTGDGVN-DAPALKLADIGVSMGR 700
                 A  R+      +  GV  D  ALKLA  G  + R
Sbjct: 1060 -----AAARKDHTPPQSAFGVVIDGDALKLALHGEDIRR 1093

 Score = 33.5 bits (75), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DVV +  GDG ND   ++ AD+G+ + 
Sbjct: 1108 CRVSPSQKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIA 1153

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 180 GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETD-PVHKSYKALSR 226
           GD+VR    D IPADI ++  +D      ++  NL GET+  V +S K   R
Sbjct: 411 GDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHR 462

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 80/184 (43%), Gaps = 41/184 (22%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERI---LDKSS 514
            E+  +  E+  +  L FNS RK M+  ++      + + K  L  KGA   I   LDK+ 
Sbjct: 833  EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTG 892

Query: 515  SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR-------------------A 555
              L E+  +EK TA H E         A+EGLR L  A+R                   A
Sbjct: 893  --LNEESLLEK-TALHLEQ-------YATEGLRTLCLAQRELSWEEYERWNKKYDIAAAA 942

Query: 556  MTDSSSKL--VEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA 612
            + D   +L  V D+I   L+  G   + D  +  V  +I    + GI + ++TGD   TA
Sbjct: 943  VVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETA 1002

Query: 613  VNIA 616
            +NI 
Sbjct: 1003 INIG 1006

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 153 LNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECND----LTIDES 208
           +NK +P +       R S     N+  GD+VR    + IPADI ++  +D      ++  
Sbjct: 388 INKTLPTDMEW----RFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETK 443

Query: 209 NLTGETD-PVHKSYKALS 225
           NL GET+  V +S K  S
Sbjct: 444 NLDGETNLKVRQSMKCTS 461

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ A+IGV + 
Sbjct: 1109 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIA 1154

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/241 (22%), Positives = 94/241 (39%), Gaps = 64/241 (26%)

Query: 532  ETIIDCANTLASEGLRVLAFAKRAMTD-----------------SSSKLVEDDIS----- 569
            E  ++   + ++EGLR L FA + +++                 S  K   D++      
Sbjct: 959  EKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIED 1018

Query: 570  DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVN--------------- 614
            +L   G   + D  +  V  AI++  + GI + M+TGD   TA+N               
Sbjct: 1019 ELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVV 1078

Query: 615  ---------------IARQIGIPVIDPKLSVLSGDKLNEMTDD--------QLANVIDHV 651
                           I++++    +   + V+ G  L    D+        +L    D V
Sbjct: 1079 ILTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSV 1138

Query: 652  NIFARATPEHKLNIVRALRR--RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKE 708
             +  RA+P  K  +V  +R   +  V    GDG ND   ++ ADIGV + G+ G   ++ 
Sbjct: 1139 -VCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRS 1197

Query: 709  A 709
            A
Sbjct: 1198 A 1198

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 111/289 (38%), Gaps = 77/289 (26%)

Query: 180 GDLVRFRIGDRIPADIRIIECN---------DLTID-ESNLTG-----ETDPVHKSYKAL 224
           GD V  +  D +PADI I+  +          + +D E+NL G     E + + KS   L
Sbjct: 269 GDFVLLQQDDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGL 328

Query: 225 SR------------DSYNDQPNSIVPVAERT---------NIAYMGTLVKEG-NGRGIVV 262
           +             D YN + N  +     +         N+ Y G++++   N  G+V+
Sbjct: 329 ANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVI 388

Query: 263 GTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKD----------LSLASFXXXXXXXXX 312
            TG E+        M+++  P+T       K+             +SL S+         
Sbjct: 389 FTGEESKI-----RMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKR 443

Query: 313 XXXQGRSWLEMFQISVSLA------VAAIPEGLPIIVTVTLALGVLRMAKRKAI------ 360
                ++W  + Q     A      +      +P+ + VT+ L  +++A+ + +      
Sbjct: 444 YVNNNKAWY-LLQEDAGTAPTIMSFIIMYNTIIPLSLYVTMEL--IKVAQSRMMEWDIDM 500

Query: 361 ----------VRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGS 399
                     VR    +E LG V+ I SDKTGTLT N M   K+   G+
Sbjct: 501 YHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGT 549

>Scas_89.1
          Length = 271

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (41%), Gaps = 38/181 (20%)

Query: 570 DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA---------------VN 614
           +L   GL G+ D  ++ VK +I+     G+ I M+TGD   TA               V+
Sbjct: 34  NLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVH 93

Query: 615 IARQIGIPVIDPKLSVLSGDKLNE-----MTDDQLANVIDHVN-------------IFAR 656
              ++  P  +  L+ L   K+N+     +  + L   + +               I  R
Sbjct: 94  TVTKLSRP--EGALNALEYLKINKSSCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACR 151

Query: 657 ATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAKEASDMIL 714
            TP+ K ++   +R   G  V   GDG ND   ++ AD+GV + G+ G   A  A+D  +
Sbjct: 152 CTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSV 210

Query: 715 T 715
           T
Sbjct: 211 T 211

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 74/185 (40%), Gaps = 45/185 (24%)

Query: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGA----FERILDKS 513
            ++  V+ EY  +  L FNS RK M+  ++      + E +  L  KGA    + R+   +
Sbjct: 871  DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSIIYSRLSKNN 930

Query: 514  SSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT---------------- 557
               L EK      TA H E         A+EGLR L  A+R ++                
Sbjct: 931  DEKLLEK------TALHLEQ-------YATEGLRTLCIAQRELSWKEYQEWNEKHEIAAA 977

Query: 558  ------DSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENT 611
                  D   K+ +    +L   G   + D  +  V  +I    + GI + ++TGD   T
Sbjct: 978  ALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVET 1037

Query: 612  AVNIA 616
            A+NI 
Sbjct: 1038 AINIG 1042

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ ADIGV + 
Sbjct: 1145 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIA 1190

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 115/289 (39%), Gaps = 86/289 (29%)

Query: 180 GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETD-PVHKSYKA--LSRDSYN-- 230
           GD+VR    D IPADI ++  +D      ++  NL GET+  V +S K   + R+S N  
Sbjct: 449 GDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRNSRNIT 508

Query: 231 --------DQPNSIVPVAERTNIAYMG---------------------TLVKEGNGRGIV 261
                   + P+S +  + + N+ ++                      TL       GIV
Sbjct: 509 RTKFKVESEGPHSNL-YSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMGIV 567

Query: 262 VGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLGKDLSLASFXXXXXXXXXXXXQG---- 317
           V TG +T       M+++     TP +++  ++ ++L+L+ F             G    
Sbjct: 568 VFTGPDTKI-----MLNA---GVTPTKVS--RISRELNLSVFMNFALLFVLCFAAGIVNG 617

Query: 318 ---------RSWLEMFQIS--------VSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAI 360
                    R++ E   I+        VS  VA I     + +++ +++ +++ A+   I
Sbjct: 618 VYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFI 677

Query: 361 V-------RRL-----PSVET----LGSVNVICSDKTGTLTSNHMTVSK 393
                    RL     P   T    LG +  I SDKTGTLT N M   K
Sbjct: 678 YGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKK 726

>Kwal_23.3556
          Length = 1597

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 77/198 (38%), Gaps = 45/198 (22%)

Query: 553  KRAMTDSSSKLVEDDISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA 612
            ++    S  +LVE   + L   G   + D  +  V  AID+  + GI + M+TGD   TA
Sbjct: 1004 RKEKMHSVGELVE---TSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETA 1060

Query: 613  VNIARQIGI--------------PVIDPKLS----------------VLSGDKLNEMTDD 642
            +NI     +                I  KL+                V+ G  L     +
Sbjct: 1061 INIGYSCNLIHDYSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESN 1120

Query: 643  --------QLANVIDHVNIFARATPEHKLNIVRALRR--RGDVVAMTGDGVNDAPALKLA 692
                    +L    D V I  RA+P  K  +V  +R   +  V    GDG ND   ++ A
Sbjct: 1121 PTLMSVFVELCTKTDSV-ICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSA 1179

Query: 693  DIGVSM-GRMGTDVAKEA 709
            DIGV + G+ G   ++ +
Sbjct: 1180 DIGVGIAGKEGLQASRSS 1197

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 105/284 (36%), Gaps = 70/284 (24%)

Query: 180 GDLVRFRIGDRIPADIRIIECND---------LTID-ESNLTG-----ETDPVHKSYKAL 224
           GD V     + +PAD+ ++ C+D         + +D E+NL       E   V K+   L
Sbjct: 273 GDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGL 332

Query: 225 SR------------DSYNDQPNSIVPVAERT------NIAYMGTLVKE-GNGRGIVVGTG 265
           +             D +N + N  +    R       +I Y G++++   N  G+VV TG
Sbjct: 333 TEFKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTG 392

Query: 266 RETSFGNVFEMMSSIEKP--KTP-LQ-------LTMDKLGKDLSLASFXXXXXXXXXXXX 315
            ET        M++I+ P  K P LQ       L M  +   ++L S             
Sbjct: 393 EETKI-----RMNAIKNPRIKAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVD 447

Query: 316 QGRSWLEMFQISVSLAVAA----------IPEGLPIIVTVTLALGVLRM----------A 355
             R+W  +F     LA             IP  L + + +  A+    M           
Sbjct: 448 NNRAWY-LFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAET 506

Query: 356 KRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGS 399
                 R    +E LG V+ I SDKTGTLT N M    +   GS
Sbjct: 507 NTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGS 550

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 90/239 (37%), Gaps = 64/239 (26%)

Query: 532  ETIIDCANTLASEGLRVLAFA-------------------KRAMTDSSSKLVED--DISD 570
            E  +   +  ++EGLR L +A                   K ++TD   K+ E   +I D
Sbjct: 1019 ERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIED 1078

Query: 571  -LVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQI---------- 619
             L   G+  + D  +  V  AI++  + GI + M+TGD   TA+NI              
Sbjct: 1079 GLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVV 1138

Query: 620  ---------------------------GIPVID-PKLSVLSGDKLNEMTDDQLANVIDHV 651
                                        + VID   +++  G+        +L    D V
Sbjct: 1139 ILTTTDENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSV 1198

Query: 652  NIFARATPEHKLNIVRALRRRGD--VVAMTGDGVNDAPALKLADIGVSM-GRMGTDVAK 707
             I  RA+P  K  +V  +R      V    GDG ND   ++ ADIGV + G+ G   ++
Sbjct: 1199 -ICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASR 1256

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 41/189 (21%)

Query: 244 NIAYMGTLVKE-GNGRGIVVGTGRETSFGNVFEMMSSIEKPKTPLQLTMDKLG------- 295
           N+ Y G++++   N  G+V+ +G ET        M++++ P+T       K+        
Sbjct: 406 NVIYRGSILRNTQNVVGMVIFSGEETKI-----RMNALKNPRTKAPKLQRKINMIIVFMV 460

Query: 296 ---KDLSLASFXXXXXXXXXXXXQGRSWLEMFQISVSLA------VAAIPEGLPIIVTVT 346
                +SL S+            Q ++W  +FQ    +A      +      +P+ + VT
Sbjct: 461 FVVATISLFSYLGHVLHKKKYIDQNKAWY-LFQADAGVAPTIMSFIIMYNTVIPLSLYVT 519

Query: 347 LALGVLRMAKRKAI----------------VRRLPSVETLGSVNVICSDKTGTLTSNHMT 390
           +   ++++ + K +                 R    +E LG V+ I SDKTGTLT N M 
Sbjct: 520 ME--IIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMI 577

Query: 391 VSKIWCLGS 399
             K    GS
Sbjct: 578 FRKFSLCGS 586

>Scas_505.4
          Length = 1025

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 656 RATPEHKLNIVRALRRR-GDVVAMTGDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709
           R +P  K  +V+ ++R+   ++   GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 593 RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 648

>Scas_227.0d
          Length = 307

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 15/21 (71%)

Query: 371 GSVNVICSDKTGTLTSNHMTV 391
           GS   +C DKTGTLT N M+V
Sbjct: 3   GSATAVCFDKTGTLTENVMSV 23

>Scas_463.3
          Length = 315

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 7/100 (7%)

Query: 598 GIHIIMITGDSENTAVNIARQIGIPVIDPKLSVLSGDKLNEMTDDQLANVIDHVNIFARA 657
           G  + +++G     A  IA+++   V   K + L  D   ++T   L +++D      + 
Sbjct: 181 GSKLAVLSGGFIQFASFIAKELKFDV--AKANTLEMDTEGKLTGKVLGDIVD-----GQC 233

Query: 658 TPEHKLNIVRALRRRGDVVAMTGDGVNDAPALKLADIGVS 697
             E  L +    +   +   M GDG ND PA+ +A  G++
Sbjct: 234 KAETLLELCEKYQCPVEASCMVGDGGNDLPAMSVAGFGIA 273

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,503,792
Number of extensions: 1204687
Number of successful extensions: 4132
Number of sequences better than 10.0: 92
Number of HSP's gapped: 4092
Number of HSP's successfully gapped: 193
Length of query: 937
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 826
Effective length of database: 12,753,511
Effective search space: 10534400086
Effective search space used: 10534400086
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)