Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04290g42241620990.0
YGL169W (SUA5)42640512721e-174
Kwal_14.150440140712141e-166
Scas_707.4944141812011e-163
AEL300C41840611841e-161
KLLA0A03135g40440411471e-156
ABR227C75796655.8
ABR063C49299638.7
CAGL0F08261g43861639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04290g
         (416 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces c...   813   0.0  
YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in ...   494   e-174
Kwal_14.1504                                                          472   e-166
Scas_707.49                                                           467   e-163
AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..794...   460   e-161
KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces c...   446   e-156
ABR227C [821] [Homologous to ScYLR069C (MEF1) - SH] (827283..829...    30   5.8  
ABR063C [654] [Homologous to ScYMR023C (MSS1) - SH] (507671..509...    29   8.7  
CAGL0F08261g complement(823014..824330) highly similar to sp|P00...    29   9.3  

>CAGL0I04290g 380844..382112 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein,
           start by similarity
          Length = 422

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/416 (96%), Positives = 402/416 (96%)

Query: 1   MTLLHKLSTFCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHII 60
           MTLLHKLSTFCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHII
Sbjct: 1   MTLLHKLSTFCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHII 60

Query: 61  RDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDY 120
           RDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDY
Sbjct: 61  RDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDY 120

Query: 121 EDGDILRNIPKIYHPLIEKXXXXXXXXXXXXXXERNVSLSKLTTGDQPTFAVRIPANSIA 180
           EDGDILRNIPKIYHPLIEK              ERNVSLSKLTTGDQPTFAVRIPANSIA
Sbjct: 121 EDGDILRNIPKIYHPLIEKLWPGPLTILLPIPPERNVSLSKLTTGDQPTFAVRIPANSIA 180

Query: 181 RALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLC 240
           RALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLC
Sbjct: 181 RALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLC 240

Query: 241 LPPALLRPGGFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVL 300
           LPPALLRPGGFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVL
Sbjct: 241 LPPALLRPGGFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVL 300

Query: 301 LPNDSDTQMQLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTE 360
           LPNDSDTQMQLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTE
Sbjct: 301 LPNDSDTQMQLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTE 360

Query: 361 FLVSELGASGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG 416
           FLVSELGASGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG
Sbjct: 361 FLVSELGASGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG 416

>YGL169W (SUA5) [1821] chr7 (186063..187343) Protein involved in
           translation initiation, mutation suppresses the effect
           of an aberrant upstream ATG in CYC1 [1281 bp, 426 aa]
          Length = 426

 Score =  494 bits (1272), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 253/405 (62%), Positives = 309/405 (76%), Gaps = 9/405 (2%)

Query: 19  TEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAFPTETVYGLG 78
           T++LKV+ LSI+F  +AHIDG LP + D  +  AL++AA IIRDT+ETVAFPTETVYGLG
Sbjct: 18  TKILKVNPLSIIFSPDAHIDGSLPTITDPETEAALVEAARIIRDTDETVAFPTETVYGLG 77

Query: 79  GSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYND--YEDGDILRNIPKIYHPL 136
           GS+LNDNSV +IY+AKNRPSDNPLITHVSSIDQLNRK++N        +  NIP IY PL
Sbjct: 78  GSALNDNSVLSIYRAKNRPSDNPLITHVSSIDQLNRKVFNQPHLSGTSLFDNIPSIYRPL 137

Query: 137 IEKXXXXXXXXXXXXXXERNVSLSKLTTGDQPTFAVRIPANSIARALIALADTPIAAPSA 196
           I                  + +LSKLTT DQPTFAVRIPAN +ARALIAL+DTPIAAPSA
Sbjct: 138 ISSLWPGPLTILLPVPSSEHSALSKLTTADQPTFAVRIPANPVARALIALSDTPIAAPSA 197

Query: 197 NASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYEDI 256
           NASTRPSPTLASHVYHDLK +IP+I+DGGAC VGVESTVVDGLC PP LLRPGGFTYE+I
Sbjct: 198 NASTRPSPTLASHVYHDLKDKIPIILDGGACKVGVESTVVDGLCNPPTLLRPGGFTYEEI 257

Query: 257 LHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPN-DSDTQMQLIDKM 315
           + LGGE+W  CKVENKKT+ +GEKVRTPGMKY+HY+PSAKV++L+P+ + D  ++ +D+M
Sbjct: 258 VKLGGEAWSLCKVENKKTVEKGEKVRTPGMKYRHYSPSAKVVLLVPHCEGDGILKGVDRM 317

Query: 316 ----KVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGASGE 371
               ++  +  + +   KK+AI+T+LKL     +  +F   ++  +KT F++  LG SGE
Sbjct: 318 ERLKRLIETELKANSNIKKIAILTSLKLRDSDLQSKIFNEPDF-SSKT-FIIERLGQSGE 375

Query: 372 AIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG 416
            IQ NLFAALRK DE D VD I VEGI+E  EGLAVMNRLRKA+ 
Sbjct: 376 EIQTNLFAALRKVDENDKVDLIFVEGINEEGEGLAVMNRLRKAAA 420

>Kwal_14.1504
          Length = 401

 Score =  472 bits (1214), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 246/407 (60%), Positives = 293/407 (71%), Gaps = 19/407 (4%)

Query: 10  FCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAF 69
             KMS   +T +LKVD  SIVF ++AHIDG LP + DA +   LL+AA IIRDT+ TV F
Sbjct: 6   ISKMS--FQTRILKVDPKSIVFSDSAHIDGSLPTITDAETERNLLEAARIIRDTDNTVGF 63

Query: 70  PTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDYEDGDILRNI 129
           PTETVYGLGGSSLNDNSV NIYKAKNRPSDNPLI+HVSSIDQLNR+I+       IL NI
Sbjct: 64  PTETVYGLGGSSLNDNSVLNIYKAKNRPSDNPLISHVSSIDQLNRRIFGQSHATSILHNI 123

Query: 130 PKIYHPLIEKXXXXXXXXXXXXXXERNVSLSKLTTGDQPTFAVRIPANSIARALIALADT 189
           P+IY PLIEK              +   +LSKLTT DQPTFAVRIP+N +ARALIAL+DT
Sbjct: 124 PEIYRPLIEKLWPGPLTILLSVPPKS--TLSKLTTADQPTFAVRIPSNPVARALIALSDT 181

Query: 190 PIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPG 249
           PIAAPSAN STRPSPTLASHV+HDL+GRIPLI+DGGAC VGVESTVVDGL  PP LLRPG
Sbjct: 182 PIAAPSANQSTRPSPTLASHVFHDLQGRIPLILDGGACTVGVESTVVDGLVSPPLLLRPG 241

Query: 250 GFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQM 309
           GFT+E +  +GG  W NCKVENKKT+S GEKVRTPGMKY+HY+P AKV + +P +++  +
Sbjct: 242 GFTWEQVRSMGGPQWANCKVENKKTVSAGEKVRTPGMKYRHYSPRAKVFLFVPQENELAI 301

Query: 310 -QLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGA 368
            Q ++ +   +     DI  K+ A+++TL       ++ + +   YK          LG 
Sbjct: 302 EQRLETVSRIIKESTKDI--KRFAVLSTLTFP---QDLLVDSRGIYKS---------LGH 347

Query: 369 SGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKAS 415
           +   IQANLFA LR+ DE DNVD I VEGI E  EGLAVMNRLRKA+
Sbjct: 348 TNIEIQANLFALLREVDEKDNVDIIFVEGIDEEGEGLAVMNRLRKAA 394

>Scas_707.49
          Length = 441

 Score =  467 bits (1201), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 249/418 (59%), Positives = 296/418 (70%), Gaps = 13/418 (3%)

Query: 1   MTLLHKLSTFCKMSQP-LRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHI 59
           + L  +L T   M+ P  +T++ KVD   I FPEN+HIDG LP + D  +  ALL+AA I
Sbjct: 28  INLARRLITTTTMASPSFQTKIAKVDPTKIFFPENSHIDGTLPIITDPITESALLEAAQI 87

Query: 60  IRDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYND 119
           IRDT++TVAFPTETVYGLGGS+LND SV NIYKAKNRPSDNPLITHVSSI+QLNRKI+  
Sbjct: 88  IRDTDQTVAFPTETVYGLGGSALNDQSVINIYKAKNRPSDNPLITHVSSINQLNRKIFKS 147

Query: 120 YEDGDILRNIPKIYHPLIEKXXXXXXXXXXXXXXERNVSLSKLTTGDQPTFAVRIPANSI 179
           ++    L+NIP IYH LI+                R  +LS  TT  QPTFAVRIP+N I
Sbjct: 148 HKTDSSLQNIPIIYHKLIKTLWPGPLTILLPTENTRG-TLSVKTTNSQPTFAVRIPSNVI 206

Query: 180 ARALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGL 239
           ARALIAL+DTPIAAPSAN ST+PSPTLASHV+HDLKG+IPLI+DGG CNVGVESTV+DGL
Sbjct: 207 ARALIALSDTPIAAPSANTSTKPSPTLASHVFHDLKGKIPLILDGGPCNVGVESTVLDGL 266

Query: 240 CLPPALLRPGGFTYEDILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIV 299
             PP LLRPGG T E IL LGG+ W +CKVENK+ + +GE VRTPGMKYKHY+P AKVI+
Sbjct: 267 SRPPMLLRPGGLTLEHILELGGQDWIDCKVENKQNVKQGETVRTPGMKYKHYSPDAKVIL 326

Query: 300 LLPNDSDTQMQLIDKMKVFLSSHQPDIIDKKVAIMTTLKLTPILN-EISLFASSNYKGTK 358
           L+P     Q   +      L+        KK+AI+T     PILN E  LF ++      
Sbjct: 327 LIPPPDSNQRPTVKSYLHELNEIVGQEKGKKIAILT----GPILNREEKLFPNN------ 376

Query: 359 TEFLVSELGASGEAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG 416
           T+ +V  LG  G  IQANLFA LR+ADE DNVD +IVEG SE  EGLA+MNRL+KAS 
Sbjct: 377 TDIIVKHLGDEGNEIQANLFAMLREADEIDNVDVMIVEGSSEDGEGLAIMNRLKKASA 434

>AEL300C [2205] [Homologous to ScYGL169W (SUA5) - SH] (78172..79428)
           [1257 bp, 418 aa]
          Length = 418

 Score =  460 bits (1184), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 236/406 (58%), Positives = 292/406 (71%), Gaps = 22/406 (5%)

Query: 19  TEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAFPTETVYGLG 78
           T+VL+VD  +I F   AHIDG LP ++D  +   LL+AA +IRD  ETVAFPTETVYGLG
Sbjct: 21  TKVLRVDPSAIHFSATAHIDGSLPRISDPETEKHLLEAARLIRDDGETVAFPTETVYGLG 80

Query: 79  GSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDYEDGDILRNIPKIYHPLIE 138
           GSSLND SVRNIYKAKNRPSDNPLI+HVSSI QLNR+IY    +GD+LRNIP +YH L+ 
Sbjct: 81  GSSLNDASVRNIYKAKNRPSDNPLISHVSSIAQLNRRIYQQDREGDVLRNIPVVYHELVR 140

Query: 139 KXXXXXXXXXXXXXXERNVSLSKLTTGDQPTFAVRIPANSIARALIALADTPIAAPSANA 198
           +              E   +LS LTT  QPTFAVRIPA+ +ARALIAL+DTPIAAPSAN 
Sbjct: 141 QLWPGPLTILLPINEE--TALSVLTTAGQPTFAVRIPADPVARALIALSDTPIAAPSANV 198

Query: 199 STRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYEDILH 258
           STRPSPT A HVYHDLKG+IPLI+DGG+C VGVESTV+DGL  PP LLRPGGFTYE+I+ 
Sbjct: 199 STRPSPTAAEHVYHDLKGKIPLILDGGSCRVGVESTVIDGLVNPPMLLRPGGFTYEEIIE 258

Query: 259 LGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQMQLIDKMKV- 317
           LGGE W +CKVEN+ T+  GEKVRTPGMKYKHY+P A  +   P + D  +   ++MK+ 
Sbjct: 259 LGGEQWSHCKVENRMTVGSGEKVRTPGMKYKHYSPRASTVAFAPINDD--LPTSERMKIV 316

Query: 318 ------FLSSHQPDIIDKKVAIMTTLKL-TPILNEISLFASSNYKGTKTEFLVSELGASG 370
                 +++SH  D   +KV ++T++     +L  I+          + + +V  LG+SG
Sbjct: 317 TSEIMKYMTSHGTD-KRQKVGLLTSIMFPNNLLESIT---------DEVDVVVYSLGSSG 366

Query: 371 EAIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKASG 416
           + +Q+NLFA LR+ DE D VD I VEGIS+ +EGLAVMNRLRKA+G
Sbjct: 367 KEVQSNLFAMLRRLDEEDEVDLIFVEGISDRNEGLAVMNRLRKAAG 412

>KLLA0A03135g 279951..281165 similar to sp|P32579 Saccharomyces
           cerevisiae YGL169w SUA5 translation initiation protein
           singleton, start by similarity
          Length = 404

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 237/404 (58%), Positives = 286/404 (70%), Gaps = 19/404 (4%)

Query: 17  LRTEVLKVDALSIVFPENAHIDGKLPEVNDAPSRDALLKAAHIIRDTEETVAFPTETVYG 76
           L T +LKVD  +I F ++AHIDG LP    A +   LL+AA IIRDT ETVAFPTETVYG
Sbjct: 8   LTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNLLEAAGIIRDTSETVAFPTETVYG 67

Query: 77  LGGSSLNDNSVRNIYKAKNRPSDNPLITHVSSIDQLNRKIYNDY-EDGDILRNIPKIYHP 135
           LGGS+LND SV+NIYKAKNRPSDNPLITH+SS+ QLNR IY+D  +D   L ++P+IYHP
Sbjct: 68  LGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQLNRVIYSDISDDCKPLSHVPEIYHP 127

Query: 136 LIEKXXXXXXXXXXXXXXERNV-SLSKLTTGDQPTFAVRIPANSIARALIALADTPIAAP 194
           L+EK                N  +LSKLTT +QPTFA RIPAN IARALIAL+DTPIAAP
Sbjct: 128 LVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQPTFACRIPANPIARALIALSDTPIAAP 187

Query: 195 SANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYE 254
           SANASTRPSPT A HV+HDL GRIPLI+DGG C+VGVESTVVDGL  PP LLRPGGFTYE
Sbjct: 188 SANASTRPSPTTAEHVFHDLNGRIPLILDGGKCSVGVESTVVDGLVTPPMLLRPGGFTYE 247

Query: 255 DILHLGGESWRNCKVENKKTLSEGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQMQLIDK 314
           +IL++GG  W+ C VE K  + + EKV+TPGMKY+HY+P AKVI+L+P + D+Q+   ++
Sbjct: 248 NILNIGGPLWKECLVETKVNIKDDEKVKTPGMKYRHYSPKAKVILLVP-EGDSQIISSER 306

Query: 315 MKVFLSSHQPDIID---KKVAIMTTLKLTPILNEISLFASSNYKGTKTEFLVSELGASGE 371
           +    S    +II    KKVA + +L L             N      + +   LG +G+
Sbjct: 307 LGRLKSLVDKEIIQQGAKKVAFLNSLHL-------------NKHFIDGKCIHESLGTTGK 353

Query: 372 AIQANLFAALRKADETDNVDTIIVEGISETSEGLAVMNRLRKAS 415
            IQANLFA LRK DE DNVD I+VEG     EGLA+MNRLRKA+
Sbjct: 354 EIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNRLRKAA 397

>ABR227C [821] [Homologous to ScYLR069C (MEF1) - SH]
           (827283..829556) [2274 bp, 757 aa]
          Length = 757

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 10/96 (10%)

Query: 109 IDQLNR-KIYNDYEDGDILRN--IPKIYHPLIEKXXXXXXXXXXXXXXERNVSLSKLTTG 165
           +D +NR  IYN+ E+G++LR   +P+    L+E+              E    ++++   
Sbjct: 241 VDIINRVAIYNEGENGEVLRKGPVPEELQDLVEEKRLLLVETLADVDDE----MAEIFLD 296

Query: 166 DQ-PTFAVRIPANSIARALIALADTPIAAPSANAST 200
           +Q PT  V+   ++I RA IA   TP+   SA A+T
Sbjct: 297 EQEPT--VQQIKDAIRRATIARKFTPVLMGSALANT 330

>ABR063C [654] [Homologous to ScYMR023C (MSS1) - SH]
           (507671..509149) [1479 bp, 492 aa]
          Length = 492

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 46/99 (46%), Gaps = 10/99 (10%)

Query: 174 IPANSIARALIALADTPIAAPSANASTRPSPTLASHVYHDL--KGRIPLIIDGGACNVGV 231
           +PA + A  + AL+ TP+   SA A  R S T A  VY  L    R P        N+  
Sbjct: 12  VPATTYAPTIYALS-TPMGQKSAIAVVRVSGTHARLVYEKLTDSKRPPTPRRASLRNLYS 70

Query: 232 ESTVVDGLCLPPALL----RPGGFTYEDILHL---GGES 263
             +  + + L  AL     +PG FT EDIL L   GG++
Sbjct: 71  PQSAPEKVFLDSALTLFFEQPGTFTGEDILELHVHGGKA 109

>CAGL0F08261g complement(823014..824330) highly similar to sp|P00924
           Saccharomyces cerevisiae YGR254w ENO1 enolase I or
           sp|P00925 Saccharomyces cerevisiae YHR174w ENO2 enolase
           II, start by similarity
          Length = 438

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 25/61 (40%), Gaps = 4/61 (6%)

Query: 182 ALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRIPLIIDGGACNVGVESTVVDGLCL 241
           AL      P+ A S + + R    L S VYH LK      I   A NVG E  +   L  
Sbjct: 166 ALQEFLIAPVGAESFHEALR----LGSEVYHKLKALAKKRIGSSAGNVGDEGGIAPSLST 221

Query: 242 P 242
           P
Sbjct: 222 P 222

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,757,870
Number of extensions: 540431
Number of successful extensions: 1664
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1680
Number of HSP's successfully gapped: 16
Length of query: 416
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 312
Effective length of database: 12,995,837
Effective search space: 4054701144
Effective search space used: 4054701144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 63 (28.9 bits)