Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04268g33431315040.0
YGL161C (YIP5)3102692905e-30
KLLA0A03113g2652381347e-09
AEL299W2491951001e-04
Kwal_14.1513250231870.005
Scas_489.662266770.14
ADR309W1486205720.56
KLLA0F13134g39472710.64
AGL226C135860662.9
KLLA0D10758g85034653.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04268g
         (329 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04268g complement(379149..380153) weakly similar to sp|P53...   583   0.0  
YGL161C (YIP5) [1828] chr7 complement(199214..200146) Protein th...   116   5e-30
KLLA0A03113g complement(277880..278677) some similarities with c...    56   7e-09
AEL299W [2206] [Homologous to ScYGL161C - SH] complement(80282.....    43   1e-04
Kwal_14.1513                                                           38   0.005
Scas_489.6                                                             34   0.14 
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...    32   0.56 
KLLA0F13134g complement(1212025..1213209) similar to sgd|S000421...    32   0.64 
AGL226C [4086] [Homologous to ScYCR081W (SRB8) - SH] (271523..27...    30   2.9  
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...    30   3.9  

>CAGL0I04268g complement(379149..380153) weakly similar to sp|P53108
           Saccharomyces cerevisiae YGL161c, hypothetical start
          Length = 334

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/313 (95%), Positives = 299/313 (95%)

Query: 1   MMSDSDRLXXXXXXXXXXXXXXSEPNPFEEHANTSHNKYGSGTGDNIMGDESGKTVNDLP 60
           MMSDSDRL              SEPNPFEEHANTSHNKYGSGTGDNIMGDESGKTVNDLP
Sbjct: 1   MMSDSDRLFDIDDGMDGVDDFISEPNPFEEHANTSHNKYGSGTGDNIMGDESGKTVNDLP 60

Query: 61  PAYDNTIALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDS 120
           PAYDNTIALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDS
Sbjct: 61  PAYDNTIALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDS 120

Query: 121 RDPEEQNFEIDDEDEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQA 180
           RDPEEQNFEIDDEDEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQA
Sbjct: 121 RDPEEQNFEIDDEDEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQA 180

Query: 181 AEDGSYLPSTFWEKQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIY 240
           AEDGSYLPSTFWEKQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIY
Sbjct: 181 AEDGSYLPSTFWEKQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIY 240

Query: 241 GYSNLIWVSISVILGVLEGFSQPVARSTKWLEFIIFGLGLIPVFFYILRESMYRIQNKVV 300
           GYSNLIWVSISVILGVLEGFSQPVARSTKWLEFIIFGLGLIPVFFYILRESMYRIQNKVV
Sbjct: 241 GYSNLIWVSISVILGVLEGFSQPVARSTKWLEFIIFGLGLIPVFFYILRESMYRIQNKVV 300

Query: 301 PTSELFKEIYKVP 313
           PTSELFKEIYKVP
Sbjct: 301 PTSELFKEIYKVP 313

>YGL161C (YIP5) [1828] chr7 complement(199214..200146) Protein that
           oligomerizes and associates with Ygl161p and Rab
           proteins, may be involved in vesicular transport, member
           of the YIP1 family [933 bp, 310 aa]
          Length = 310

 Score =  116 bits (290), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/269 (32%), Positives = 130/269 (48%), Gaps = 42/269 (15%)

Query: 23  SEPNPFEEHA---NTSHNKYGSGTGD---NIMGD--ESGKTVNDL-PPAYDNTIALEPQR 73
           +EPNPF++     + + N   +G G    N  G   ES      + PPAYD  I      
Sbjct: 23  NEPNPFDDATVPDSPNMNNSTAGKGSEFYNTTGSKAESAPLQGQMDPPAYDQVIGQN--- 79

Query: 74  VAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDSRDPEEQNFEIDDE 133
              D DG + +  L PGL+NYYS+YFQ+     KKR+    +F  D            + 
Sbjct: 80  ---DNDG-LGRNGLRPGLINYYSKYFQIDLTQFKKRLSAVLTFRNDHNS---------ES 126

Query: 134 DEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQAAEDGSYLPSTFWE 193
           +ED     +DLYG VWITAT VM  F +   +  +   ++ GV      D +        
Sbjct: 127 NEDN----TDLYGAVWITATVVMINFTMSRGLNFIISDVIEGVKTGEDIDRA-------- 174

Query: 194 KQFVNLIHSIWLYYAHTFISPLLIYRGF---QNHYDGMKMKSRYELISIYGYSNLIWVSI 250
            QF  L+HSIWL+Y +TF  P +  +     ++       KS  ELIS+YGY+NLIW+ +
Sbjct: 175 SQFKKLLHSIWLFYGYTFGVPFITMQVLNRDEHSERNRSFKSVPELISVYGYANLIWIPV 234

Query: 251 SVILGVLEGFSQPVARSTKWLEFIIFGLG 279
            VIL +L+   +   R+ + +++ I  LG
Sbjct: 235 CVILNILDMSKR--LRTVQAIQWAIVALG 261

>KLLA0A03113g complement(277880..278677) some similarities with
           ca|CA3594|IPF6076.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 265

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 100/238 (42%), Gaps = 44/238 (18%)

Query: 67  IALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSF--YQDSRDPE 124
           I LE  R AP    +I  GK    + +  S YFQ+    LK++++        +  RDPE
Sbjct: 41  ITLETTREAPQP--AITTGK--ASIFSKLSPYFQVDETTLKQKLITALKLGELKSLRDPE 96

Query: 125 EQNFEIDDEDEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQAAEDG 184
            Q           A    DLY  VWITAT +M  F+  +   ++               G
Sbjct: 97  SQ-----------ADAQLDLYSTVWITATVIMVLFLSYSGKSVI---------------G 130

Query: 185 SYLPSTFWEK-QFVNLIHSIWLYYAHTFISPLLIYR----GFQNHYDGMKMKSRYELISI 239
           S + ++F +   F  +I+ ++L+Y +    P+L +      F+  +D +        I  
Sbjct: 131 SLITNSFSDVIDFQIMINCLFLFYIYVLGVPILAFLICKFVFKEPFDVITA------IDT 184

Query: 240 YGYSNLIWVSISVILGVLEGFSQPVARSTKWLEFIIFGLGLIPVFFYILRESMYRIQN 297
           YG SN++WV I  I  V+ G   P     +W+   I G     + +  L+  +  +QN
Sbjct: 185 YGVSNVVWVPIGFI-SVVTGLVGPFENIIEWVLVAIGGAYSGGIIYIQLKNVVTELQN 241

>AEL299W [2206] [Homologous to ScYGL161C - SH]
           complement(80282..81031) [750 bp, 249 aa]
          Length = 249

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 85/195 (43%), Gaps = 31/195 (15%)

Query: 71  PQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDSRDPEEQNFEI 130
            + VA     S    +L  GL N  + Y+ +++E L  +    RS     +    Q  E+
Sbjct: 26  AEHVATGTSMSAGDPQLGGGLFNTLAPYYAVTSEQLFHK---TRSSLMLQK---VQTLEM 79

Query: 131 DDEDEDEASVLSDLYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQAAEDGSYLPST 190
            +         +++Y  VWI  +A +A +V   L  ++ + L      +  EDG      
Sbjct: 80  GNAA-------TEIYSTVWIILSASIALYVSRGLRTVLSEIL------RGQEDGGS---- 122

Query: 191 FWEKQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIYGYSNLIWV-- 248
               Q+  L+H +WL+  +    PL+     Q  +   +     EL+  YG+  L+W+  
Sbjct: 123 --HGQYQILVHVLWLFATYVVAVPLVFKLVVQYAFS--EALHGLELVQWYGFGCLVWIPL 178

Query: 249 -SISVILGVL-EGFS 261
             IS++LG+L EG++
Sbjct: 179 TPISLVLGLLPEGWA 193

>Kwal_14.1513
          Length = 250

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 96/231 (41%), Gaps = 55/231 (23%)

Query: 24  EPNPFEEHANTSHNKYGSGTGDNIMGDESGKTVNDLPPAYDNTIALEPQRVAPDRDGSIP 83
           EPNPF   A+ S   YG+   D+I  D                +AL+   V    D  IP
Sbjct: 3   EPNPF---ADESTRHYGTTIADSIPDD----------------VALDITPVKTSAD--IP 41

Query: 84  QGKLPPGLLNYYSRYFQLSNEGLKKRIMYPRSFYQDSRDPEEQNFEIDDEDEDEASVLSD 143
                    + Y+ Y+Q+  E L+ RI    +          ++ +   E+E    +  +
Sbjct: 42  SA-------STYADYYQVDYEKLRARIKCAIA---------AKSLK---ENEGGEELEPE 82

Query: 144 LYGPVWITATAVMAKFVVVTLVEIVKDGLVLGVPRQAAEDGSYLPSTFWEKQFVNLIHSI 203
           LY PVW+T  A +A +V   +VE +        P Q  E G +            L   +
Sbjct: 83  LYAPVWVTVCAGLAGYVARGVVEFLWSLATGQAPLQ--EVGQH-----------RLAPGL 129

Query: 204 WLYYAHTFISPLLIYRGFQNHYDGMKMK-SRYELISIYGYSNLIWVSISVI 253
            + + +T+  PL++ R        + ++ +   L++IYGYS ++WV I V+
Sbjct: 130 LVAFFYTWGCPLVV-RTVARVVLKLDLEGTLLTLVTIYGYSLVVWVPIVVL 179

>Scas_489.6
          Length = 622

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 185 SYLPS-TFWEKQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELISIYGYS 243
           + LP+ T+W  Q  N   +  L Y        LI+R   N     KMK  YE IS++G S
Sbjct: 25  AKLPTETYWSSQTPNEAKTETLLYEQ------LIHRDKLNKISQEKMKQGYEPISVHGLS 78

Query: 244 NLIWVS 249
           N  +++
Sbjct: 79  NQEYIT 84

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
            complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 85/205 (41%), Gaps = 28/205 (13%)

Query: 78   RDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRI----MYPRSFYQDSRDPEEQN------ 127
            +D S+P  K  P +LNY   +   +   ++KR+     Y  +FY +S   E++       
Sbjct: 1054 KDASLPDAKDDPIVLNYQDMHEFYTGYTVRKRLRLIDQYRHTFYLNSLRCEKRPVYGINL 1113

Query: 128  ---FEIDDEDEDEASVLSDLYGPV---WITATAVMAKFVVVTLVEIVKDG--LVLGVPRQ 179
                 +      E +V+S+L  P+    +T   ++ +F ++T   I  D   L LG+  +
Sbjct: 1114 VRLVSVHHRPPLECNVMSELMKPLETRLVTHKRIIDEFAIITPTAITLDTRVLSLGLDSE 1173

Query: 180  AAEDGSYLPSTFWE-KQFVNLIHSIWLYYAHTFISPLLIYRGFQNHYDGMKMKSRYELIS 238
            AA           +  +  N  H +    +  F    L+       YD  K++S   L+ 
Sbjct: 1174 AAVHPVIKSDINTQLSRMKNPFHLLQTKLSIAFPDKSLL------QYDCGKLQSLAVLLR 1227

Query: 239  IY---GYSNLIWVSISVILGVLEGF 260
                 G+  LI+  ++ +L +LE F
Sbjct: 1228 RLKEEGHRALIFTQMTKVLDILEQF 1252

>KLLA0F13134g complement(1212025..1213209) similar to sgd|S0004216
           Saccharomyces cerevisiae YLR226w BUR2 divergent
           CDK-cyclin complex, start by similarity
          Length = 394

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 55  TVNDLPPAYDNTIALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLSNEGLKKRIMYPR 114
           TV+++    D    L+P+   P     I +G++   LLNY  R      E L  RIM  R
Sbjct: 320 TVDEIDKVIDEDRQLDPEPFNPYDYDIIKEGEVNEELLNYTERKI----EELSNRIMSER 375

Query: 115 SFYQDSRDPEEQ 126
           S  + S  P EQ
Sbjct: 376 SIKRPSEPPAEQ 387

>AGL226C [4086] [Homologous to ScYCR081W (SRB8) - SH]
           (271523..275599) [4077 bp, 1358 aa]
          Length = 1358

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 230 MKSRYELISIYGYSNLIWVS---ISVILGVLEGFSQPVARSTKWLEFIIFGLGLIPVFFY 286
           ++ ++E IS    S  IWVS   +S +   ++   +PV + T    F IFGL L  +F +
Sbjct: 648 LQEQFEHISCLPISVKIWVSEWYLSYVCSPVDNVLKPVDKGTVIKNFTIFGLYLKEIFHF 707

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 122 DPEEQNFEIDDEDEDEASVLSDLYGPVWITATAV 155
           D E  +F I+DEDEDE   +   + P  +T+++V
Sbjct: 273 DEEVDDFNIEDEDEDEKCPICVKHVPTKVTSSSV 306

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,025,116
Number of extensions: 510368
Number of successful extensions: 2538
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2559
Number of HSP's successfully gapped: 25
Length of query: 329
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 227
Effective length of database: 13,065,073
Effective search space: 2965771571
Effective search space used: 2965771571
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)