Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04224g94292846780.0
YGL163C (RAD54)89894533160.0
KLLA0A03069g89596530710.0
AEL297W89593629320.0
Scas_668.1887557826620.0
Kwal_14.153784287726500.0
KLLA0F11814g9315589771e-117
AGL212W9035439151e-108
Scas_718.409265339101e-108
YBR073W (RDH54)9245629041e-107
Kwal_27.105139005489011e-106
CAGL0M01958g9205698841e-104
Scas_549.410795327292e-81
Sklu_2125.310525677248e-81
KLLA0E22726g10335447175e-80
CAGL0I01694g10715387178e-80
AEL065C10255407096e-79
YJR035W (RAD26)10855497082e-78
YOR304W (ISW2)11205136234e-67
CAGL0I09614g10395176101e-65
Kwal_34.160827264675972e-65
CAGL0C01683g11154806004e-64
Kwal_34.1592510254825825e-62
Scas_665.1710605125816e-62
Scas_652.1710254905782e-61
KLLA0F24838g10624795737e-61
Scas_662.713424925732e-60
CAGL0M04807g17304865714e-60
YOR290C (SNF2)17034865705e-60
Kwal_23.477713014825633e-59
KLLA0E23804g18735285643e-59
KLLA0F04521g13444855624e-59
Kwal_14.160011025305595e-59
AER375C12884825606e-59
CAGL0H05533g19045185601e-58
Scas_594.717034905572e-58
YIL126W (STH1)13594855553e-58
Scas_597.810654925524e-58
Kwal_56.2344214354855536e-58
YPL082C (MOT1)18675495546e-58
CAGL0L11770g14764825501e-57
YER164W (CHD1)14684775501e-57
Kwal_26.916414544865492e-57
Scas_576.614574755492e-57
KLLA0C17578g15254835464e-57
AFR562C14444865455e-57
CAGL0G08756g13544865412e-56
AFR537W10254855372e-56
KLLA0B08327g15344845402e-56
Scas_664.918595435413e-56
KLLA0F06710g10965025364e-56
Scas_520.58635255306e-56
ADL098C8045195286e-56
YBR245C (ISW1)11294845356e-56
AFL040W10864845331e-55
AEL256C18665135351e-55
KLLA0F07513g10485185302e-55
KLLA0E04048g8265195233e-55
ACR286C10195375241e-54
AGR123C14224815172e-53
CAGL0J02662g8445205093e-53
Kwal_47.180778095215073e-53
Scas_548.410545284921e-50
Kwal_26.712310815414912e-50
Kwal_27.1138813343043083e-28
Scas_669.2013973143002e-27
Kwal_55.2014314943073003e-27
Sklu_1582.22831712804e-27
ADR309W14863042941e-26
CAGL0M01188g14501712942e-26
YGL150C (INO80)14893102932e-26
Scas_646.3*14561522922e-26
CAGL0H06193g11261562913e-26
CAGL0E05038g14843092914e-26
YAL019W (FUN30)11311632904e-26
YFR038W8532582884e-26
YDR334W15141702887e-26
KLLA0E08965g14893082888e-26
KLLA0F21758g15723042871e-25
AGR379W14143152833e-25
AAR147W15801472395e-20
Kwal_47.177719721582322e-19
AFR220W10851602261e-18
CAGL0A03432g11511782243e-18
KLLA0F17479g11141782233e-18
CAGL0G09493g14081552181e-17
Scas_721.10011371772172e-17
CAGL0K07766g8301722117e-17
YBR114W (RAD16)7901742091e-16
ADL345C7461672081e-16
Kwal_23.36607681512082e-16
Scas_591.107721752072e-16
Kwal_14.186813571492072e-16
YLR032W (RAD5)11691622073e-16
YOR191W (RIS1)16191682073e-16
KLLA0B09240g8001512044e-16
KLLA0C05368g16051392047e-16
Scas_674.12d13231591885e-14
Sklu_2412.711271571813e-13
KLLA0F12166g15281781439e-09
Kwal_14.128715181501412e-08
AAL030C15391251351e-07
YLR247C15561501287e-07
CAGL0B05049g1470631215e-06
Scas_573.91502651196e-06
Sklu_2432.91475611000.001
Sklu_2234.2100668950.004
KLLA0F23716g554153770.57
Kwal_34.1608029048693.4
KLLA0D08932g27846693.5
KLLA0B09900g453110694.8
YNL137C (NAM9)48669685.6
Kwal_27.999926437676.1
Sklu_2393.1055058686.8
Scas_588.1669356686.9
CAGL0M02233g76780687.2
Scas_700.1970074679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04224g
         (928 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04224g complement(369858..372686) highly similar to sp|P32...  1806   0.0  
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...  1281   0.0  
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...  1187   0.0  
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...  1134   0.0  
Scas_668.18                                                          1030   0.0  
Kwal_14.1537                                                         1025   0.0  
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   380   e-117
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   357   e-108
Scas_718.40                                                           355   e-108
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   352   e-107
Kwal_27.10513                                                         351   e-106
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   345   e-104
Scas_549.4                                                            285   2e-81
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           283   8e-81
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   280   5e-80
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   280   8e-80
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   277   6e-79
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   277   2e-78
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   244   4e-67
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   239   1e-65
Kwal_34.16082                                                         234   2e-65
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   235   4e-64
Kwal_34.15925                                                         228   5e-62
Scas_665.17                                                           228   6e-62
Scas_652.17                                                           227   2e-61
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   225   7e-61
Scas_662.7                                                            225   2e-60
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   224   4e-60
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   224   5e-60
Kwal_23.4777                                                          221   3e-59
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   221   3e-59
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   221   4e-59
Kwal_14.1600                                                          219   5e-59
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   220   6e-59
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   220   1e-58
Scas_594.7                                                            219   2e-58
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   218   3e-58
Scas_597.8                                                            217   4e-58
Kwal_56.23442                                                         217   6e-58
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   218   6e-58
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   216   1e-57
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   216   1e-57
Kwal_26.9164                                                          216   2e-57
Scas_576.6                                                            216   2e-57
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   214   4e-57
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   214   5e-57
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   213   2e-56
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   211   2e-56
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   212   2e-56
Scas_664.9                                                            213   3e-56
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   211   4e-56
Scas_520.5                                                            208   6e-56
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   207   6e-56
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   210   6e-56
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   209   1e-55
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   210   1e-55
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...   208   2e-55
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   206   3e-55
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   206   1e-54
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   203   2e-53
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   200   3e-53
Kwal_47.18077                                                         199   3e-53
Scas_548.4                                                            194   1e-50
Kwal_26.7123                                                          193   2e-50
Kwal_27.11388                                                         123   3e-28
Scas_669.20                                                           120   2e-27
Kwal_55.20143                                                         120   3e-27
Sklu_1582.2 , Contig c1582 197-1048                                   112   4e-27
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   117   1e-26
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   117   2e-26
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   117   2e-26
Scas_646.3*                                                           117   2e-26
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   116   3e-26
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   116   4e-26
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   116   4e-26
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   115   4e-26
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   115   7e-26
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   115   8e-26
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   115   1e-25
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   113   3e-25
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...    97   5e-20
Kwal_47.17771                                                          94   2e-19
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...    92   1e-18
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    91   3e-18
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...    91   3e-18
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...    89   1e-17
Scas_721.100                                                           88   2e-17
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    86   7e-17
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    85   1e-16
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...    85   1e-16
Kwal_23.3660                                                           85   2e-16
Scas_591.10                                                            84   2e-16
Kwal_14.1868                                                           84   2e-16
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    84   3e-16
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    84   3e-16
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...    83   4e-16
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...    83   7e-16
Scas_674.12d                                                           77   5e-14
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          74   3e-13
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    60   9e-09
Kwal_14.1287                                                           59   2e-08
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    57   1e-07
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    54   7e-07
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    51   5e-06
Scas_573.9                                                             50   6e-06
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              43   0.001
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         41   0.004
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    34   0.57 
Kwal_34.16080                                                          31   3.4  
KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces c...    31   3.5  
KLLA0B09900g 866210..867571 no similarity, hypothetical start          31   4.8  
YNL137C (NAM9) [4458] chr14 complement(368595..370055) Mitochond...    31   5.6  
Kwal_27.9999                                                           30   6.1  
Sklu_2393.10 YIL162W, Contig c2393 16513-18165                         31   6.8  
Scas_588.16                                                            31   6.9  
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    31   7.2  
Scas_700.19                                                            30   9.0  

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54, start by
           similarity
          Length = 942

 Score = 1806 bits (4678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 881/928 (94%), Positives = 881/928 (94%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDXXX 60
           MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSD   
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDLSR 60

Query: 61  XXXXXXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120
                    TVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD
Sbjct: 61  QRQLRQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120

Query: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDGEM 180
           TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDGEM
Sbjct: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDGEM 180

Query: 181 IIQDDTETVQNVQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQELLGNSPFNPTESM 240
           IIQDDTETVQNVQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQELLGNSPFNPTESM
Sbjct: 181 IIQDDTETVQNVQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQELLGNSPFNPTESM 240

Query: 241 KKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQLASQSSNINFLECS 300
           KKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQLASQSSNINFLECS
Sbjct: 241 KKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQLASQSSNINFLECS 300

Query: 301 DDDVCSKEVSPIDGGGAHDNSEANNDEAGNAXXXXXXXXXXXXXXXXXXXXXXXENDFLE 360
           DDDVCSKEVSPIDGGGAHDNSEANNDEAGNA                       ENDFLE
Sbjct: 301 DDDVCSKEVSPIDGGGAHDNSEANNDEAGNAIQNAKKNVKSKKQKKTITKKQQSENDFLE 360

Query: 361 ALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVN 420
           ALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVN
Sbjct: 361 ALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVN 420

Query: 421 NWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDT 480
           NWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDT
Sbjct: 421 NWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDT 480

Query: 481 LRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 540
           LRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA
Sbjct: 481 LRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 540

Query: 541 LLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTN 600
           LLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTN
Sbjct: 541 LLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTN 600

Query: 601 DILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCN 660
           DILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCN
Sbjct: 601 DILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCN 660

Query: 661 HPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIV 720
           HPDLIK            IPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIV
Sbjct: 661 HPDLIKLDEELDNYNDLDIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIV 720

Query: 721 LISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG 780
           LISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG
Sbjct: 721 LISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG 780

Query: 781 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSM 840
           CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSM
Sbjct: 781 CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSM 840

Query: 841 KMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAAM 900
           KMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAAM
Sbjct: 841 KMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAAM 900

Query: 901 LYGDATTWNHLNHKALEKTNDHLLKNEF 928
           LYGDATTWNHLNHKALEKTNDHLLKNEF
Sbjct: 901 LYGDATTWNHLNHKALEKTNDHLLKNEF 928

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score = 1281 bits (3316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/945 (68%), Positives = 744/945 (78%), Gaps = 80/945 (8%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQR-----SQTVPAN 55
           MARRRLPDRPPNGIGAGERPRLVPRPINV +S+++LTKPF+VP K+        +    +
Sbjct: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVQDSVNRLTKPFRVPYKNTHIPPAAGRIATGS 60

Query: 56  SDXXXXXXXXXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMED 115
            +            TV Y+GLD+++    D  E    ++    + KRR DALSA+RL +D
Sbjct: 61  DNIVGGRSLRKRSATVCYSGLDINA----DEAEYNSQDISFSQLTKRRKDALSAQRLAKD 116

Query: 116 PTRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPS 175
           PTRL  I+ TL++SF VPIKGYVQRHSLPLTLG K K+ PEPRPLHDPTDEFAIVLYDPS
Sbjct: 117 PTRLSHIQYTLRRSFTVPIKGYVQRHSLPLTLGMKKKITPEPRPLHDPTDEFAIVLYDPS 176

Query: 176 VDGEMIIQD------DTETVQNVQSSEDQ-------NAQEAEAEKSKYKHPKILSNGVKN 222
           VDGEMI+ D      + E+ + ++S++++       N+QE    +   +HP +++NGV+N
Sbjct: 177 VDGEMIVHDTSMDNKEEESKKMIKSTQEKDNINKEKNSQEERPTQRIGRHPALMTNGVRN 236

Query: 223 KTLQELLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDF 282
           K L+ELLG+S  N  E+ KKKFA+VPVVIDPKLAKILRPHQVEGV+FLYRCVTGLVMKD+
Sbjct: 237 KPLRELLGDSE-NSAEN-KKKFASVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDY 294

Query: 283 LDQQLASQSSNINFLECSDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAXXXXXXXXXXX 342
           L+ +         F   S+D + S E +                                
Sbjct: 295 LEAEA--------FNTSSEDPLKSDEKA-------------------------------- 314

Query: 343 XXXXXXXXXXXXENDFLEALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ 402
                           L   +K++ NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ
Sbjct: 315 ----------------LTESQKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQ 358

Query: 403 GKRLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWA 462
           GKRLI KCIIVCPSSLVNNWANEL+KWLGPNTL+PLAVDGKKSS+  G T+V++AI  WA
Sbjct: 359 GKRLIDKCIIVCPSSLVNNWANELIKWLGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWA 418

Query: 463 QAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPR 522
           QAQGRNIVKPVLIISY+TLRRNV QL+N  VGL+LADEGHRLKNGDSLTFTALDSI+CPR
Sbjct: 419 QAQGRNIVKPVLIISYETLRRNVDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPR 478

Query: 523 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQ 582
           RVILSGTPIQNDLSEYFALL+FSNPGLLG+R EFR+NFE PILR RDADATD ++  GE 
Sbjct: 479 RVILSGTPIQNDLSEYFALLSFSNPGLLGSRAEFRKNFENPILRGRDADATDKEITKGEA 538

Query: 583 KLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKG 642
           +LQ LS IVSKFIIRRTNDIL+KYLPCKYEHVIFVNL P Q ++YN LIKSR++KKVVKG
Sbjct: 539 QLQKLSTIVSKFIIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIKSREVKKVVKG 598

Query: 643 DGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFA 702
            GGSQPL+AIG+LKKLCNHP+L+             +PDDY++P  K+RDVQT++S KF+
Sbjct: 599 VGGSQPLRAIGILKKLCNHPNLLNFEDEFDDEDDLELPDDYNMPGSKARDVQTKYSAKFS 658

Query: 703 ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRF 762
           ILERFLHKIKTESDDKIVLISNYTQTLDLIE+MCR +HY++VRLDGTMSINKRQKLVDRF
Sbjct: 659 ILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQKLVDRF 718

Query: 763 NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 822
           NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY
Sbjct: 719 NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIY 778

Query: 823 RFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETF 882
           RFISTGTIEEKI+QRQSMKMSLSSCVVDAKEDVERLFS DNLRQLFQ N+ TIC+THET+
Sbjct: 779 RFISTGTIEEKIFQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQKNENTICETHETY 838

Query: 883 QCKRCNKHGQQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKNE 927
            CKRCN  G+Q+ RA AMLYGDATTWNHLNH ALEKTNDHLLKNE
Sbjct: 839 HCKRCNAQGKQLKRAPAMLYGDATTWNHLNHDALEKTNDHLLKNE 883

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
           Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
           ATPase of the SNF2P family, start by similarity
          Length = 895

 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/965 (63%), Positives = 719/965 (74%), Gaps = 121/965 (12%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVK--------------S 46
           MARRRLPDRPPNGIGAG RP L PR ++ ++++  LTKPFKVP K              S
Sbjct: 1   MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPFKVNKTDHAKRYGVRSS 60

Query: 47  QRSQTVPANSDXXXXXXXXXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDA 106
           +RSQT  AN D                + LD D                   +  +R DA
Sbjct: 61  RRSQTTYANMD----------------SSLDSD-------------------LHVKRKDA 85

Query: 107 LSARRLMEDPTRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDE 166
           LS  RL  +P+RLDTI  TL++SF VPIKGYV RH++P+ LGTK KV+  PRPLHDPTDE
Sbjct: 86  LSLSRLNAEPSRLDTIYSTLRRSFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDE 145

Query: 167 FAIVLYDPSVDGEMIIQ-DDTETVQN--VQSSEDQNAQEAEAEKSKYK-----------H 212
            AIVLYDP+VDG++  Q +D E+ +   V + + Q  +++E++  K K           H
Sbjct: 146 LAIVLYDPTVDGDIPEQHEDLESFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHH 205

Query: 213 PKILSNGVKNKTLQELLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYR 272
           PK+LSNGVKNKTL+ELLG+S  N +    KKF NVPVVIDPKLAKILRPHQVEGV+FLYR
Sbjct: 206 PKMLSNGVKNKTLKELLGSSEDNTS----KKFPNVPVVIDPKLAKILRPHQVEGVRFLYR 261

Query: 273 CVTGLVMKDFLDQQ--LASQSSNINFLECSDDDVCSKEVSPI--DGGGAHDNSEANNDEA 328
           CVTGLVMKDFLD +  L S S ++   +   D   +   SP+  D     D  + N +  
Sbjct: 262 CVTGLVMKDFLDAKTVLDSSSQSMEKADTQADSNITGSKSPVETDVSSLKDVIKINEN-- 319

Query: 329 GNAXXXXXXXXXXXXXXXXXXXXXXXENDFLEALKKSQSNNRGAYGCIMADEMGLGKTLQ 388
                                                 S NRGAYGCIMADEMGLGKTLQ
Sbjct: 320 --------------------------------------SRNRGAYGCIMADEMGLGKTLQ 341

Query: 389 CIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLA 448
           C+ALMWT+L+QGPQG+R I KCIIVCPSSLVNNWANE+ KWLGP +LS LA+DGKKSSL 
Sbjct: 342 CLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLAIDGKKSSLN 401

Query: 449 SGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGD 508
           +G  +VA+++ +WA AQGRNIVKPVLIISYDTLRRNV+QL+N EVGL+LADEGHRLKN D
Sbjct: 402 NG--NVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLADEGHRLKNAD 459

Query: 509 SLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSR 568
           SLTFTALDSI CPRRVILSGTPIQNDLSEYFALLNFSNPGLLG+RN+FR+NFE+PIL+SR
Sbjct: 460 SLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFRKNFELPILQSR 519

Query: 569 DADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYN 628
           D+ ATD +V  G+ +L+ LSNIVSKFIIRRTN+IL+KYLPCKYEHVIF+NLTPFQ+ +Y 
Sbjct: 520 DSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVIFINLTPFQQSLYQ 579

Query: 629 MLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDY--SIP 686
             I+SR +KK+VKGD  +QPLKAIG+LKKLCNHPDL++            IPDDY  S+ 
Sbjct: 580 HFIESRAVKKIVKGDS-NQPLKAIGLLKKLCNHPDLLELSEDIPGSEEL-IPDDYQSSVD 637

Query: 687 TGKSRD---VQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYAS 743
           +  SR+   +QT FS KF++L RFL+KIKTES+DKIVLISNYTQTLDLIE+MC + HY  
Sbjct: 638 SRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQTLDLIEKMCFSNHYGV 697

Query: 744 VRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAAD 803
           +RLDGTM+INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLIL+DPDWNPAAD
Sbjct: 698 LRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILLDPDWNPAAD 757

Query: 804 QQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDN 863
           QQALARVWRDGQKKDCFIYRFISTGTIEEKI+QRQSMKMSLSSCVVD KEDVERLFS DN
Sbjct: 758 QQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSLSSCVVDEKEDVERLFSSDN 817

Query: 864 LRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAAMLYGDATTWNHLNHKALEKTNDHL 923
           L+QLF+ + KTICDTHET+ CKRC K+G+QI++A  MLYGDAT+WNHLNH AL KTNDHL
Sbjct: 818 LKQLFKLDTKTICDTHETYNCKRC-KNGKQILKAPVMLYGDATSWNHLNHDALAKTNDHL 876

Query: 924 LKNEF 928
           LKNEF
Sbjct: 877 LKNEF 881

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
           complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/936 (62%), Positives = 689/936 (73%), Gaps = 65/936 (6%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDXXX 60
           MA+R+LPDRPPNG GAGERP + PR ++   + S LT+PF+VP+ S+R++    + +   
Sbjct: 1   MAKRKLPDRPPNGSGAGERPSVRPRRLDSGRAYSTLTQPFRVPLNSERTR----HGERYG 56

Query: 61  XXXXXXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120
                    T +  G     +++V GK               R+DALS +R+ +D  RL 
Sbjct: 57  VRATRRAVTTYAEEGGARSEENDVGGK---------------RIDALSEQRVSKDAQRLA 101

Query: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDGEM 180
            IE TL++SF VPIKGYV RH++PL LG K++V+  PRPLHDPT+EFAIVLYDP+VDGE 
Sbjct: 102 GIERTLRRSFSVPIKGYVPRHNIPLALGMKMRVVAPPRPLHDPTEEFAIVLYDPTVDGE- 160

Query: 181 IIQDDTETVQNVQSSEDQ-NAQEAEAEKSKYKHPKILSNGVKNKTLQELLGNSPFNPTES 239
            I D+T   +  Q   D  N ++A   +    HP+ LSNG++NKTL+ELLG     P   
Sbjct: 161 -IPDETPREEPAQKENDGGNEEQARPTRRTATHPEKLSNGLRNKTLRELLGTVTETP--- 216

Query: 240 MKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQLASQSSNINFLEC 299
              KF +VPVVIDP+LA+ILRPHQVEGV+FLYRCVTGL MKDFLD Q    +  +   + 
Sbjct: 217 ---KFPSVPVVIDPRLARILRPHQVEGVRFLYRCVTGLAMKDFLDTQAVLAAGEVQD-DG 272

Query: 300 SDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAXXXXXXXXXXXXXXXXXXXXXXXENDFL 359
           +  D  SK+  PI                                            + L
Sbjct: 273 TGKDPGSKDSEPI-----------------------VVEVLEETPTPTPTPTPTPSPEIL 309

Query: 360 EA-LKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSL 418
           +A    ++ +NRGAYGCIMADEMGLGKTLQCIALMWTLLRQG QG+  I KCIIVCPSSL
Sbjct: 310 DANAAMTRESNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSL 369

Query: 419 VNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISY 478
           VNNWANE+VKWLGP+ LSPLA+DG+KSSL++G  SVA++++ WA AQGRN+VKPVLIISY
Sbjct: 370 VNNWANEIVKWLGPDALSPLAIDGRKSSLSNG--SVAQSVRQWAIAQGRNVVKPVLIISY 427

Query: 479 DTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEY 538
           +TLRRNV+ L+  +VGL+LADEGHRLKNGDSLTFT+LDSINCPRRVILSGTPIQNDLSEY
Sbjct: 428 ETLRRNVENLKGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEY 487

Query: 539 FALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRR 598
           FALLNFSNPGLLGTR +FR+NFEIPILR RDADATD ++ +GE KL  LS IVSKFIIRR
Sbjct: 488 FALLNFSNPGLLGTRAQFRKNFEIPILRGRDADATDKEIAAGEVKLHELSQIVSKFIIRR 547

Query: 599 TNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKL 658
           TNDILSKYLPCKYEH++FVNL+P QK +Y   ++SR++ K++KG G SQPLKAIG+LKKL
Sbjct: 548 TNDILSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLMKGTG-SQPLKAIGLLKKL 606

Query: 659 CNHPDLIKXXXXXXXXXXXXIPDDY-SIPTGKSR------DVQTQFSGKFAILERFLHKI 711
           CNHPDL+             IPDDY S  T  SR      +VQT  S KFAILERFL KI
Sbjct: 607 CNHPDLLDLPDEIAGSTNL-IPDDYQSAMTHNSRGGRSHVEVQTTHSSKFAILERFLFKI 665

Query: 712 KTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFI 771
           K ES+DKIVLISNYTQTLDLIE+MCR  HY  +RLDGTM+INKRQKLVD+FNDP G+EFI
Sbjct: 666 KHESNDKIVLISNYTQTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFI 725

Query: 772 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
           FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI+TG+IE
Sbjct: 726 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIE 785

Query: 832 EKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHG 891
           EKI QR SMKMSLSSCVV+ KEDVERLFS +NLR LFQF+  T      T+ CKRC + G
Sbjct: 786 EKISQRPSMKMSLSSCVVEEKEDVERLFSSENLRPLFQFDSNTHMRYPPTYHCKRC-RDG 844

Query: 892 QQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKNE 927
           +Q+++A AMLYGDATTWNHLNH AL KTNDHLL+NE
Sbjct: 845 KQMIKAPAMLYGDATTWNHLNHDALLKTNDHLLRNE 880

>Scas_668.18
          Length = 875

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/578 (84%), Positives = 528/578 (91%), Gaps = 6/578 (1%)

Query: 357 DFLEA------LKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC 410
           DFL+A      + K++ NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLI KC
Sbjct: 284 DFLDAEAVNTGIVKTEQNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKC 343

Query: 411 IIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIV 470
           IIVCPSSLVNNWANELVKWLGP TLSPLAVDGKKSSLASG ++VAEA+ +WAQA GRNIV
Sbjct: 344 IIVCPSSLVNNWANELVKWLGPGTLSPLAVDGKKSSLASGNSTVAEAVHSWAQATGRNIV 403

Query: 471 KPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTP 530
           KPVLIISY+TLRRNV QL+N +VGL+LADEGHRLKNGDSLTFTALDSINCPRRVILSGTP
Sbjct: 404 KPVLIISYETLRRNVDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTP 463

Query: 531 IQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNI 590
           IQNDLSEYFALLNFSNPGLLGTR+EFR+NFE+PILRSRDAD+TD ++  GE++LQ LS I
Sbjct: 464 IQNDLSEYFALLNFSNPGLLGTRSEFRKNFELPILRSRDADSTDEEITKGEEQLQKLSTI 523

Query: 591 VSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLK 650
           VSKFIIRRTNDILSKYLPCKYEHVIFVNL PFQK VY+ L+KSRD+ K+VKG GG+QPLK
Sbjct: 524 VSKFIIRRTNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKSRDVNKMVKGVGGTQPLK 583

Query: 651 AIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHK 710
           AIGVLKKLCNHP+LI             IPD+Y++   KSRDVQ QFSGKFAILERFLHK
Sbjct: 584 AIGVLKKLCNHPNLINLDEEIDDFDDLEIPDEYNMQGSKSRDVQPQFSGKFAILERFLHK 643

Query: 711 IKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEF 770
           IKTESDDKIVLISNYTQTLDLIE+MCRN+HY+SVRLDGTM+INKRQKLVDRFNDPEGQEF
Sbjct: 644 IKTESDDKIVLISNYTQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEF 703

Query: 771 IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTI 830
           IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTG+I
Sbjct: 704 IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSI 763

Query: 831 EEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKH 890
           EEKIYQRQSMKMSLSSCVVDAKEDVERLFS DNLRQLFQ+NDKTIC+THET+ CKRCN  
Sbjct: 764 EEKIYQRQSMKMSLSSCVVDAKEDVERLFSSDNLRQLFQYNDKTICETHETYHCKRCNAA 823

Query: 891 GQQIMRAAAMLYGDATTWNHLNHKALEKTNDHLLKNEF 928
           G+Q +R+ AMLYGD TTWNHLNH ALEKTNDHLL+NEF
Sbjct: 824 GKQSVRSTAMLYGDPTTWNHLNHAALEKTNDHLLQNEF 861

 Score =  341 bits (875), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/296 (60%), Positives = 212/296 (71%), Gaps = 17/296 (5%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDXXX 60
           MARR+LPDRPPNGIG G+RPRLVPRPINV  SIS L+KPFKVP K+ + + + +  +   
Sbjct: 1   MARRKLPDRPPNGIGFGDRPRLVPRPINVQNSISTLSKPFKVPYKTAKPRALSSEHEKEV 60

Query: 61  XXXX----XXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDP 116
                        TVSY+GLD+ S    D  EN    L      KRR DALSA RL  DP
Sbjct: 61  VQVNGRILRKRSHTVSYSGLDISSA-AADVDEN---SLTFSQSTKRRKDALSASRLANDP 116

Query: 117 TRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSV 176
           TRL +IE TLK+SF VPIKGY+QRHSLPLTLGTK K+I EPRPLHDPTDEFAIVLYDPSV
Sbjct: 117 TRLHSIEFTLKRSFTVPIKGYIQRHSLPLTLGTKKKIIMEPRPLHDPTDEFAIVLYDPSV 176

Query: 177 DGEMIIQDDTETVQN------VQSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQELLG 230
           DG+MI+ D+++ V+N       +   D   +E +    K+ HPK+++NGV+NK+L+ELLG
Sbjct: 177 DGDMIMHDNSQDVRNDKKDSTKEKGTDSKDEETKTGSKKFAHPKLMTNGVRNKSLKELLG 236

Query: 231 NSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQ 286
           +S     +  KKKF NVPVVIDPKL KILRPHQVEGVKFLYRCVTGLVMKDFLD +
Sbjct: 237 SS---EEDEAKKKFPNVPVVIDPKLTKILRPHQVEGVKFLYRCVTGLVMKDFLDAE 289

>Kwal_14.1537
          Length = 842

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/877 (62%), Positives = 633/877 (72%), Gaps = 55/877 (6%)

Query: 1   MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPVKSQRSQTVPANSDXXX 60
           MARR+LPDRPPNGIGAG+RP L PR ++   + + LT+PFKVP++          ++   
Sbjct: 1   MARRKLPDRPPNGIGAGQRPSLRPRQLDSLAAHATLTRPFKVPLRKLEPNCAANPANAAI 60

Query: 61  XXXXXXXXXTVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTRLD 120
                     V       ++  E +  E+   E G +  + +R DALSARRL  DP RL 
Sbjct: 61  GKRTTRSKTHVYEL---TETAPEFEHSES---ESGLK--RAKRPDALSARRLSRDPDRLR 112

Query: 121 TIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPLHDPTDEFAIVLYDPSVDG-- 178
            I+  L++SF VPIKGYV RH++PL+LGTK K++  PRPLHDPT+EFAIVLYDPSVDG  
Sbjct: 113 KIDSLLRRSFTVPIKGYVPRHNIPLSLGTKPKIVLGPRPLHDPTEEFAIVLYDPSVDGPT 172

Query: 179 -EMIIQDDTETVQNV----------QSSEDQNAQEAEAEKSKYKHPKILSNGVKNKTLQE 227
            E++IQ  ++  ++            +   Q +           HPK LSNG+ NKTL+E
Sbjct: 173 PELLIQMRSQLPKSSSASALSKPRGSTRATQLSPTPPPPSPHPSHPKKLSNGLPNKTLRE 232

Query: 228 LLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLVMKDFLDQQL 287
           LLG+        + +KFA+VPVVIDP L KILRPHQVEGV+FLYRCVTGLVMKD+LDQQ 
Sbjct: 233 LLGD------RQVDEKFASVPVVIDPLLVKILRPHQVEGVRFLYRCVTGLVMKDYLDQQ- 285

Query: 288 ASQSSNINFLECSDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAXXXXXXXXXXXXXXXX 347
                    L+ +D    SKE +P           A++  +  A                
Sbjct: 286 -------ALLQNADAATTSKEQTP----------PADHLPSPPAELLPSPPADPAHTLTS 328

Query: 348 XXXXXXXENDFLEALKKSQS---NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGK 404
                  E D      +S S    NRGAYGCIMADEMGLGKTLQCIAL+WTLLRQGPQGK
Sbjct: 329 DEKLPNQELDTPAPTDESSSEVSQNRGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGK 388

Query: 405 RLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQA 464
             I KCIIVCPSSLVNNWANE+VKWLG  TL+ L +DGKKSSL +G  +VA+A++ WA A
Sbjct: 389 PTIDKCIIVCPSSLVNNWANEIVKWLGKGTLASLPIDGKKSSLNNG--TVAQAVRGWALA 446

Query: 465 QGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
           +GR++VKPVLIISY+TLRRNV+ L N E+GLLLADEGHRLKN +S TFTALDSINCPRRV
Sbjct: 447 RGRSVVKPVLIISYETLRRNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRV 506

Query: 525 ILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKL 584
           ILSGTPIQNDLSEYFALLNFSNPGLLGTR+EFRRNFE PIL SRDADATD+++  G +KL
Sbjct: 507 ILSGTPIQNDLSEYFALLNFSNPGLLGTRSEFRRNFENPILLSRDADATDSEIAKGNEKL 566

Query: 585 QLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVK-GD 643
           Q LS IVSKFIIRRTNDILSKYLPCKYEHV+FVNL PFQ+ VY +++K RD+K  VK G 
Sbjct: 567 QALSTIVSKFIIRRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLKCRDVKLAVKDGT 626

Query: 644 GGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSR---DVQTQFSGK 700
             SQPLK IG LKKLCNHPDL++            IP+DY   T   R   +VQT +SGK
Sbjct: 627 TPSQPLKHIGALKKLCNHPDLLQ-LPEDVEGSEDVIPEDYRNSTLSKRGHAEVQTWYSGK 685

Query: 701 FAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVD 760
           F+IL RFLHKIKTESDDKIV+ISNYTQTLD+IERMCR   Y  VRLDGTM+INKRQKLVD
Sbjct: 686 FSILNRFLHKIKTESDDKIVIISNYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVD 745

Query: 761 RFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 820
           RFND EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF
Sbjct: 746 RFNDVEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCF 805

Query: 821 IYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVER 857
           IYRFI TGTIEEKIYQRQSMKMSLSSCVVD KEDVER
Sbjct: 806 IYRFICTGTIEEKIYQRQSMKMSLSSCVVDEKEDVER 842

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54 required for
           mitotic diploid-specific recombination and repair and
           meiosis, start by similarity
          Length = 931

 Score =  380 bits (977), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 221/558 (39%), Positives = 322/558 (57%), Gaps = 62/558 (11%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGP-------QGKRL---ISKCIIVCPSSLVNNWA 423
           GC++ADEMGLGKTL  I L+WTLL+Q P       +G  L   ISK +IVCP +L+ NW 
Sbjct: 315 GCLLADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWK 374

Query: 424 NELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-----PVLIISY 478
            E  KWL  N +  L +  + S                 +AQ R+ +K      VLI+ Y
Sbjct: 375 KEFKKWLPMNRIGVLTLHSRNSPTED-------------KAQVRSFLKVPRTYQVLIVGY 421

Query: 479 DTLRRNVKQLQNTE--VGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLS 536
           + L     +LQN +  + L++ DEGHRLKN DS     L S++  ++++LSGTPIQNDL 
Sbjct: 422 EKLLSIKDELQNEKRNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLE 481

Query: 537 EYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND--VKSGEQKLQLLSNIVSKF 594
           E++ +++F NPG+LG+   F+R + +PI RSRD +A  N   V+ G  +   L  I  +F
Sbjct: 482 EFYTIIDFINPGILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRF 541

Query: 595 IIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGV 654
           I+RRTN+IL +YLP + + +IF   T  Q + ++ ++    +         +  L  I +
Sbjct: 542 ILRRTNEILQQYLPPRTDLIIFCKPTAEQVEAFHKILTEGQLN--FSNMTFNSSLGLITL 599

Query: 655 LKKLCNHPDLIKXXXXXXXXXXXXIPDDY---SIPTGKSRDVQTQF-SGKFAILERFLHK 710
            KK+CN   LIK              D Y    +   ++     +F SGK  IL   LH+
Sbjct: 600 FKKICNSTRLIKT-------------DPYYEERLSQVQTSSTSGKFTSGKLRILLSLLHE 646

Query: 711 IKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFN-DPEGQE 769
           +KT++D+K+V+ISNYTQTLD+IE  C +  Y S RLDG+ +   R ++V  FN DP    
Sbjct: 647 LKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTRDQIVTSFNNDPSI-- 704

Query: 770 FIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGT 829
           F+FLLS+K+GG G+NLIGA+RL+L D DWNP+ D QA++R+ RDGQ++ CFIYR ++TG 
Sbjct: 705 FVFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQRRPCFIYRLVTTGC 764

Query: 830 IEEKIYQRQSMKMSLSSCVVDAKEDVER----LFSVDNLRQLFQFNDKTICDTHETFQCK 885
           I+EKI QRQ MK++LS   +D+  D  +    LF  + L+ LF  N  T+ +TH+     
Sbjct: 765 IDEKILQRQLMKIALSKKFLDSATDQSKNDDDLFQQEELKDLFTINLSTLSNTHDLI--- 821

Query: 886 RCNKHGQQIMRAAAMLYG 903
            CN  G+  +     + G
Sbjct: 822 -CNCSGEVEVLEEEEITG 838

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 36/63 (57%), Gaps = 10/63 (15%)

Query: 226 QELLGN---SP-FNPTESMKKKFAN------VPVVIDPKLAKILRPHQVEGVKFLYRCVT 275
           QEL+G    SP F+P         N      V V++DP L+K LRPHQ EGVKFLY CV 
Sbjct: 235 QELIGQITYSPLFDPVSIKDPLIMNKTENHKVSVIVDPLLSKTLRPHQREGVKFLYDCVM 294

Query: 276 GLV 278
            +V
Sbjct: 295 NMV 297

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
           complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  357 bits (915), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/543 (38%), Positives = 308/543 (56%), Gaps = 45/543 (8%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQG------------KRLISKCIIVCPSSLVNN 421
           GC++ADEMGLGKT   IAL+WTLL+Q P+             + +  K ++VCP +L+ N
Sbjct: 293 GCLLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGN 352

Query: 422 WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
           W  E +KWL  N +  L +  K +            ++N+ + Q       VLI+ Y+ L
Sbjct: 353 WKKEFIKWLPMNRIGILTLSSKNTPEKD-----KNDVRNFLRVQR---TYQVLILGYEKL 404

Query: 482 RRNVKQLQN--TEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 539
                +L    +++ LL+ DEGHRLKN  S     L  +   R+VIL+GTPIQNDL+E++
Sbjct: 405 LNVFSELDQAKSKLDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFY 464

Query: 540 ALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND--VKSGEQKLQLLSNIVSKFIIR 597
            ++NF NPG+LGT   F+R +  PI R+RD +   ND  V  GE + Q L  I  KFI+R
Sbjct: 465 TIINFINPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILR 524

Query: 598 RTNDILSKYLPCKYEHVIFVNLTPFQKQVYN-MLIKSR-DIKKVVKGDGGSQPLKAIGVL 655
           RT+ I++ YLP + + V+F   T  Q   +N +L+ +R D + +      +  L  I + 
Sbjct: 525 RTSSIIADYLPPRTDIVVFCKPTQHQLDAFNQVLVGTRVDFQNM----SFNSSLGLITLF 580

Query: 656 KKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTES 715
           KK+CN P L+              P          R  Q+  SGK  +L   LH+I   S
Sbjct: 581 KKICNSPSLVSSDSYFQSKVNGGTP--------ALRIAQSTTSGKLKVLMSLLHQIAHRS 632

Query: 716 D-DKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLL 774
           D +K+V+ISNYTQTLD+I  +  +   + +RLDG+    +R  +V+ FN  +   F FLL
Sbjct: 633 DNEKVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERDAIVNDFNRSQ-TIFGFLL 691

Query: 775 SSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKI 834
           S+K+GG G+NL+GA+RLIL D DWNP+ D QA++R+ RDGQKK CFIYR ++TG I+EKI
Sbjct: 692 SAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKI 751

Query: 835 YQRQSMKMSLSSCVVDAKED---VERLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHG 891
           +QRQ MK +LS   +D   D    + +F  ++L+ LF     T+ +TH+   C  C   G
Sbjct: 752 FQRQLMKNNLSKKFLDDHCDDKSSDNVFEQEDLKDLFSVQSGTLSNTHDLL-CS-CEGSG 809

Query: 892 QQI 894
           ++ 
Sbjct: 810 EEF 812

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 23/32 (71%)

Query: 247 VPVVIDPKLAKILRPHQVEGVKFLYRCVTGLV 278
           V VV+DP L+K LR HQ  G+KF+Y CV GL 
Sbjct: 241 VEVVVDPILSKKLRQHQRTGIKFMYDCVRGLA 272

>Scas_718.40
          Length = 926

 Score =  355 bits (910), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 213/533 (39%), Positives = 306/533 (57%), Gaps = 47/533 (8%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKR------------LISKCIIVCPSSLVNN 421
           GC++ADEMGLGKTL  I L+WTLL+Q P  K             L  K ++VCP +L+ N
Sbjct: 303 GCLLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGN 362

Query: 422 WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
           W  E  KWL  N +  L +  + +           A+KN+ + Q       VL+I Y+ L
Sbjct: 363 WKREFAKWLNLNRIGILTLSSRNTPEMDKT-----AVKNFLRVQR---TFQVLVIGYEKL 414

Query: 482 RRNVKQLQNTE--VGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 539
               ++L  +   + LL+ DEGHRLKNG S     L ++   R+++LSGTPIQNDL+E++
Sbjct: 415 LSVSEELHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFY 474

Query: 540 ALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND--VKSGEQKLQLLSNIVSKFIIR 597
            +++F NPG+LG+   F++ F  PI R RD +   N+  ++ GE + + + +I  KF +R
Sbjct: 475 TIIDFLNPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLR 534

Query: 598 RTNDILSKYLPCKYEHVIFVNLTPFQKQVYN-MLIKSR-DIKKVVKGDGGSQPLKAIGVL 655
           RTN ILSKYLP K + ++F   T  Q   +N +L +SR D   +      +  L  I + 
Sbjct: 535 RTNAILSKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANL----SFNSSLGLITLF 590

Query: 656 KKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTES 715
           KK+CN P LI             I  D  I     R +    SGK  IL   L KIK  +
Sbjct: 591 KKICNSPTLI----GDDSYYQSKIRPDGVIQERYDRSLN---SGKLKILMTLLEKIKGNT 643

Query: 716 D-DKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFN-DPEGQEFIFL 773
           + +K+V++SNYTQTLD+I+ +  +    S RLDG+    +R  +V+ FN +P    F FL
Sbjct: 644 NNEKVVIVSNYTQTLDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPS--IFAFL 701

Query: 774 LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEK 833
           LS+K+GG G+NLIGA+RLIL D DWNP+ D QA++R+ RDGQKK C+IYR I+TG I+EK
Sbjct: 702 LSAKSGGVGLNLIGASRLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEK 761

Query: 834 IYQRQSMKMSLSSCVVDAKEDVER------LFSVDNLRQLFQFNDKTICDTHE 880
           I QRQ MK SLS   +D+     +      LF+ ++L+ LF   + T  +TH+
Sbjct: 762 ILQRQLMKHSLSKKFLDSSYTTGKTGSNDDLFTKEDLKDLFTIMETTKSNTHD 814

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 31/44 (70%)

Query: 235 NPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLV 278
           NP    K + A+V V++DP L K+LRPHQ EGVKF+Y CV GL 
Sbjct: 235 NPIIMNKWRDADVDVIVDPLLGKLLRPHQREGVKFMYDCVMGLA 278

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
           mitotic diploid-specific recombination and repair and
           for meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  352 bits (904), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/562 (38%), Positives = 320/562 (56%), Gaps = 69/562 (12%)

Query: 368 NNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKR------------LISKCIIVCP 415
           N+    GC++AD+MGLGKTL  I L+WTL+RQ P   +            L  K ++VCP
Sbjct: 301 NDSDISGCLLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCP 360

Query: 416 SSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLI 475
            +L+ NW  E  KWL  + +  L +  + S           A++N+ + Q       VLI
Sbjct: 361 VTLIGNWKREFGKWLNLSRIGVLTLSSRNSPDMDKM-----AVRNFLKVQR---TYQVLI 412

Query: 476 ISYDTLRRNVKQLQNTE--VGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQN 533
           I Y+ L    ++L+  +  + +L+ DEGHRLKNG S     L S++  R+++L+GTPIQN
Sbjct: 413 IGYEKLLSVSEELEKNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQN 472

Query: 534 DLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND--VKSGEQKLQLLSNIV 591
           DL+E+F +++F NPG+LG+   F+R F IPI R+RD     N+  ++ GE++ + +  I 
Sbjct: 473 DLNEFFTIIDFINPGILGSFASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEIT 532

Query: 592 SKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGG----SQ 647
            +FI+RRTN IL KYLP K + ++F    P+ +Q+    +  +DI +  + D G    S 
Sbjct: 533 KRFILRRTNAILEKYLPPKTDIILFCK--PYSQQI----LAFKDILQGARLDFGQLTFSS 586

Query: 648 PLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKS--RDVQTQ-------FS 698
            L  I +LKK+CN P L+                  S P  KS  +D Q+Q        S
Sbjct: 587 SLGLITLLKKVCNSPGLVG-----------------SDPYYKSHIKDTQSQDSYSRSLNS 629

Query: 699 GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
           GK  +L   L  I+  + +K+V++SNYTQTLD+IE +      +  RLDG++   +R  +
Sbjct: 630 GKLKVLMTLLEGIRKGTKEKVVVVSNYTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSI 689

Query: 759 VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 818
           V  FN      F FLLS+K+GG G+NL+G +RLIL D DWNP+ D QA++R+ RDGQKK 
Sbjct: 690 VTSFNRNPAI-FGFLLSAKSGGVGLNLVGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKP 748

Query: 819 CFIYRFISTGTIEEKIYQRQSMKMSLS------SCVVDAKEDVERLFSVDNLRQLFQFND 872
           CFIYR ++TG I+EKI QRQ MK SLS      S + + +   + LF+ ++L+ LF  + 
Sbjct: 749 CFIYRLVTTGCIDEKILQRQLMKNSLSQKFLGDSEMRNKESSNDDLFNKEDLKDLFSVHT 808

Query: 873 KTICDTHETFQCKRCNKHGQQI 894
            T  +TH+   C  C+  G++I
Sbjct: 809 DTKSNTHDLI-CS-CDGLGEEI 828

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 28/44 (63%)

Query: 235 NPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGLV 278
           NP    K   A V V++DP L K LRPHQ EGVKF+Y C+ GL 
Sbjct: 238 NPIVMNKNAAAEVDVIVDPLLGKFLRPHQREGVKFMYDCLMGLA 281

>Kwal_27.10513
          Length = 900

 Score =  351 bits (901), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 212/548 (38%), Positives = 309/548 (56%), Gaps = 59/548 (10%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGP--------------QGKRLISKCIIVCPSSLV 419
           GC++ADEMGLGKTL  I L+WTLL+Q P              QG  L +K ++VCP +L+
Sbjct: 293 GCLLADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQG--LCNKILVVCPVTLI 350

Query: 420 NNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYD 479
            NW  E  KWL  N +  L +  K     S A      ++N+ + Q       VL+I Y+
Sbjct: 351 GNWKREFSKWLNVNRIGILTLSSK-----SNAEKDKLTVRNFLRVQR---TYQVLVIGYE 402

Query: 480 TLRRNVKQL--QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSE 537
            L    ++L    +++ L++ DEGHRLKNG S T  A+ S+  PR+++L+GTPIQNDL+E
Sbjct: 403 KLLSVTEELLEAKSKIDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAE 462

Query: 538 YFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDV--KSGEQKLQLLSNIVSKFI 595
           +F + +F N G+LGT ++F+R+F  PI R+RD +   N++  + G  K Q L  I   F 
Sbjct: 463 FFTIADFLNDGILGTFSKFKRDFINPITRARDLNNKHNNLIQEKGRDKTQELIEITKNFT 522

Query: 596 IRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSR--DIKKVVKGDGGSQPLKAIG 653
           +RRT + +SK+LP K + V+F   T  Q   +   + +   D  ++      +  L  I 
Sbjct: 523 LRRTAETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRLT----FNSSLGLIT 578

Query: 654 VLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRD---VQTQFSGKFAILERFLHK 710
           + KK+CN P LI               D Y + T K      +    SGK  +L   L  
Sbjct: 579 LFKKICNSPSLISQ-------------DSYYLETIKPNSEVKISAPDSGKLRVLMALLDN 625

Query: 711 IKTES-DDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQE 769
           ++  S  +K+V++SNYTQTLD+I+ M  +   +  RLDG+ +   R K+V+ FN      
Sbjct: 626 LRKLSPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDRDKIVNSFNTVPSI- 684

Query: 770 FIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGT 829
           F FLLS+K+GG G+NLIGA+RLIL D DWNPA D QA++R+ RDGQK++C+IYR ++TG 
Sbjct: 685 FAFLLSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQKRECYIYRLLTTGC 744

Query: 830 IEEKIYQRQSMKMSLSSCVVDAKEDV-----ERLFSVDNLRQLFQFNDKTICDTHETFQC 884
           I+EKI+QRQ  K SLSS  +    D      + LF  ++L+ LF  +  T  +TH+   C
Sbjct: 745 IDEKIFQRQLAKTSLSSKFMGDSADSNTESGDDLFGSEDLKDLFTVHATTSSNTHDLI-C 803

Query: 885 KRCNKHGQ 892
             C   GQ
Sbjct: 804 S-CQGLGQ 810

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 43/80 (53%), Gaps = 5/80 (6%)

Query: 203 AEAEKSKYKHPKILSNGV----KNKTLQELLGNSPF-NPTESMKKKFANVPVVIDPKLAK 257
           +++ K  +K   I+SNGV    K  T   L   S   NP        A+  VV+DP L+K
Sbjct: 190 SQSFKPAFKPSSIISNGVPKSSKEDTFLPLFDPSTIENPLIMNSFAEADTDVVVDPILSK 249

Query: 258 ILRPHQVEGVKFLYRCVTGL 277
            LRPHQ  GVKF+Y C+ GL
Sbjct: 250 HLRPHQRIGVKFMYDCILGL 269

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
           Saccharomyces cerevisiae YBR073w RDH54, hypothetical
           start
          Length = 920

 Score =  345 bits (884), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 221/569 (38%), Positives = 327/569 (57%), Gaps = 59/569 (10%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKR------------LISKCIIVCPSSLVNN 421
           GCI+AD+MGLGKTL  I L+WTLL+Q P   +            +ISK +IVCP +L+ N
Sbjct: 309 GCILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGN 368

Query: 422 WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
           W  E  KWLG N +  L ++  K+++     SV   IK        N    VLI+ Y+ +
Sbjct: 369 WKREFKKWLGLNRIGILTLN-PKNNVDMDKISVRNFIK-------VNRTYQVLILGYEKV 420

Query: 482 RRNVKQL--QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 539
               ++L  Q  ++ LL+ DEGHRLKNG S     L S++  ++VIL+GTPIQNDL+E+F
Sbjct: 421 LTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFF 480

Query: 540 ALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND--VKSGEQKLQLLSNIVSKFIIR 597
            +++F NPG+LGT   F++ +  PI R+RD +   N   ++ GE+K   L     +FI+R
Sbjct: 481 TIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILR 540

Query: 598 RTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGS----QPLKAIG 653
           R+N+ILSK+LP K + ++F   T  Q + +      RDI + V+ D  +      L  I 
Sbjct: 541 RSNNILSKFLPPKTDIILFCRPTIEQIKAF------RDIIENVRVDMNNITFNTSLGLIN 594

Query: 654 VLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKT 713
           ++KK+CN P L+                D +I T  ++   +  SGK  +L   L +IK 
Sbjct: 595 LMKKVCNSPSLLCNDPYYQSNV------DSNIFTVSNK---SNSSGKLTVLLELLLEIKA 645

Query: 714 ESD-DKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIF 772
            S  +K+V++SNYTQ+LD+I+ +  +   ++ RLDG     +R  LV+ FN+     F F
Sbjct: 646 TSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNTFNN-NPNIFGF 704

Query: 773 LLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEE 832
           LLS+KAGG G+NLIGA+RL+L D DWNPA D QA++R+ R+GQK+ C+IYR I+TG I+E
Sbjct: 705 LLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYIYRLITTGCIDE 764

Query: 833 KIYQRQSMKMS-----LSSCVVDAKEDVERLFSVDNLRQLFQFNDKTICDTHETFQCKRC 887
           KI QRQ MK +     LSS   D     + LF   +L+ LF  +  T  +TH+   C RC
Sbjct: 765 KILQRQLMKHNLTRKFLSSNTSDTGSANDDLFDKSDLKDLFTIHQNTKSNTHDLI-C-RC 822

Query: 888 NKHG------QQIMRAAAMLYGDATTWNH 910
           +  G      +++++A A L G    W++
Sbjct: 823 DGLGEEFDDDEEVLKAPA-LDGSFEQWSN 850

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 24/33 (72%)

Query: 245 ANVPVVIDPKLAKILRPHQVEGVKFLYRCVTGL 277
           + V +++DP L K+LR HQ  GVKF+Y C+ GL
Sbjct: 253 SEVDIIVDPLLCKMLRNHQRIGVKFMYDCLLGL 285

>Scas_549.4
          Length = 1079

 Score =  285 bits (729), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 182/532 (34%), Positives = 281/532 (52%), Gaps = 66/532 (12%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
           G I+ DEMGLGKT+Q IA + +L   G     L    +IVCP++++  W NEL  W  P 
Sbjct: 324 GGIIGDEMGLGKTIQIIAFLASLHHSG----LLNGPVLIVCPATVMKQWCNELHHWWPP- 378

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQA-----------QGRNIVKP---------- 472
            L  + +    S +++      E ++                Q R+  K           
Sbjct: 379 -LRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRSKTKASLESTFNIQS 437

Query: 473 ----------VLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPR 522
                     ++I +Y  LR + +QL        + DEGH+++N DS        I  P 
Sbjct: 438 LIDKVINDGHIIITTYVGLRIHSEQLLKVNWAYAVLDEGHKIRNPDSDISLTCKKIKTPN 497

Query: 523 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQ 582
           R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F +PI     A+AT+  V++G +
Sbjct: 498 RIILSGTPIQNNLIELWSLFDFIYPGKLGTLPVFQQQFVMPINAGGYANATNIQVQTGVK 557

Query: 583 KLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKG 642
               L N++S +++RR    ++K LP K E V+F  LT +QK  Y   + S ++ + ++G
Sbjct: 558 CATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCKLTQYQKNRYLEFLNSNELTQ-IRG 616

Query: 643 DGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFA 702
            G    L  I +L+K+CNHPDL++               DY  P         + SGK  
Sbjct: 617 -GRRHVLYGIDILRKICNHPDLLEREERQYET-------DYGNP---------KRSGKMQ 659

Query: 703 ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRH-----YASVRLDGTMSINKRQK 757
           ++++ L     E   K +L +   Q LD++E+  + +         +R+DGT +I+KRQ 
Sbjct: 660 VVKQLLLLWHKEG-HKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGTSNISKRQG 718

Query: 758 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
           LVD+FN+ +    +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK+
Sbjct: 719 LVDQFNNEDYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARERAWRIGQKR 776

Query: 818 DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLF 868
           +  IYR + +G+IEEKIY RQ  K  L++ ++ D K+  +R F ++ LR LF
Sbjct: 777 EVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKMNELRDLF 826

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  283 bits (724), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 186/567 (32%), Positives = 290/567 (51%), Gaps = 67/567 (11%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGP- 432
           G I+ DEMGLGKT+Q I+ + +L   G     L    +IVCP++++  W NE   W  P 
Sbjct: 305 GGIIGDEMGLGKTIQIISFLASLHHSG----MLDGPILIVCPATVMKQWCNEFHTWWPPF 360

Query: 433 --------------------NTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK- 471
                               + L  + ++      +    + ++  K+  +++  N+ K 
Sbjct: 361 RAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSKKTKSTMESK-LNLTKL 419

Query: 472 --------PVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRR 523
                    VLI +Y  LR +  +L   + G  + DEGH+++N DS        +    R
Sbjct: 420 VDKVVNDGHVLITTYVGLRLHADELLKVKWGYAVLDEGHKIRNPDSDISLTCKQLKTSNR 479

Query: 524 VILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQK 583
           VILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI     A+AT+  V++G + 
Sbjct: 480 VILSGTPIQNNLTELWSLFDFIFPGRLGTLPVFQQQFAIPINMGGYANATNIQVQTGYKC 539

Query: 584 LQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGD 643
              L +++S +++RR    ++K LP K E V+F  LT +Q+  Y   + S D+ K+   +
Sbjct: 540 AVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCKLTQYQRNKYLQFLNSGDLVKI--KN 597

Query: 644 GGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAI 703
           G  Q L  I +L+K+CNHPD++               + Y  P         + SGK  +
Sbjct: 598 GKRQVLYGIDILRKICNHPDILVRDMRHSE-------ESYGDP---------KRSGKMQV 641

Query: 704 LERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNR-----HYASVRLDGTMSINKRQKL 758
           +++ L K+  E   K +L +   Q LD++E+    R         +R+DGT +I  RQ L
Sbjct: 642 VKQLL-KLWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLTYLRMDGTTNIAARQHL 700

Query: 759 VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 818
           VD+FN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK++
Sbjct: 701 VDKFNNELYD--VFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRE 758

Query: 819 CFIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQFNDKTICD 877
             IYR +  G+IEEKIY RQ  K  L++ ++ D K+  +R F ++ L+ LF    +    
Sbjct: 759 VTIYRLMIAGSIEEKIYHRQIFKQFLTNKILKDPKQ--KRFFKMNELQDLFSLGGER--- 813

Query: 878 THETFQCKRCNKHGQQIMRAAAMLYGD 904
            HE  +      H    MR    L GD
Sbjct: 814 GHENQEFADEISHQTDQMRNTKSLEGD 840

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1033

 Score =  280 bits (717), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 183/544 (33%), Positives = 275/544 (50%), Gaps = 62/544 (11%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
           G I+ DEMGLGKT+Q IA + TL       ++L    ++VCP++++  W NE   W  P 
Sbjct: 285 GGIIGDEMGLGKTIQIIAFLATL----HHSRKLNGPVLVVCPATVMKQWCNEFHTWWPPF 340

Query: 434 TLSPLAVDGKKSSLASGATSVAEAI---------------------KNWAQAQGRNIVKP 472
               L   G  + +  G     E +                     K     + R  VK 
Sbjct: 341 RAVILHSIG--AGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTRTSLESRKSVKK 398

Query: 473 VL----------IISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPR 522
           +L          I +Y  LR + + L N   G  + DEGH+++N DS        +    
Sbjct: 399 LLEKVITDGHIIITTYVGLRLHSEALLNVRWGYAILDEGHKIRNPDSDISLTCKQLKTQN 458

Query: 523 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQ 582
           R+ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI     A+A++  VK+G +
Sbjct: 459 RIILSGTPIQNNLTELWSLFDFVYPGKLGTLPVFQQQFANPINMGGYANASNIQVKTGYK 518

Query: 583 KLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKG 642
               L +++S +++RR    ++K LP K E V+F  LT +QK  Y   + S ++ K+ KG
Sbjct: 519 CAVALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKLTQYQKSKYLEFLHSDELMKIRKG 578

Query: 643 DGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFA 702
               Q L  I +L+K+CNHPDL+                DY  P           SGK  
Sbjct: 579 K--RQVLYGIDILRKICNHPDLLDLKRKKMNDYEDA---DYGNPAR---------SGKMQ 624

Query: 703 ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNR-----HYASVRLDGTMSINKRQK 757
           ++++ L    ++   K +L +   Q LD+++     +         +R+DGT +I  RQ 
Sbjct: 625 VVKQLLLLWHSQG-HKTLLFTQSRQMLDILQEFISYKDPELSDLKFLRMDGTTNIGSRQS 683

Query: 758 LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
           LVD+FN+      +FLL+++ GG GINL GANR+I+ DPDWNP+ D QA  R WR GQK+
Sbjct: 684 LVDKFNNEPYD--VFLLTTRVGGLGINLTGANRIIIFDPDWNPSTDMQARERAWRIGQKR 741

Query: 818 DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQFNDKTIC 876
           +  IYR +  G+IEEKIY RQ  K  LS+ ++ D K+  +R F +++L  LF        
Sbjct: 742 EVTIYRLMIAGSIEEKIYHRQIFKQFLSNKILKDPKQ--KRFFKMNDLHDLFTLGGDNGY 799

Query: 877 DTHE 880
           +T E
Sbjct: 800 ETEE 803

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  280 bits (717), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 189/538 (35%), Positives = 279/538 (51%), Gaps = 74/538 (13%)

Query: 374 GCIMADEMGLGKTLQCIALMWTL----LRQGPQGKRLISKCIIVCPSSLVNNWANELVKW 429
           G I+ DEMGLGKT+Q  A +  L    L  GP         +IVCP++++  W NE+ +W
Sbjct: 317 GGIIGDEMGLGKTIQVTAFLAALHHSNLLSGP--------VLIVCPATVMKQWCNEIHQW 368

Query: 430 LGP-------------NTLSPLAVDGK-----KSSLAS-------GATSVAEAIKNWAQA 464
             P             N  S L  D       KS L +        A+ +   ++     
Sbjct: 369 WPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENASKLKSKVETGMHM 428

Query: 465 QGRNIVKPV------LIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSI 518
           Q  N++  V      +I +Y  LR +  +L N      + DEGH+++N DS        +
Sbjct: 429 Q--NLISKVVADGHIIITTYVGLRIHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKKL 486

Query: 519 NCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVK 578
            C  R+ILSGTPIQN+L E ++L +F  PG LGT   F++ F  PI     A+AT+  V+
Sbjct: 487 KCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQVQ 546

Query: 579 SGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKK 638
           +G +    L +++S +++RR    ++K LP K E V+F  LT FQ++ Y   + S ++ +
Sbjct: 547 TGYRCAVALRDLISPYLLRRVKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSDELSQ 606

Query: 639 VVKGDGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFS 698
            +KG G    L  I +L+K+CNHPDL+                DY   T    D +   S
Sbjct: 607 -IKG-GKRHVLYGIDILRKICNHPDLLDR--------------DYIKNTSGYGDPKR--S 648

Query: 699 GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRH-----YASVRLDGTMSIN 753
           GK  ++++ L   K+E   K +L +   Q LD++E   + +         +R+DGT SI 
Sbjct: 649 GKMQVVKQLLKLWKSEG-HKTLLFTQSRQMLDILEEFIKFKEPELSDIRYLRMDGTTSIQ 707

Query: 754 KRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 813
            RQ LVDRFN+      +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR 
Sbjct: 708 VRQTLVDRFNNESYD--VFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDLQARERAWRI 765

Query: 814 GQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQF 870
           GQK++  IYR + +GTIEEKIY RQ  K  L + V+ D K+  +R F    L+ LF  
Sbjct: 766 GQKREVSIYRLMISGTIEEKIYHRQIFKQFLMNKVLSDPKQ--KRFFKTKELQDLFSL 821

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
           (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  277 bits (709), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 178/540 (32%), Positives = 283/540 (52%), Gaps = 62/540 (11%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGP- 432
           G I+ DEMGLGKT+Q ++ + +L   G    +L    ++VCP++++  W +E   W  P 
Sbjct: 283 GGIVGDEMGLGKTIQIVSFLASLHHSG----KLKGPVLVVCPATVMKQWCSEFQTWWPPF 338

Query: 433 -----NTLSPLAVDGKKSS------LASGATSVAEAIKNWA-------QAQGRNIVKP-- 472
                +++    +  KK +      L     S   + + +A       Q + R  ++   
Sbjct: 339 RAVILHSIGAGMITRKKMTEEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLV 398

Query: 473 --------VLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
                   +LI +Y  L+ +   L +      + DEGH+++N D+        +  P R+
Sbjct: 399 QKVVDDGHILITTYLGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRI 458

Query: 525 ILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKL 584
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F  PI     A+AT+  V++G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFANPINAGGYANATNIQVQTGYKCA 518

Query: 585 QLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDG 644
             L +++S +++RR  + ++K LP K E V+F  +T FQK+ Y   + S D+ K+   +G
Sbjct: 519 VALRDLISPYLLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKYLQFLNSEDMIKI--KNG 576

Query: 645 GSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAIL 704
             Q L  I +L+K+CNHPDL++                +    G  R      SGK  ++
Sbjct: 577 RRQVLYGIDILRKICNHPDLLERDFRK-----------HEPSFGDPRR-----SGKMTVI 620

Query: 705 ERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRH-----YASVRLDGTMSINKRQKLV 759
           ++ L   K +   K +L +   Q LD++E    ++         +R+DGT +I  RQ LV
Sbjct: 621 KQLLLTWKKQGH-KALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQALV 679

Query: 760 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDC 819
           DRFN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR GQK+D 
Sbjct: 680 DRFNN--GPYHLFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRDV 737

Query: 820 FIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQFNDKTICDT 878
            IY  +  G+IEEKIY RQ  K  L++ V+ D K+  +R F ++ L  LF F      D+
Sbjct: 738 TIYLLMVAGSIEEKIYHRQIFKQFLTNKVLSDPKQ--KRFFKMNELHDLFSFGPGAASDS 795

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  277 bits (708), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 186/549 (33%), Positives = 281/549 (51%), Gaps = 74/549 (13%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGP- 432
           G I+ DEMGLGKT+Q IA +  L   G     L    +IVCP++++  W NE   W  P 
Sbjct: 317 GGIIGDEMGLGKTIQVIAFIAALHHSGL----LTGPVLIVCPATVMKQWCNEFQHWWPPL 372

Query: 433 ----------------------NTLSPLAVDGKKSSLA----SGATSVAEAIKNWAQAQG 466
                                 N L  L ++ K S  +      +T   +A+++ +    
Sbjct: 373 RTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKNSTRTKKALES-SYHLD 431

Query: 467 RNIVKPV-----LIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCP 521
           + I K V     LI +Y  LR +  +L   +    + DEGH+++N DS        +   
Sbjct: 432 KLIDKVVTDGHILITTYVGLRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTH 491

Query: 522 RRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGE 581
            R+ILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI     A+AT+  V++G 
Sbjct: 492 NRIILSGTPIQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTGY 551

Query: 582 QKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVK 641
           +    L +++S +++RR    ++K LP K E V+F  LT +Q+  Y   + S D+ ++  
Sbjct: 552 KCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEFLHSSDLNQI-- 609

Query: 642 GDGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKF 701
            +G    L  I +L+K+CNHPDL+                DY  P         + SGK 
Sbjct: 610 QNGKRNVLFGIDILRKICNHPDLLDRDTKRHNP-------DYGDP---------KRSGKM 653

Query: 702 AILERFL---HKIKTESDDKIVLISNYTQTLDLIERMCRNR-----HYASVRLDGTMSIN 753
            ++++ L   HK       K +L +   Q LD++E     +     H   +R+DGT +I 
Sbjct: 654 QVVKQLLLLWHK----QGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTNIK 709

Query: 754 KRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 812
            RQ LVDRFN+   + F +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA  R WR
Sbjct: 710 GRQSLVDRFNN---ESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWR 766

Query: 813 DGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQFN 871
            GQK++  IYR +  G+IEEKIY RQ  K  L++ ++ D K+  +R F +  L  LF   
Sbjct: 767 IGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTNRILTDPKQ--KRFFKIHELHDLFSLG 824

Query: 872 DKTICDTHE 880
            +    T E
Sbjct: 825 GENGYSTEE 833

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
           Ume6p-dependent transcriptional repression of several
           meiotic genes, has chromatin remodeling activity, has
           strong similarity to Drosophila nucleosome remodeling
           factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  244 bits (623), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 165/513 (32%), Positives = 261/513 (50%), Gaps = 59/513 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKTLQ I+ +  L       K++    +I+ P S ++NW  E +KW  PN +
Sbjct: 206 ILADEMGLGKTLQTISFLGYL----RYVKQIEGPFLIIVPKSTLDNWRREFLKW-TPN-V 259

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP----VLIISYDTLRRNVKQLQNT 491
           + L + G K + A                  RNI+      VLI SY+ + R    L+  
Sbjct: 260 NVLVLHGDKDTRADIV---------------RNIILEARFDVLITSYEMVIREKNALKRL 304

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
               ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G
Sbjct: 305 AWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFG 364

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611
               F   FE            +N  +  E  +Q L ++++ F++RR    + K L  K 
Sbjct: 365 DSELFDEWFE-----------QNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKI 413

Query: 612 EHVIFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDLIKX 667
           E  ++V +T  Q Q Y  L++ +DI  V     K +G ++ L  +  L+K CNHP L + 
Sbjct: 414 ETNVYVGMTDMQIQWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEG 472

Query: 668 XXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                        D++ I            SGK  IL++ L ++K E   ++++ S  ++
Sbjct: 473 AEPGPPYTT----DEHLIFN----------SGKMIILDKLLKRLK-EKGSRVLIFSQMSR 517

Query: 728 TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
            LD++E  C  R +   R+DG+ S  +R + +D +N P  ++F+FLL+++AGG GINL+ 
Sbjct: 518 LLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVT 577

Query: 788 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
           A+ +IL D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+ L   
Sbjct: 578 ADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQL 637

Query: 848 VVD---AKEDVERLFSVDNLRQLFQFNDKTICD 877
           V+     K+      S D+L  + QF  K + +
Sbjct: 638 VIQQGTGKKTASLGNSKDDLLDMIQFGAKNMFE 670

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2 or sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1, hypothetical
           start
          Length = 1039

 Score =  239 bits (610), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 160/517 (30%), Positives = 260/517 (50%), Gaps = 59/517 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKTLQ I+ +  L       K++    +++ P S ++NW  E  KW  PN  
Sbjct: 155 ILADEMGLGKTLQTISFLGYL----RYVKKIEGPFLVIVPKSTLDNWRREFFKW-TPNV- 208

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP----VLIISYDTLRRNVKQLQNT 491
                          +T+V +  K   Q   +NIV      VLI SY+ + R    L+  
Sbjct: 209 ---------------STTVLQGTKEQRQDILQNIVLEARFDVLITSYEMVIREKGYLKRL 253

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
               ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G
Sbjct: 254 AWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFG 313

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611
               F   F+            +N  +  E  +Q L  +++ F++RR    + K L  K 
Sbjct: 314 DSEVFDDWFQ-----------QNNSDQDQEVVVQQLHAVLNPFLLRRIKADVEKSLLPKI 362

Query: 612 EHVIFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDLIKX 667
           E  ++V +T  Q Q Y  L++ +DI  V     K +G ++ L  +  L+K CNHP L + 
Sbjct: 363 ETNVYVGMTDMQVQWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEG 421

Query: 668 XXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                             P   + +     +GK  +L++ L ++K E   ++++ S  ++
Sbjct: 422 AEPG--------------PPYTTDEHLIFNAGKMIVLDKLLKRLK-EKGSRVLIFSQMSR 466

Query: 728 TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
            LD++E  C  R+Y   R+DG+ S  +R   +D +N P  ++F+FLL+++AGG GINL+ 
Sbjct: 467 LLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINLVT 526

Query: 788 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
           A+ ++L D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+ L   
Sbjct: 527 ADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLDQL 586

Query: 848 VV---DAKEDVERLFSVDNLRQLFQFNDKTICDTHET 881
           V+     K+      S D+L ++ Q+  K + + + T
Sbjct: 587 VIQQGSGKKTANLGNSKDDLIEMIQYGAKNVFEKNGT 623

>Kwal_34.16082
          Length = 726

 Score =  234 bits (597), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 154/467 (32%), Positives = 238/467 (50%), Gaps = 59/467 (12%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGP- 432
           G I+ DEMGLGKT+Q IA + +L   G    +L    +IVCP++++  W  E   W  P 
Sbjct: 283 GGIIGDEMGLGKTIQIIAFLASLHHSG----KLDGPVLIVCPATVLRQWCKEFHTWWPPF 338

Query: 433 --------------------NTLSPLAVDGKKSSLASGATSVAEAIKNWAQ---AQGRNI 469
                                 L  L ++     L+  A   ++  K+  +   A+ + I
Sbjct: 339 RTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSKRTKSTLESGMARSKLI 398

Query: 470 VKPV-----LIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
            K V     LI +Y  LR +   L N      + DEGH+++N D+        +    R+
Sbjct: 399 NKVVSEGHILITTYVGLRIHADNLLNVRWSYAVLDEGHKIRNPDADISLTCKKLKTKNRI 458

Query: 525 ILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKL 584
           ILSGTPIQN+L+E ++L +F  PG LGT   F++ F IPI     A+AT+  V++G +  
Sbjct: 459 ILSGTPIQNNLTELWSLFDFIYPGRLGTLPVFQQQFSIPINVGGYANATNIQVQTGYKCA 518

Query: 585 QLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDG 644
             L N++S +++RR    ++K LP K E V+F  LT FQ++ Y   + S D+ K+   +G
Sbjct: 519 IALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLTQFQRRKYLQFLNSEDLTKI--KNG 576

Query: 645 GSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAIL 704
             Q L  I +L+K+CNHPDL++                Y  P         + SGK  ++
Sbjct: 577 KRQVLFGIDILRKICNHPDLLEKDKRENESS-------YGDP---------KRSGKMQVV 620

Query: 705 ERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNR-----HYASVRLDGTMSINKRQKLV 759
           ++ L ++      K +L +   Q LD++E+    +         +R+DGT +I  RQ LV
Sbjct: 621 KQLL-RLWHSQGHKTLLFTQSRQMLDILEKFISYKDPELEDLTYLRMDGTTNIGSRQALV 679

Query: 760 DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQA 806
           D FN+  G   +FLL+++ GG G+NL GANR+I+ DPDWNP+ D QA
Sbjct: 680 DSFNN--GLYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQA 724

>CAGL0C01683g 178695..182042 highly similar to sp|P38144
           Saccharomyces cerevisiae YBR245c ISW1 or tr|Q08773
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1115

 Score =  235 bits (600), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 250/480 (52%), Gaps = 52/480 (10%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKTLQ I+ +  L       K++    +++ P S +NNW  E+ KW     +
Sbjct: 197 ILADEMGLGKTLQTISFLGYL----RYIKKIPGPFLVIAPKSTLNNWLREINKWTP--EV 250

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           +   + G K   A         I++   A   ++V    I SY+ + R     +      
Sbjct: 251 NAFILQGDKEERAR-------LIQDKFMACDFDVV----IASYEIIIREKAAFRKMNWEY 299

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P +     +
Sbjct: 300 IMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPLQNNLHELWALLNFLLPDIFSDSQD 359

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT-NDILSKYLPCKYEHV 614
           F   F      S++ D  D      E+ ++ L  ++  F++RR  +D+ +  LP K E  
Sbjct: 360 FDEWF------SKETDEEDQ-----EKIVKQLHTVLQPFLLRRIKSDVETSLLPKK-ELN 407

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-----LKAIGVLKKLCNHPDLIKXXX 669
           ++V ++P QK+ Y  +++ +DI   V  D GS+      L  +  L+K CNHP L     
Sbjct: 408 VYVGMSPMQKKWYRQILE-KDID-AVNADSGSKESKTRLLNIVMQLRKCCNHPYLFDGAE 465

Query: 670 XXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTL 729
                           P   + +     S K  +L++ L K+K E+  ++++ S  ++ L
Sbjct: 466 PG--------------PPYTTDEHLVYNSEKLKVLDKLLRKLK-EAGSRVLIFSQMSRVL 510

Query: 730 DLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 789
           D++E  C  R Y   R+DG+ +   R + +D +N P+ ++F+FLL+++AGG GINL  A+
Sbjct: 511 DILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINLTTAD 570

Query: 790 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            ++L D DWNP AD QA+ R  R GQKK   ++RF++  ++EEKI +R + K+ L   V+
Sbjct: 571 VVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLRLDQLVI 630

>Kwal_34.15925
          Length = 1025

 Score =  228 bits (582), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 154/482 (31%), Positives = 243/482 (50%), Gaps = 56/482 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLR----QGPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKTLQ IA +  L       GP         I++ P S +NNW  E  KW  
Sbjct: 151 ILADEMGLGKTLQTIAFLGYLRYLKDIDGPH--------IVIVPKSTLNNWKREFSKW-- 200

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
              +  + + G K         +    K             VLI SY+ + +    L+  
Sbjct: 201 TPEVEAVVLSGDKEERQHLLKDIVLECKF-----------DVLITSYEMVIKEKSTLKRF 249

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
               ++ DE HR+KN  S     +   +   R++++GTP+QN+L E +ALLNF  P + G
Sbjct: 250 MWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNFLLPDVFG 309

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611
             + F R FE      +     D DV      +Q L  ++S F++RR    +   L  K 
Sbjct: 310 DSDAFDRWFE------QSDTEKDQDVV-----VQQLHTVLSPFLLRRLKSEVETSLLPKI 358

Query: 612 EHVIFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDLIKX 667
           E  ++V +T  Q Q Y  L++ +D+  V     K +G ++ L  +  L+K CNHP L + 
Sbjct: 359 ETNLYVGMTDMQVQWYKSLLE-KDLDAVNGAIGKREGNTRLLNIVMQLRKCCNHPYLFEG 417

Query: 668 XXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                        D++ I            +GK  +L++ L K K E+  ++++ S  ++
Sbjct: 418 AEPGPPYT----TDEHLIFN----------AGKMIVLDK-LLKKKKEAGSRVLIFSQMSR 462

Query: 728 TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
            LD++E  C  R Y   R+DG+ +  +R + +D+FN+P  ++FIFLL+++AGG GINL+ 
Sbjct: 463 LLDILEDYCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLGINLVT 522

Query: 788 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
           A+ +++ D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+ L   
Sbjct: 523 ADTVVIYDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQL 582

Query: 848 VV 849
           V+
Sbjct: 583 VI 584

>Scas_665.17
          Length = 1060

 Score =  228 bits (581), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 154/512 (30%), Positives = 252/512 (49%), Gaps = 51/512 (9%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKTLQ I+ +  L       K++    +IV P S ++NW  E  KW     +
Sbjct: 159 ILADEMGLGKTLQTISFLGYL----RYVKKIDGPFLIVVPKSTLDNWRREFNKWTPE--V 212

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           + + + G K         +    K             VLI SY+ + +    L+      
Sbjct: 213 NAIVLHGDKEERHKILYDIVLEAKF-----------DVLITSYEMVIKEKNVLKKFAWQY 261

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G    
Sbjct: 262 IVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSGI 321

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVI 615
           F   FE            +N  +  E  +Q L  +++ F++RR    + K L  K E  +
Sbjct: 322 FDEWFE-----------QNNSEQDQEIVVQQLHTVLNPFLLRRIKADVEKSLLPKIETNV 370

Query: 616 FVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDLIKXXXXX 671
           +V +T  Q + Y  L++ +DI  V     K +G ++ L  +  L+K CNHP L +     
Sbjct: 371 YVGMTEMQVKWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPG 429

Query: 672 XXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDL 731
                         P   + +     +GK  +L++ L ++K E   ++++ S  ++ LD+
Sbjct: 430 --------------PPYTTDEHLVFNAGKMIVLDKLLKRLK-EKGSRVLIFSQMSRLLDI 474

Query: 732 IERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRL 791
           +E  C  R Y   R+DG+ +   R + +D +N P   +F+FLL+++AGG GINL+ A+ +
Sbjct: 475 LEDYCFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINLVTADTV 534

Query: 792 ILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD- 850
           IL D DWNP AD QA+ R  R GQKK   +YRF++   IEEK+ +R + K+ L   V+  
Sbjct: 535 ILYDSDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLDQLVIQQ 594

Query: 851 --AKEDVERLFSVDNLRQLFQFNDKTICDTHE 880
              K+      + D+L ++ Q+  K + +  E
Sbjct: 595 GTGKKTASLGSNKDDLLEMIQYGAKNMFENKE 626

>Scas_652.17
          Length = 1025

 Score =  227 bits (578), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 154/490 (31%), Positives = 249/490 (50%), Gaps = 54/490 (11%)

Query: 367 SNNRGAYGCIMADEMGLGKTLQCIALMWTL-LRQGPQGKRLISKCIIVCPSSLVNNWANE 425
           S ++     I+ADEMGLGKTLQ IA +  L   +G  G  L+     + P S +NNW  E
Sbjct: 126 SLHKNGLAGILADEMGLGKTLQTIAFLGYLKYMEGINGPFLV-----IAPKSTLNNWLRE 180

Query: 426 LVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNV 485
           + KW  P+ +    + G K   AS        IK        +IV    + SY+ + R  
Sbjct: 181 INKW-TPD-VKAFVLQGDKQERAS-------LIKEKLMTCDFDIV----VASYEIIIREK 227

Query: 486 KQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 545
              +      ++ DE HR+KN +SL    L       R++++GTP+QN+L E +ALLNF 
Sbjct: 228 AAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFL 287

Query: 546 NPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT-NDILS 604
            P +  +  +F   F         ++ T+ D    ++ ++ L  ++  F++RR  ND+ +
Sbjct: 288 LPDIFSSSQDFDDWF--------SSETTEED---QDKVVKQLHTVLQPFLLRRIKNDVET 336

Query: 605 KYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-----LKAIGVLKKLC 659
             LP K E  ++V ++  QK+ Y  +++ +D+   V G+  S+      L  +  L+K C
Sbjct: 337 SLLPKK-ELNLYVGMSNMQKKWYKKILE-KDLD-AVNGENSSKESKTRLLNIVMQLRKCC 393

Query: 660 NHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKI 719
           NHP L                     P   + +     S K  +L++ L K+K E   ++
Sbjct: 394 NHPYLFDGAEPG--------------PPYTTDEHLVYNSKKLQVLDKLLKKMK-EDGSRV 438

Query: 720 VLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAG 779
           ++ S  ++ LD++E  C  R Y   R+DG+     R K +D +N P+  +FIFLL+++AG
Sbjct: 439 LIFSQMSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAG 498

Query: 780 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQS 839
           G GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF++  ++EEKI +R +
Sbjct: 499 GLGINLTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERAT 558

Query: 840 MKMSLSSCVV 849
            K+ L   V+
Sbjct: 559 QKLRLDQLVI 568

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
           Saccharomyces cerevisiae YOR304w ISW2, hypothetical
           start
          Length = 1062

 Score =  225 bits (573), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 152/479 (31%), Positives = 245/479 (51%), Gaps = 50/479 (10%)

Query: 376 IMADEMGLGKTLQCIALMWTLLR-QGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKTLQ I+ +  L   +G +G       I++ P S ++NW  E  KW     
Sbjct: 158 ILADEMGLGKTLQSISFLGYLRYIKGIEGP-----YIVIVPKSTLDNWQREFAKW----- 207

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVG 494
            +P      K+ +  G     + +    + +       VLI SY+ + +    L+     
Sbjct: 208 -TPEV----KTVILQGDKDFRKEL---IETKILTCNFDVLITSYEMVLKEKLTLKRFAWE 259

Query: 495 LLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            +L DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P + G   
Sbjct: 260 YILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSE 319

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
            F   F+      ++    D +V      +Q L +++  F++RR    + K L  K E  
Sbjct: 320 VFDEWFQ------QNGKEEDQEVV-----VQQLHSVLQPFLLRRVKSEVEKSLLPKKEIN 368

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDLIKXXXX 670
           ++V +T  Q + Y  L++ +DI  V     K +G ++ L  +  L+K CNHP L +    
Sbjct: 369 LYVGMTDMQIEWYKSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEP 427

Query: 671 XXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLD 730
                          P   + +     SGK  +L++ L K K E   ++++ S  ++ LD
Sbjct: 428 G--------------PPYTTDEHLVFNSGKMIVLDK-LLKKKKEQGSRVLIFSQMSRLLD 472

Query: 731 LIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANR 790
           ++E  C  R Y   R+DG+ S ++R + +D +N P  ++FIFLL+++AGG GINL+ A+ 
Sbjct: 473 ILEDYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGINLVTADT 532

Query: 791 LILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           ++L D DWNP AD QA+ R  R GQKK  F+YRF++   IEEK+ +R + K+ L   V+
Sbjct: 533 VVLYDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLRLDQLVI 591

>Scas_662.7
          Length = 1342

 Score =  225 bits (573), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 236/492 (47%), Gaps = 57/492 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+L+  L  +    K+     +++ P S + NW  E  KW      
Sbjct: 483 ILADEMGLGKTIQSISLITYLFEE----KKDPGPYLVIVPLSTITNWTLEFEKW------ 532

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPV-------LIISYDTLRRNVKQL 488
                          A S+   I      Q RN+   V       L+ +Y+ + ++   L
Sbjct: 533 ---------------APSLNTVIYKGTPNQRRNLQHQVRIGNFDVLLTTYEYIIKDRALL 577

Query: 489 QNTEVGLLLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNP 547
              E   ++ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P
Sbjct: 578 AKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNFVLP 637

Query: 548 GLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYL 607
            +  +   F   F  P   +   +  +   +     ++ L  ++  F++RR    + K L
Sbjct: 638 KIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDL 697

Query: 608 PCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKA--------IGVLKKLC 659
           P K E V+   L+  Q+Q+Y  ++K      +  G+G     K+        I  L+K+C
Sbjct: 698 PDKVEKVVKCKLSGLQQQLYEQMLKH---NALFLGEGTEGATKSGIKGLNNKIMQLRKIC 754

Query: 660 NHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKI 719
           NHP +                     PT  + ++  + SGKF +L R L K K  +  ++
Sbjct: 755 NHPFVFDEVEGVIN------------PTRANSNLLYRVSGKFELLNRVLPKFKA-AGHRV 801

Query: 720 VLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAG 779
           ++    TQ +D++E   R +    +RLDG+   + R  +++ FN P+   F FLLS++AG
Sbjct: 802 LMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAG 861

Query: 780 GCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQS 839
           G G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R  
Sbjct: 862 GLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAM 921

Query: 840 MKMSLSSCVVDA 851
            K+ +   V+ A
Sbjct: 922 QKLDIDGKVIQA 933

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  224 bits (571), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 244/486 (50%), Gaps = 46/486 (9%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +I+ P S + NW++E  KW  P  L
Sbjct: 824  ILADEMGLGKTIQTISLLTYLY----EMKNIKGPFLIIVPLSTLPNWSSEFAKW-APK-L 877

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
              ++  G  +             +   QAQ ++     +I +++ + +    L   +   
Sbjct: 878  RTISYKGSPNE------------RKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVH 925

Query: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            ++ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 926  MIIDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAK 985

Query: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
             F   F  P   +   D  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 986  SFDEWFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKV 1045

Query: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGV---------LKKLCNHPDLI 665
            I   ++  Q  +Y  ++K    K++  GD      K +G+         LKK+CNHP + 
Sbjct: 1046 IKCKMSALQHAMYQQMLKH---KQLFIGDQKKN--KLVGLRGFNNQLMQLKKICNHPFVF 1100

Query: 666  KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
            +              +D+  PT  +     + +GKF +LER L K+K  S  ++++    
Sbjct: 1101 EEV------------EDHINPTRDTNMNIWRVAGKFELLERILPKLKA-SRHRVLIFFQM 1147

Query: 726  TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
            TQ +D++E   R      +RLDG    ++R +L+  FNDP  + F F+LS++AGG G+NL
Sbjct: 1148 TQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNL 1207

Query: 786  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ + 
Sbjct: 1208 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDID 1267

Query: 846  SCVVDA 851
              V+ A
Sbjct: 1268 GKVIQA 1273

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  224 bits (570), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 250/486 (51%), Gaps = 46/486 (9%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S ++NW++E  KW  P TL
Sbjct: 789  ILADEMGLGKTIQTISLLTYLY----EMKNIRGPYLVIVPLSTLSNWSSEFAKW-AP-TL 842

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
              ++  G  +             +   QA+ R     V++ +++ + +    L   +   
Sbjct: 843  RTISFKGSPNE------------RKAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVH 890

Query: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            ++ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 891  MIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 950

Query: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
             F   F  P   +   D  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 951  SFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKV 1010

Query: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGV---------LKKLCNHPDLI 665
            +   ++  Q+ +Y  ++K R   ++  GD  ++  K +G+         LKK+CNHP + 
Sbjct: 1011 VKCKMSALQQIMYQQMLKYR---RLFIGDQNNK--KMVGLRGFNNQIMQLKKICNHPFVF 1065

Query: 666  KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
            +              +D   PT ++ D   + +GKF +L+R L K+K  +  ++++    
Sbjct: 1066 EEV------------EDQINPTRETNDDIWRVAGKFELLDRILPKLKA-TGHRVLIFFQM 1112

Query: 726  TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
            TQ +D++E   R  +   +RLDG    ++R +L+  FN P+ +   F+LS++AGG G+NL
Sbjct: 1113 TQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNL 1172

Query: 786  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ + 
Sbjct: 1173 QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDID 1232

Query: 846  SCVVDA 851
              V+ A
Sbjct: 1233 GKVIQA 1238

>Kwal_23.4777
          Length = 1301

 Score =  221 bits (563), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 150/482 (31%), Positives = 235/482 (48%), Gaps = 37/482 (7%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+L+ T LR+    K      +++ P S + NW  E  KW  P +L
Sbjct: 478 ILADEMGLGKTIQSISLI-TYLRET---KNEPGPFLVIVPLSTITNWTLEFEKW-AP-SL 531

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           + +   G  +   S             Q Q R     VL+ +Y+ + ++   L   +   
Sbjct: 532 ATIVYKGTPNQRKS------------MQHQIRIGNFEVLLTTYEYIIKDRSLLAKHDWSH 579

Query: 496 LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
           ++ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 580 MIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAK 639

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
            F   F  P   +   +  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 640 TFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 699

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-LKA----IGVLKKLCNHPDLIKXXX 669
           +   L+  Q Q+Y  ++K   +      +G ++  +K     I  L+K+CNHP +     
Sbjct: 700 VKCKLSGLQHQLYQQMLKHNALFFGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE 759

Query: 670 XXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTL 729
                     P  Y +            +GKF +L+R L K K  +  ++++    TQ +
Sbjct: 760 GIINPSRANSPLLYRV------------AGKFELLDRILLKFKV-TGHRVLMFFQMTQVM 806

Query: 730 DLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 789
           D++E   R R    +RLDG      R  ++  FN P  + F FLLS++AGG G+NL  A+
Sbjct: 807 DIMEDFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLGLNLQTAD 866

Query: 790 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V+
Sbjct: 867 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKLDIDGKVI 926

Query: 850 DA 851
            A
Sbjct: 927 QA 928

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  221 bits (564), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 161/528 (30%), Positives = 252/528 (47%), Gaps = 80/528 (15%)

Query: 369  NRGAYGCIMADEMGLGKTLQCIALMWT--LLRQGPQGKRLISKC-----IIVCPSSLVNN 421
            N+     I+ D+MGLGKTLQ I ++ +   LR     K    K      +I+CP SL  +
Sbjct: 1302 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKTRPLPSLIICPPSLTGH 1361

Query: 422  WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
            W  E  ++  P TL+ L        + +G  SV   +      QG+     +++ SYD  
Sbjct: 1362 WEQEFQQY-SP-TLNVL--------VYAGGPSVRYPL------QGQVPTADIVVTSYDVA 1405

Query: 482  RRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFAL 541
            R +V  L+  +    + DEGH +KN  S    A+  IN   R++L+GTPIQN++ E ++L
Sbjct: 1406 RNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPIQNNVVELWSL 1465

Query: 542  LNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTND 601
             +F  PG LGT   F+  F  PI  SR++  +  + ++G   L+ L   V  F++RR  +
Sbjct: 1466 FDFLMPGFLGTEKMFQERFAKPIASSRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKE 1525

Query: 602  ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIK------SRDIKKVVKGDGGSQPLKAIGVL 655
             +   LP K     +  L+  QKQ+YN  +K       +DI+   + +      +A+  +
Sbjct: 1526 EVLSDLPPKIIQDYYCELSDLQKQLYNDFVKKQKNVVEKDIENTAEVENKQHIFQALQYM 1585

Query: 656  KKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTE- 714
            +KLCNHP L+                + S P  + + VQ+  S     L    H  K E 
Sbjct: 1586 RKLCNHPSLVL---------------NSSHP--QFQQVQSYLSQTGMDLHDIGHAPKLEA 1628

Query: 715  -----------------------------SDDKIVLISNYTQTLDLIERMCRNRHYASV- 744
                                         S  ++++       LD++E     +H  SV 
Sbjct: 1629 LKTLLLECGIGIQDVEKKSNKNPSIDNVISQHRVLIFCQLKDMLDMVENDLLKKHLPSVT 1688

Query: 745  --RLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 802
              RLDG++    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  
Sbjct: 1689 FMRLDGSVDSRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMN 1747

Query: 803  DQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD 850
            D QA+ R  R GQKK   +YR I+ GT+EEKI   Q  KM+++S +V+
Sbjct: 1748 DLQAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTIVN 1795

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, start by similarity
          Length = 1344

 Score =  221 bits (562), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/485 (29%), Positives = 240/485 (49%), Gaps = 43/485 (8%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+L+  L     + K      +++ P S + NW  E  KW  P+  
Sbjct: 535 ILADEMGLGKTIQSISLISYLY----EIKNERQPFLVIVPLSTITNWTIEFEKW-APSL- 588

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
                   ++ +  G  +  +A+++  +    ++V    + +Y+ + ++   L   +   
Sbjct: 589 --------RTIVYKGNPNQRKALQHTIKMGNFDVV----LTTYEYIIKDRPLLAKHDWAH 636

Query: 496 LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
           ++ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 637 MIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 696

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
            F   F  P   +   +  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 697 TFDEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 756

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKA--------IGVLKKLCNHPDLIK 666
           +   L+  Q+Q+Y  ++K         G G     KA        +  L+K+CNHP +  
Sbjct: 757 VKCKLSSLQQQLYEQMLKH---NAFFIGAGTEGATKAGIKGLNNKVMQLRKICNHPFVFD 813

Query: 667 XXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYT 726
                         ++   PT ++  +  + SGKF +L+R L K K  S  ++++    T
Sbjct: 814 EV------------ENVINPTRENSSILYRVSGKFELLDRVLPKFKA-SGHRVLMFFQMT 860

Query: 727 QTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 786
           Q +D++E   R R    +RLDG      R  ++  FN P+ + F FLLS++AGG G+NL 
Sbjct: 861 QVMDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGLNLQ 920

Query: 787 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSS 846
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +  
Sbjct: 921 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDG 980

Query: 847 CVVDA 851
            V+ A
Sbjct: 981 KVIQA 985

>Kwal_14.1600
          Length = 1102

 Score =  219 bits (559), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 262/530 (49%), Gaps = 64/530 (12%)

Query: 367 SNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISK----CIIVCPSSLVNNW 422
           S +R     I+ADEMGLGKTLQ I+ +  L        R + K     +++ P S +NNW
Sbjct: 149 SLHRNNLAGILADEMGLGKTLQTISFLGYL--------RYVEKKPGPFVVIAPKSTLNNW 200

Query: 423 ANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLR 482
             E+ +W      +P   D +   L       A+ + N   A   +IV    + SY+ + 
Sbjct: 201 LREINRW------TP---DVRAFILQGDKEERAKLVANKLMACDFDIV----VASYEIII 247

Query: 483 RNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALL 542
           +     +      ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALL
Sbjct: 248 KEKASFKKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALL 307

Query: 543 NFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRR-TND 601
           NF  P +      F   F         ++++++D     + ++ L  ++  F++RR  N+
Sbjct: 308 NFLLPDVFSDSQAFDDWF--------SSESSEDD---KGKIVKQLHTVLQPFLLRRLKNE 356

Query: 602 ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP----LKAIGVLKK 657
           + +  LP K E  +++ ++  QK+ Y  +++ +DI  V   +G  +     L  +  L+K
Sbjct: 357 VETSLLPKK-ELNLYIGMSSMQKRWYKQILE-KDIDAVNGANGNKESKTRLLNVMMQLRK 414

Query: 658 LCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDD 717
            CNHP L                     P   + +     S K  +L++ L K K E   
Sbjct: 415 CCNHPYLFDGAEPG--------------PPYTTDEHLVYNSAKLKVLDKLLRKFKEEGS- 459

Query: 718 KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 777
           ++++ S  ++ LD++E  C  R Y   R+DG+ +   R + +D +N P+ ++F+FLL+++
Sbjct: 460 RVLIFSQMSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTR 519

Query: 778 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQR 837
           AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R
Sbjct: 520 AGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILER 579

Query: 838 QSMKMSLSSCVVDA------KEDVERLFSVDNLRQLFQFNDKTICDTHET 881
            + K+ L   V+        +++V++  S D L  + Q     +  T+ T
Sbjct: 580 ATQKLRLDQLVIQQSRNGVNQKEVKKGDSKDALLSMIQHGAADVFSTNST 629

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
           (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  220 bits (560), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 147/482 (30%), Positives = 239/482 (49%), Gaps = 37/482 (7%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+L+  L     + K+     +++ P S + NW  E  KW  P +L
Sbjct: 479 ILADEMGLGKTIQSISLITYLY----EVKKDSGPFLVIVPLSTITNWTLEFEKW-AP-SL 532

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           + +   G  +   S             Q Q R     VL+ +Y+ + ++   L   E   
Sbjct: 533 TTVIYKGTPNQRRS------------LQHQVRIGDFDVLLTTYEYIIKDRSLLAKHEWSH 580

Query: 496 LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
           ++ DEGHR+KN  S L++T         R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 581 MIIDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNFVLPKIFNSSK 640

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
            F   F  P   +   +  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 641 TFDEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKV 700

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-LKA----IGVLKKLCNHPDLIKXXX 669
           +   L+  Q Q+Y  ++K   +      +G ++  +K     I  L+K+CNHP +     
Sbjct: 701 VKCKLSGLQHQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVE 760

Query: 670 XXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTL 729
                           PT  +  +  + SGKF +L+R L K K  +  ++++    TQ +
Sbjct: 761 GVVN------------PTRTNSSLLYRVSGKFELLDRVLPKFKA-TGHRVLMFFQMTQVM 807

Query: 730 DLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGAN 789
           D++E   + ++   +RLDG     +R  +++ FN P+   F FLLS++AGG G+NL  A+
Sbjct: 808 DIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTAD 867

Query: 790 RLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +   V+
Sbjct: 868 TVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVI 927

Query: 850 DA 851
            A
Sbjct: 928 QA 929

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  220 bits (560), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 160/518 (30%), Positives = 248/518 (47%), Gaps = 59/518 (11%)

Query: 369  NRGAYGCIMADEMGLGKTLQCIALMWT--LLRQGPQGKRLISKC-----IIVCPSSLVNN 421
            N+     I+ D+MGLGKTLQ I ++ +   LRQ         +C     +IVCP SL  +
Sbjct: 1328 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLIVCPPSLTGH 1387

Query: 422  WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
            W NE  ++      SP      K  + +G  SV + ++    +        ++I SYD  
Sbjct: 1388 WENEFEQY------SPFL----KIVVYAGGPSVRQPLRKQLSSAD------IIITSYDVA 1431

Query: 482  RRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFAL 541
            R ++  + + +    + DEGH +KN  S    A+  I    R+IL+GTPIQN++ E ++L
Sbjct: 1432 RNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNNVVELWSL 1491

Query: 542  LNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTND 601
             +F  PG LGT   F+  F  PI  SR++  +  + ++G   L+ L   V  F++RR  +
Sbjct: 1492 FDFLMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKE 1551

Query: 602  ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIK------SRDIKKVVKGDGGSQPLKAIGVL 655
             +   LP K     +  L+  QKQ+Y    K       +DI+     D      +A+  +
Sbjct: 1552 DVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQHIFQALQYM 1611

Query: 656  KKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTG-KSRDVQTQFSGKFAILERFLH----- 709
            +KLCNHP L+                +Y   TG    D++   + K   L   L      
Sbjct: 1612 RKLCNHPALVLSNDHPQLKQI----QNYLKQTGCDLHDIRN--APKLTALRTLLFECGIG 1665

Query: 710  ------KIKTE--------SDDKIVLISNYTQTLDLIERMCRNRHYASV---RLDGTMSI 752
                  K+  E        S  + ++       LD+IE     R+  SV   RLDG++  
Sbjct: 1666 EADMDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLDGSVDP 1725

Query: 753  NKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 812
              RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R
Sbjct: 1726 RDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHR 1784

Query: 813  DGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD 850
             GQKK   +YR ++ GT+EEKI   Q  KM+++S VV+
Sbjct: 1785 LGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVN 1822

>Scas_594.7
          Length = 1703

 Score =  219 bits (557), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 151/490 (30%), Positives = 238/490 (48%), Gaps = 54/490 (11%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S ++NW+NE  KW  P   
Sbjct: 835  ILADEMGLGKTIQTISLLTYLY----ETKHIHGPYLVIVPLSTLSNWSNEFAKW-APTMR 889

Query: 436  ------SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQ 489
                  SP     K + + SG   V      +             II    L   VK + 
Sbjct: 890  CISYKGSPNERKSKHAIIKSGEFDVVLTTFEY-------------IIKERALLSKVKWIH 936

Query: 490  NTEVGLLLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548
                  ++ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF+ P 
Sbjct: 937  ------MIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFALPK 990

Query: 549  LLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLP 608
            +  +   F   F  P   +   D  +   +     ++ L  ++  F++RR    + K LP
Sbjct: 991  IFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELP 1050

Query: 609  CKYEHVIFVNLTPFQKQVYNMLIKSRDI-------KKVVKGDGGSQPLKAIGVLKKLCNH 661
             K E VI   ++  Q+ +Y  ++K R +       KK+V   G +  L     LKK+CNH
Sbjct: 1051 DKVEKVIKCKMSALQQIMYQQMLKYRRLFIGDHTNKKMVGLRGFNNQLMQ---LKKICNH 1107

Query: 662  PDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVL 721
            P + +              +D   PT ++     + +GKF +LE+ L K+K  +  ++++
Sbjct: 1108 PFVFEEV------------EDQINPTRETNANIWRVAGKFELLEKVLPKLKA-TGHRVLI 1154

Query: 722  ISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGC 781
                TQ +D++E   R      +RLDG    + R  L+  FN P+ +   F+LS++AGG 
Sbjct: 1155 FFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYLCFILSTRAGGL 1214

Query: 782  GINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMK 841
            G+NL  A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I +R   K
Sbjct: 1215 GLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSVEEAILERAHKK 1274

Query: 842  MSLSSCVVDA 851
            + +   V+ A
Sbjct: 1275 LDIDGKVIQA 1284

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
           chromatin remodeling complex (RSC), involved in the
           response to DNA damage, DNA helicase of the Snf2p
           family, has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  218 bits (555), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 152/485 (31%), Positives = 240/485 (49%), Gaps = 43/485 (8%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWL-GPNT 434
           I+ADEMGLGKT+Q I+L+  L     + K+ I   +++ P S + NW  E  KW    NT
Sbjct: 492 ILADEMGLGKTIQSISLITYLY----EVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNT 547

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVG 494
           +       ++ SL               Q Q R     VL+ +Y+ + ++   L   +  
Sbjct: 548 IIYKGTPNQRHSL---------------QHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWA 592

Query: 495 LLLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553
            ++ DEGHR+KN  S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  + 
Sbjct: 593 HMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSA 652

Query: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEH 613
             F   F  P   +   +  +   +     ++ L  ++  F++RR    + K LP K E 
Sbjct: 653 KTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEK 712

Query: 614 VIFVNLTPFQKQV------YNMLIKSRDIKKVVKGDGGSQPLK-AIGVLKKLCNHPDLIK 666
           VI   L+  Q+Q+      +N L      +   KG  G + L   I  L+K+CNHP +  
Sbjct: 713 VIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKG--GIKGLNNKIMQLRKICNHPFVFD 770

Query: 667 XXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYT 726
                              P+  + D+  + +GKF +L+R L K K  S  ++++    T
Sbjct: 771 EVEGVVN------------PSRGNSDLLFRVAGKFELLDRVLPKFKA-SGHRVLMFFQMT 817

Query: 727 QTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 786
           Q +D++E   R +    +RLDG+    +R ++++ FN P+   F FLLS++AGG G+NL 
Sbjct: 818 QVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQ 877

Query: 787 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSS 846
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ +  
Sbjct: 878 TADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDG 937

Query: 847 CVVDA 851
            V+ A
Sbjct: 938 KVIQA 942

>Scas_597.8
          Length = 1065

 Score =  217 bits (552), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 146/492 (29%), Positives = 245/492 (49%), Gaps = 58/492 (11%)

Query: 367 SNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC----IIVCPSSLVNNW 422
           S ++     I+ADEMGLGKTLQ I+ +  L        R + K     +++ P S +NNW
Sbjct: 145 SLHKSKLAGILADEMGLGKTLQTISFLGYL--------RYVEKIPGPFLVIAPKSTLNNW 196

Query: 423 ANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLR 482
             E+ KW     ++   + G K          A+ +K+   A   +IV    + SY+ + 
Sbjct: 197 LREINKWTPE--VNAFILQGDKEE-------RAQLVKDKLLACDFDIV----VASYEIII 243

Query: 483 RNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALL 542
           R     +  +   ++ DE HR+KN +SL    L       R++++GTP+QN+L E +ALL
Sbjct: 244 REKSAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQNNLHELWALL 303

Query: 543 NFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRR-TND 601
           NF  P +     +F   F         ++ T+ D    E+ ++ L  ++  F++RR  ND
Sbjct: 304 NFLLPDIFSDSQDFDDWF--------SSETTEED---QEKVVKQLHTVLQPFLLRRLKND 352

Query: 602 ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKK 657
           + +  LP K E  ++V ++  QK+ Y  +++ +DI  V    V  +  ++ L  +  L+K
Sbjct: 353 VETSLLP-KQELNLYVGMSNMQKKWYKQILE-KDIDAVNGSNVNKESKTRLLNIVMQLRK 410

Query: 658 LCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDD 717
            CNHP L                D        + D    ++     +   L K   E   
Sbjct: 411 CCNHPYLF---------------DGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKMKEEGS 455

Query: 718 KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 777
           ++++ S  ++ LD++E  C  R Y   R+DG+     R + +D +N+P  ++FIFLL+++
Sbjct: 456 RVLIFSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTR 515

Query: 778 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQR 837
           AGG GINL  AN ++L D DWNP AD QA+ R  R GQK+   ++R ++  ++EEKI +R
Sbjct: 516 AGGLGINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILER 575

Query: 838 QSMKMSLSSCVV 849
            + K+ L   V+
Sbjct: 576 ATQKLRLDQLVI 587

>Kwal_56.23442
          Length = 1435

 Score =  217 bits (553), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 241/485 (49%), Gaps = 49/485 (10%)

Query: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 379 ILADEMGLGKTVQTVAFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFEKW-APDL 432

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRNVKQLQNTEV 493
                V  +KS     A    E   N  QA+ +   K  VL+ +Y+ + ++  +L   + 
Sbjct: 433 NCIYFVGNQKSR---DAIREGEFFTN-PQAKTKKHAKFNVLLTTYEYILKDRAELGAIKW 488

Query: 494 GLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553
             L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG     
Sbjct: 489 QFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFTID 548

Query: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEH 613
            E   +FE     ++DA+         E  ++ L + +  FI+RR    + K LP K E 
Sbjct: 549 QEI--DFE-----NQDAEQ--------ETYIRDLHSRLQPFILRRLKKDVEKSLPSKTER 593

Query: 614 VIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQ--PLKAIGVLKKLCNHPDLIKXXXXX 671
           ++ V L+  Q   Y  ++ +++   +  G  G+    L  +  LKK  NHP L       
Sbjct: 594 ILRVELSDVQTDYYKNIL-TKNYSALSAGSKGAHFSLLNIMNELKKASNHPYLFDMAE-- 650

Query: 672 XXXXXXXIPDDYSIPTGKSRDVQTQF-------SGKFAILERFLHKIKTESDDKIVLISN 724
                    D      G  R  +          SGK  +L++ L ++K +   ++++ S 
Sbjct: 651 ---------DRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTRLKKDGH-RVLIFSQ 700

Query: 725 YTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGIN 784
             + LD++      +     RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GIN
Sbjct: 701 MVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGLGIN 760

Query: 785 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSL 844
           L+ A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L
Sbjct: 761 LMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMIL 820

Query: 845 SSCVV 849
              ++
Sbjct: 821 EYAII 825

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  218 bits (554), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 164/549 (29%), Positives = 257/549 (46%), Gaps = 60/549 (10%)

Query: 369  NRGAYGCIMADEMGLGKTLQCIALMWT---LLRQGPQGKRLISK----CIIVCPSSLVNN 421
            N+     I+ D+MGLGKTLQ I ++ +   L ++  +  R +       +I+CP SL  +
Sbjct: 1287 NKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVESRALPSLIICPPSLTGH 1346

Query: 422  WANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL 481
            W NE  ++      +P      K  + +G  +V   ++   Q    +I+    + SYD  
Sbjct: 1347 WENEFDQY------APFL----KVVVYAGGPTVRLTLR--PQLSDADII----VTSYDVA 1390

Query: 482  RRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFAL 541
            R ++  L  TE    + DEGH +KN  S    A+  I    R+IL+GTPIQN++ E ++L
Sbjct: 1391 RNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNNVLELWSL 1450

Query: 542  LNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTND 601
             +F  PG LGT   F+  F  PI  SR++  +  + ++G   L+ L   V  F++RR  +
Sbjct: 1451 FDFLMPGFLGTEKMFQERFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRLKE 1510

Query: 602  ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIK------SRDIKKVVKGDGGSQPLKAIGVL 655
             +   LP K     +  L   QKQ+Y    K       +DI+     DG     +A+  +
Sbjct: 1511 DVLSDLPPKIIQDYYCELGDLQKQLYMDFTKKQKNVVEKDIENSEIADGKQHIFQALQYM 1570

Query: 656  KKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSG-KFAILERFLHKIKTE 714
            +KLCNHP L+                DY   TG   D+    +  K + L   L +    
Sbjct: 1571 RKLCNHPALVLSPNHPQLAQV----QDYLKQTG--LDLHDIINAPKLSALRTLLFECGIG 1624

Query: 715  SDD--------------------KIVLISNYTQTLDLIERMCRNRHYASV---RLDGTMS 751
             +D                    + ++       LD++E     ++  SV   RLDG++ 
Sbjct: 1625 EEDIDKKASQDQNFPIQNVISQHRALIFCQLKDMLDMVENDLFKKYMPSVTYMRLDGSID 1684

Query: 752  INKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 811
               RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  
Sbjct: 1685 PRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAH 1743

Query: 812  RDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQFN 871
            R GQKK   +YR I+ GT+EEKI   Q  KM+++S VV+ +           L  LF  +
Sbjct: 1744 RIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDPD 1803

Query: 872  DKTICDTHE 880
            + T  D  E
Sbjct: 1804 NVTSQDNEE 1812

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
           Saccharomyces cerevisiae YER164w CHD1 transcriptional
           regulator, start by similarity
          Length = 1476

 Score =  216 bits (550), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 236/482 (48%), Gaps = 43/482 (8%)

Query: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKT+Q +A + W +  +   G  L+     V P S +  W     KW  P+ 
Sbjct: 413 ILADEMGLGKTVQTVAFISWLIFARRQNGPHLV-----VVPLSTMPAWIETFEKW-APDI 466

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGR---NIVKPVLIISYDTLRRNVKQLQNT 491
                +  +KS        +    + ++  +G+    I   VL+ +Y+ + ++  +L + 
Sbjct: 467 DVICYMGNQKSR------DIEREYEFYSNPKGKGKKQIKFNVLMTTYEYILKDRAELGSI 520

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
           +   L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG   
Sbjct: 521 KWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPGRFT 580

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611
              E   +FE             N  +  EQ ++ L   +  FI+RR    + K LP K 
Sbjct: 581 IDQEI--DFE-------------NQDEEQEQYIRDLHKRLQPFILRRLKKDVEKSLPSKT 625

Query: 612 EHVIFVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKXXXX 670
           E ++ V L+  Q + Y N+L K+          G    L  +  L K  NHP L      
Sbjct: 626 ERILRVELSDVQTEYYKNILTKNYSALTAGAKGGRFSMLNIMNTLMKASNHPYLF----- 680

Query: 671 XXXXXXXXIPDDYSIPTGKSRDVQTQF---SGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                   + + +        ++       SGK  +L++ L ++K +   ++++ S   +
Sbjct: 681 --DSAEEKVLEKFGAGNMSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVR 737

Query: 728 TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
            LD++      +     RLDGT+  N+R+  +D FN P   +F+FLLS++AGG GINL+ 
Sbjct: 738 ILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDFVFLLSTRAGGLGINLMT 797

Query: 788 ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
           A+ +I+ D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   
Sbjct: 798 ADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYA 857

Query: 848 VV 849
           ++
Sbjct: 858 II 859

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
           ATP-dependent nucleosome remodeling activity, member of
           the Chromodomain-Helicase-DNA-binding (CHD) family [4407
           bp, 1468 aa]
          Length = 1468

 Score =  216 bits (550), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 148/477 (31%), Positives = 238/477 (49%), Gaps = 33/477 (6%)

Query: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKT+Q +A + W +  +   G       IIV P S +  W +   KW  P+ 
Sbjct: 398 ILADEMGLGKTVQTVAFISWLIFARRQNGPH-----IIVVPLSTMPAWLDTFEKW-APD- 450

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRNVKQLQNTEV 493
           L+ +   G + S         E   N  +A+G+  +K  VL+ +Y+ + ++  +L + + 
Sbjct: 451 LNCICYMGNQKS--RDTIREYEFYTN-PRAKGKKTMKFNVLLTTYEYILKDRAELGSIKW 507

Query: 494 GLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553
             +  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG     
Sbjct: 508 QFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTID 567

Query: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEH 613
            E   +FE             N  +  E+ +  L   +  FI+RR    + K LP K E 
Sbjct: 568 QEI--DFE-------------NQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTER 612

Query: 614 VIFVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKXXXXXX 672
           ++ V L+  Q + Y N+L K+          G    L  +  LKK  NHP L        
Sbjct: 613 ILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF---DNAE 669

Query: 673 XXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLI 732
                   D         R +    SGK  +L++ L ++K +   ++++ S   + LD++
Sbjct: 670 ERVLQKFGDGKMTRENVLRGL-IMSSGKMVLLDQLLTRLKKDGH-RVLIFSQMVRMLDIL 727

Query: 733 ERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLI 792
                 +     RLDGT+   +R+  +D FN P+  +F+FLLS++AGG GINL+ A+ ++
Sbjct: 728 GDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVV 787

Query: 793 LMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           + D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 788 IFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 844

>Kwal_26.9164
          Length = 1454

 Score =  216 bits (549), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 241/486 (49%), Gaps = 46/486 (9%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW +E  KW  P  +
Sbjct: 624  ILADEMGLGKTIQTISLLTYLY----EVKNVRGPSLVIVPLSTLTNWDSEFDKW-AP-VI 677

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
              +A  G  +   S             Q   R+    V++ +++ + +    L   +   
Sbjct: 678  RKVAYKGSPNERKS------------KQGIIRSGQFDVVLTTFEYIIKERALLSKIKWVH 725

Query: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            ++ DEGHR+KN  S L+ T  +  +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 726  MIIDEGHRMKNAQSKLSLTLNNYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 785

Query: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
             F   F  P   +   D      +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 786  SFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKV 845

Query: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGV---------LKKLCNHPDLI 665
            +   ++  Q+++Y  ++K R   ++  GD  S   K +G+         LKK+CNHP + 
Sbjct: 846  LKCKMSALQQKLYEQMLKHR---RLFIGDLNSN--KNVGMRGFNNQIMQLKKICNHPFVF 900

Query: 666  KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
            +              +D   PT ++     + +GKF +LER L K K  +  +I++    
Sbjct: 901  EEV------------EDQINPTRETNANIWRVAGKFELLERILPKFKA-TGHRILIFFQM 947

Query: 726  TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
            TQ +D++E   R  +   +RLDG    + R  L++ FN P  + F FLLS++AGG G+NL
Sbjct: 948  TQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYFCFLLSTRAGGLGLNL 1007

Query: 786  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  R   K+ + 
Sbjct: 1008 QSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSVEEVILDRAHKKLDID 1067

Query: 846  SCVVDA 851
              V+ A
Sbjct: 1068 GKVIQA 1073

>Scas_576.6
          Length = 1457

 Score =  216 bits (549), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 148/475 (31%), Positives = 234/475 (49%), Gaps = 29/475 (6%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q +A +  L+      +R     I+V P S +  W     KW  P+ L
Sbjct: 404 ILADEMGLGKTVQTVAFISWLI----YARRQNGPHIVVVPLSTMPAWQETFDKW-APD-L 457

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           + +   G + S    A    E   N      +NI   VL+ +Y+ + ++  +L + +   
Sbjct: 458 NVICYMGNQRS--RDAIREFEFYTNPYAKGKKNIKFNVLLTTYEYILKDRSELGSIKWQF 515

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG      E
Sbjct: 516 LAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNIKELAALINFLMPGRFTIDQE 575

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVI 615
              +FE             N  +  E+ ++ L   +  FI+RR    + K LP K E ++
Sbjct: 576 I--DFE-------------NQDEEQEEYIRDLHKRLQPFILRRLKKDVEKSLPSKTERIL 620

Query: 616 FVNLTPFQKQVY-NMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXX 674
            V L+  Q + Y N+L K+          G    L  +  LKK  NHP L          
Sbjct: 621 RVELSDVQTEYYKNILTKNYSALTAGSKGGHFSLLNIMSELKKASNHPYLFDNAEERVLK 680

Query: 675 XXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIER 734
                  D  +            SGK  +L++ L+K+K +   ++++ S   + LD++  
Sbjct: 681 KFG----DGQMSRENVLRGLIMSSGKMVLLDQLLNKLKKDGH-RVLIFSQMVRMLDILGD 735

Query: 735 MCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILM 794
               +     RLDGT+   +R+  +D FN P+  + +FLLS++AGG GINL+ A+ +I+ 
Sbjct: 736 YLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGINLMTADTVIIF 795

Query: 795 DPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           D DWNP AD QA+AR  R GQK    +YR +S  T+EE++ +R   KM L   ++
Sbjct: 796 DSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAII 850

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
           cerevisiae YER164w CHD1 transcriptional regulator, start
           by similarity
          Length = 1525

 Score =  214 bits (546), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 240/483 (49%), Gaps = 45/483 (9%)

Query: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW     
Sbjct: 410 ILADEMGLGKTVQTVSFISWLIYARRQNGPHLV-----VVPLSTMPAWQETFDKW----- 459

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWA-----QAQGRNIVK-PVLIISYDTLRRNVKQL 488
                  G       G  +  + I+++      QA+G+  +K  VL+ +Y+ + ++   L
Sbjct: 460 -----APGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTYEYILKDRSTL 514

Query: 489 QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548
            + +   L  DE HRLKN +S  + +L+S     R++++GTP+QN++ E  AL+NF  PG
Sbjct: 515 GSIKWQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNIKELAALVNFLMPG 574

Query: 549 LLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLP 608
                 E   +FE             N  +  E+ ++ L   +  FI+RR    + K LP
Sbjct: 575 RFTIDQEI--DFE-------------NQDEQQEEYIRDLHKRLQPFILRRLKKDVEKSLP 619

Query: 609 CKYEHVIFVNLTPFQKQVY-NMLIKSRD-IKKVVKGDGGSQPLKAIGVLKKLCNHPDLIK 666
            K E ++ V L+  Q + Y N+L K+   +   +KG G    L  +  LKK  NHP L  
Sbjct: 620 SKTERILRVELSDVQTEYYKNILTKNYSALTSGIKG-GHVSLLNVMNELKKASNHPYLF- 677

Query: 667 XXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYT 726
                         D +       R +    SGK  +L++ L ++K +   ++++ S   
Sbjct: 678 --DNAEERVLSKFGDGHKSRENILRGL-IMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMV 733

Query: 727 QTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI 786
           + LD++      +     RLDGT+   +R+  +D FN  +  +F+FLLS++AGG GINL+
Sbjct: 734 RILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGINLM 793

Query: 787 GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSS 846
            A+ +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L  
Sbjct: 794 TADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEY 853

Query: 847 CVV 849
            ++
Sbjct: 854 AII 856

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  214 bits (545), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 242/486 (49%), Gaps = 45/486 (9%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P TL
Sbjct: 583  ILADEMGLGKTIQTISLLTYLY----EFKGIHGPFLVIVPLSTLTNWNAEFDKW-AP-TL 636

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
              LA  G  S          +A+    ++   ++V    + +++ + +    L   +   
Sbjct: 637  RKLAFKGPPSE--------RKALSGIIKSGNFDVV----LTTFEYIIKERPLLSKVKWVH 684

Query: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            ++ DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 685  MIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 744

Query: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
             F   F  P   +   D  +   +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 745  SFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKV 804

Query: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGV---------LKKLCNHPDLI 665
            +   ++  Q+++Y  ++K R +   V  D  S+  K +G+         LKK+CNHP + 
Sbjct: 805  LKCRMSALQQKLYEQMLKHRRL--FVVDDPSSK--KMVGLRGFNNQIMQLKKICNHPFVF 860

Query: 666  KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
            +              +D   P  ++     + +GKF +LE+ L K K  S  ++++    
Sbjct: 861  EEV------------EDQINPNRETNANIWRVAGKFELLEKILPKFKA-SGHRVLIFFQM 907

Query: 726  TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
            TQ +D++E   R      +RLDG    + R  L+++FN P    F FLLS++AGG G+NL
Sbjct: 908  TQIMDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGLGLNL 967

Query: 786  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
              A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I +R   K+ + 
Sbjct: 968  QTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRKLDID 1027

Query: 846  SCVVDA 851
              V+ A
Sbjct: 1028 GKVIQA 1033

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score =  213 bits (541), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 240/486 (49%), Gaps = 45/486 (9%)

Query: 376 IMADEMGLGKTLQCIALMWTL--LRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
           I+ADEMGLGKT+Q I+L+  L  ++Q P         +++ P S + NW  E  KW  P 
Sbjct: 475 ILADEMGLGKTIQSISLITYLYEVKQEP------GPYLVIVPLSTITNWTLEFEKW-AP- 526

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEV 493
           +L+ +   G  +             ++  Q + R+    VL+ +Y+ + ++   L   E 
Sbjct: 527 SLTTIIYKGTPNQ------------RHALQHKIRSGNFDVLLTTYEYIIKDKALLSKHEW 574

Query: 494 GLLLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 552
             ++ DEGHR+KN +S L+FT         R+IL+GTP+QN+L E +ALLNF  P +  +
Sbjct: 575 SHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNS 634

Query: 553 RNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYE 612
              F   F  P   +   +  +   +     ++ L  ++  F++RR    + K LP K E
Sbjct: 635 AKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVEKDLPDKVE 694

Query: 613 HVIFVNLTPFQKQV------YNMLIKSRDIKKVVKGDGGSQPLK-AIGVLKKLCNHPDLI 665
            V+   L+  Q+Q+      +N L      +   KG  G + L   I  L+K+CNHP + 
Sbjct: 695 KVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKG--GIKGLNNKIMQLRKICNHPFVF 752

Query: 666 KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
                               P+  + D+  + +GKF +L+R L K K  +  ++++    
Sbjct: 753 DEVEAVVN------------PSRGNSDLLYRVAGKFELLDRILPKFKA-TGHRVLIFFQM 799

Query: 726 TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
           TQ +D++E   R R    +RLDG+     R  ++  FN    + F FLLS++AGG G+NL
Sbjct: 800 TQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAGGLGLNL 859

Query: 786 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
             A+ +I+ D DWNP  D QA  R  R GQK +  I R I+T ++EE I +R   K+ + 
Sbjct: 860 QSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 919

Query: 846 SCVVDA 851
             V+ A
Sbjct: 920 GKVIQA 925

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
           complement(1400495..1400512,1400676..1403735) [3078 bp,
           1025 aa]
          Length = 1025

 Score =  211 bits (537), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 150/485 (30%), Positives = 240/485 (49%), Gaps = 62/485 (12%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC----IIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKTLQ I+ +  L        R I       I+V P S ++NW  E  KW  
Sbjct: 150 ILADEMGLGKTLQTISFLGYL--------RFIKDIDGPFIVVVPKSTLDNWKREFAKWTP 201

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK---PVLIISYDTLRRNVKQL 488
              ++ + + G + +     T + E            I+     VLI SY+ + +    L
Sbjct: 202 E--VNTIVLHGDRET----RTQLIE----------ERILTCDFDVLITSYEMVIKEKAIL 245

Query: 489 QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548
           +      ++ DE HR+KN  S     +       R++++GTP+QN+L E +ALLNF  P 
Sbjct: 246 KKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNFLLPD 305

Query: 549 LLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLP 608
           + G    F   F+      ++  A D ++      +Q L  ++  F++RR    + K L 
Sbjct: 306 VFGESEVFDEWFQ------QNEKAQDQEIV-----VQQLHAVLQPFLLRRVKADVEKSLL 354

Query: 609 CKYEHVIFVNLTPFQKQVYNMLIKSRDIKKV----VKGDGGSQPLKAIGVLKKLCNHPDL 664
            K E  ++V +T  Q Q Y  L++ +DI  V     K +G ++ L  +  L+K CNHP L
Sbjct: 355 PKIETNVYVGMTAMQLQWYRSLLE-KDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYL 413

Query: 665 IKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISN 724
            +                   P   + +     SGK  +L++ L + K E   ++++ S 
Sbjct: 414 FEGAEPG--------------PPYTTDEHLIYNSGKMIVLDKLLKRKKKEGS-RVLIFSQ 458

Query: 725 YTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGIN 784
            ++ LD++E  C  R +   R+DG  S  +R   +D FN  + ++FIFLL+++AGG GIN
Sbjct: 459 MSRLLDILEDYCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGIN 518

Query: 785 LIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSL 844
           L+ A+ ++L D DWNP AD QA+ R  R GQKK   +YR ++   IEEK+ +R + K+ L
Sbjct: 519 LVTADTVVLYDSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRL 578

Query: 845 SSCVV 849
              V+
Sbjct: 579 DQLVI 583

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  212 bits (540), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 145/484 (29%), Positives = 233/484 (48%), Gaps = 41/484 (8%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+L+  L     + K +    +++ P S + NW  E  KW  P  L
Sbjct: 706  ILADEMGLGKTIQTISLLTYLY----EAKGVHGPFLVIVPLSTLTNWNAEFDKW-APK-L 759

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
              +A  G                +   QA  +N    V++ +++ + +    L   +   
Sbjct: 760  RKIAFKGPPME------------RKPKQALIKNREFDVVLTTFEYIIKERPLLSKIKWVH 807

Query: 496  LLADEGHRLKNGDS-LTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
             + DEGHR+KN  S L+ T     +   R+IL+GTP+QN+L E +ALLNF  P +  +  
Sbjct: 808  TIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSVK 867

Query: 555  EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
             F   F  P   +   D      +     ++ L  ++  F++RR    + K LP K E V
Sbjct: 868  SFDEWFNTPFANTGGQDKIALSEEETLLVIRRLHKVLRPFLLRRLKKDVEKDLPDKVEKV 927

Query: 615  IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKA-------IGVLKKLCNHPDLIKX 667
            +   ++  Q ++Y  ++K R +   +  D  +Q   +       I  L+K+CNHP + + 
Sbjct: 928  LKCKMSALQHKLYQQMLKHRRL--FIFDDSSNQKFSSSRGFNNQIMQLRKICNHPFVFEE 985

Query: 668  XXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                         +D   P  ++ D   + +GKF +LER L K K  +  ++++    TQ
Sbjct: 986  V------------EDQINPARETNDTIWRSAGKFELLERILPKFKA-TGHRVLIFFQMTQ 1032

Query: 728  TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
             +D++E   R      +RLDG    + R  L++ FN P    F FLLS++AGG G+NL  
Sbjct: 1033 VMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLSTRAGGLGLNLQT 1092

Query: 788  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
            A+ +I+ D DWNP  D QA  R  R GQK +  I R I+  ++EE I  +   K+ +   
Sbjct: 1093 ADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILDKAHAKLDIDGK 1152

Query: 848  VVDA 851
            V+ A
Sbjct: 1153 VIQA 1156

>Scas_664.9
          Length = 1859

 Score =  213 bits (541), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 162/543 (29%), Positives = 254/543 (46%), Gaps = 64/543 (11%)

Query: 369  NRGAYGCIMADEMGLGKTLQCIALMWT--LLR-------QGPQGKRLISKCIIVCPSSLV 419
            N+     I+ D+MGLGKTLQ I ++ +   LR          + ++L S  +IVCP SL 
Sbjct: 1282 NKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVETRKLPS--LIVCPPSLT 1339

Query: 420  NNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYD 479
             +W NE  ++      +P      K  + +G  S+   +++   +        ++I SYD
Sbjct: 1340 GHWENEFEQY------APFL----KIIVYAGGPSMRIPLRDELGSAD------IVITSYD 1383

Query: 480  TLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 539
              R ++  +   +    + DEGH +KN  S    A+  I+   R+IL+GTPIQN++ E +
Sbjct: 1384 VARNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNNVVELW 1443

Query: 540  ALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT 599
            +L +F  PG LGT   F+  F  PI  SR++  +  + ++G   L+ L   V  F++RR 
Sbjct: 1444 SLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHKQVLPFMLRRL 1503

Query: 600  NDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIK------SRDIKKVVKGDGGSQPLKAIG 653
             + +   LP K     +  L+  QKQ+Y    K       +DI+     D      +A+ 
Sbjct: 1504 KEDVLSDLPPKIIQDYYCELSDLQKQLYQDFAKKQKNVVEKDIENTTDTDNSQHIFQALQ 1563

Query: 654  VLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKS-RDVQTQFSGKFAILERFLHKIK 712
             ++KLCNHP L+                DY   TG    DV    + K   L   L +  
Sbjct: 1564 YMRKLCNHPALVLSPNHPQLAQV----QDYLKQTGIDLHDVIN--APKLNALRTLLFECG 1617

Query: 713  TESDD--------------------KIVLISNYTQTLDLIERMCRNRHYASV---RLDGT 749
               +D                    + ++       LD++E     R+  SV   RLDG+
Sbjct: 1618 IGEEDMERKSNPNQYLTGQNVISQHRALIFCQLKDMLDMVENDLFKRYMPSVTYMRLDGS 1677

Query: 750  MSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 809
            +    RQK+V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R
Sbjct: 1678 VDPRDRQKVVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDR 1736

Query: 810  VWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
              R GQKK   +YR I+ GT+EEKI   Q  KM+++S VV+ +           L  LF 
Sbjct: 1737 AHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFD 1796

Query: 870  FND 872
             +D
Sbjct: 1797 TDD 1799

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  211 bits (536), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 238/502 (47%), Gaps = 64/502 (12%)

Query: 357 DFLEALKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISK----CII 412
           ++L AL K+Q         I+ADEMGLGKTLQ IA +  L        R I K     ++
Sbjct: 150 NWLVALHKNQ------LAGILADEMGLGKTLQTIAFLGYL--------RYIEKKNGPFLV 195

Query: 413 VCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP 472
           + P S +NNW  E+ +W    +   L  D ++ S       +A                 
Sbjct: 196 IAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLACDFD------------- 242

Query: 473 VLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQ 532
           + + SY+ + R     +  +   ++ DE HR+KN +S+    L   +   R++++GTP+Q
Sbjct: 243 ICVASYEIIIREKASFKKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 302

Query: 533 NDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVS 592
           N+L E +ALLNF  P +      F   F                       ++ L  ++S
Sbjct: 303 NNLHELWALLNFLLPDIFADSATFDEWFSSESSEEDKEKV-----------VKQLHTVLS 351

Query: 593 KFIIRRT-NDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP--- 648
            F++RR  ND+    LP K E  ++V ++  QK+ Y  +++ +DI  V   +G  +    
Sbjct: 352 PFLLRRIKNDVEGSLLPKK-ELNVYVGMSSMQKKWYKQILE-KDIDAVNGSNGQKESKTR 409

Query: 649 -LKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERF 707
            L  +  L+K CNHP L                D        + D    ++     +   
Sbjct: 410 LLNIVMQLRKCCNHPYLF---------------DGAEPGPPYTTDEHLVYNSAKLKVLDK 454

Query: 708 LHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEG 767
           L K   E   ++++ S  ++ LD++E  C  R Y   R+DG+ +   R   +D +N P+ 
Sbjct: 455 LLKKFKEQGSRVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDS 514

Query: 768 QEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIST 827
           ++FIFLL+++AGG GINL  A+ ++L D DWNP AD QA+ R  R GQKK   ++RF++ 
Sbjct: 515 KKFIFLLTTRAGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTD 574

Query: 828 GTIEEKIYQRQSMKMSLSSCVV 849
            ++EEKI +R + K+ L   V+
Sbjct: 575 NSVEEKILERATQKLKLDQLVI 596

>Scas_520.5
          Length = 863

 Score =  208 bits (530), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 156/525 (29%), Positives = 245/525 (46%), Gaps = 68/525 (12%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+AD+MGLGKT+Q IAL+  +     +G  LI+      P S V+NW NE  K+  P+  
Sbjct: 293 ILADDMGLGKTIQSIALLAFIYEMDTKGPFLIA-----APLSTVDNWMNEFEKF-APDL- 345

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNW-AQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVG 494
            P+     K     G     + ++N+  +  G  IV    + SY+ + R+   + + +  
Sbjct: 346 -PVL----KYYHPGGKNERNKLMRNFFKKTNGTGIV----VTSYEIIIRDADYIMSKQWK 396

Query: 495 LLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            L+ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +     
Sbjct: 397 FLIVDEGHRLKNVNCRLIQELKRINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFTDFE 456

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSN---IVSKFIIRRTND-ILSKYLPCK 610
            F + F+   L      +  N V + E +  L+SN   I+  F++RR    +L+  LP K
Sbjct: 457 IFNKWFDFKDLEMESNSSKLNKVINEELQKNLISNLHTILKPFLLRRLKKTVLANILPPK 516

Query: 611 YEHVIFVNLTPFQKQVYNMLIKSRDIKKVVK----------------------------- 641
            E+V+   LTP QK+ Y   ++ +  K + K                             
Sbjct: 517 REYVVNCPLTPIQKKFYKRGLEGKLKKTIFKEYVKAFFTLNSDYIGSVSNKSIREFIDYK 576

Query: 642 -------GDGGSQ---PLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDD---YSIPTG 688
                   DG  Q    L+ +  L     H ++              I D    +  P  
Sbjct: 577 LHEGETDSDGQIQLNDTLQKMDTLFMEYIHKEIANKRLQNMMMQLRQIVDSTLIFYFPYL 636

Query: 689 KSRDVQTQ----FSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASV 744
           +  D+  Q     SGK   L+R +  +  +   KI++ S +   LDL+E  C     A+ 
Sbjct: 637 RPEDLTLQELLESSGKLKTLQRLVIPLIAKG-HKILIFSQFVNMLDLLEDWCDLNSLAAF 695

Query: 745 RLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 804
           R+DGT+    R++ + +FND + +  +FLLS++A G G+NL+GA+ ++L D DWNP  D 
Sbjct: 696 RIDGTIDNESRKEQLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDL 755

Query: 805 QALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           QA+ R  R GQ K   +YRF    T+E  I  R + K  L   V+
Sbjct: 756 QAMDRCHRIGQTKPVIVYRFCCDNTLEHVILTRAANKRKLERLVI 800

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  207 bits (528), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 250/519 (48%), Gaps = 62/519 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q IAL+  +     +G  L++      P S+V+NW  E  K+      
Sbjct: 209 ILADEMGLGKTIQSIALLAFIYEMDTRGPFLVT-----APLSVVDNWITEFEKF------ 257

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
           +P ++   K   A G       +K + +   +N  + V++ SY+ + R++  + + +   
Sbjct: 258 AP-SIPVLKYYSADGPGKRHAILKEFFR---KNSGEGVVVTSYEIVMRDMNVILSHQWKF 313

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           L+ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +      
Sbjct: 314 LIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQNNLAELWSLLNFILPDVFADFEI 373

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSN---IVSKFIIRRTND-ILSKYLPCKY 611
           F + F+   L  + +    + +   E +  L++N   I+  F++RR    +L+  LP K 
Sbjct: 374 FSKWFDFSDLDLKTSSQRWDKIIGEELEKNLVTNLHTILKPFLLRRLKRVVLADALPPKR 433

Query: 612 EHVIFVNLTPFQKQVYNMLIKSRDIKKVV------------------------------- 640
           E++I   LTP Q + Y M +  + +K+ V                               
Sbjct: 434 EYIINCPLTPLQTRFYKMALAGK-LKRTVFTQAIKEFFTLNREHIGSVSNKTIREFIDYK 492

Query: 641 KGDGGSQPLKAIGVLKKLCN---HPDLIKXXXXXXXXXXXXIPDD---YSIPTGKSRDVQ 694
             D   Q  K I  ++KL     H +L              I D    +  P  K+ D+Q
Sbjct: 493 TSDEEIQASKVITDMEKLYEQHIHKELRNKRLQNLMMQLRQIVDSTFLFYFPYLKAEDLQ 552

Query: 695 ----TQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTM 750
                Q SGK  IL++ L ++   +  K+++ S +   LDLIE  C   +Y++ R+DG+M
Sbjct: 553 LPVLLQTSGKLQILQQLLPRL-LAAKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSM 611

Query: 751 SINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 810
               R++ ++ F++      +FLLS++AGG GINL  A+ +IL D DWNP  D QA+ R 
Sbjct: 612 DNETRREQINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRS 671

Query: 811 WRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            R GQ+    +YR     T+E  I  R + K  L   V+
Sbjct: 672 HRIGQQHPVIVYRLYCDKTVESVILARATNKRKLEQLVI 710

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  210 bits (535), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 145/484 (29%), Positives = 245/484 (50%), Gaps = 60/484 (12%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC----IIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKTLQ I+ +  L        R I K     +++ P S +NNW  E+ +W  
Sbjct: 218 ILADEMGLGKTLQTISFLGYL--------RYIEKIPGPFLVIAPKSTLNNWLREINRWT- 268

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
           P+ ++   + G K   A       E I    Q +       V+I SY+ + R    L+  
Sbjct: 269 PD-VNAFILQGDKEERA-------ELI----QKKLLGCDFDVVIASYEIIIREKSPLKKI 316

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
               ++ DE HR+KN +S+    L       R++++GTP+QN+L E +ALLNF  P +  
Sbjct: 317 NWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFS 376

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT-NDILSKYLPCK 610
              +F   F         +++T+ D    ++ ++ L  ++  F++RR  +D+ +  LP K
Sbjct: 377 DAQDFDDWF--------SSESTEED---QDKIVKQLHTVLQPFLLRRIKSDVETSLLPKK 425

Query: 611 YEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-----LKAIGVLKKLCNHPDLI 665
            E  ++V ++  QK+ Y  +++ +D+   V G  GS+      L  +  L+K CNHP L 
Sbjct: 426 -ELNLYVGMSSMQKKWYKKILE-KDLD-AVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF 482

Query: 666 KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
                          D        + D    ++     +   L K   E   ++++ S  
Sbjct: 483 ---------------DGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQM 527

Query: 726 TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
           ++ LD++E  C  R+Y   R+DG+ +   R + +D +N P+ ++F+FLL+++AGG GINL
Sbjct: 528 SRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINL 587

Query: 786 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
             A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R + K+ L 
Sbjct: 588 TSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 647

Query: 846 SCVV 849
             V+
Sbjct: 648 QLVI 651

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  209 bits (533), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 143/484 (29%), Positives = 241/484 (49%), Gaps = 60/484 (12%)

Query: 376 IMADEMGLGKTLQCIALMWTLL----RQGPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKTLQ I  +  L     ++GP         +++ P S +NNW  E+ +W  
Sbjct: 166 ILADEMGLGKTLQTITFLGYLRYIEKKRGP--------FLVIAPKSTLNNWQREINRWT- 216

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
           P+ +    + G K   A              Q +       V I SY+ + R     +  
Sbjct: 217 PD-VDAFILQGDKEERA-----------RLCQERLLACNFDVAIASYEIIIREKASFKKI 264

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
           +   ++ DE HR+KN +S+    L   +   R++++GTP+QN+L E +ALLNF  P +  
Sbjct: 265 DWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFS 324

Query: 552 TRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT-NDILSKYLPCK 610
               F   F         ++A+D+D    ++ ++ L  I+  F++RR  +D+ +  LP K
Sbjct: 325 DSAAFDEWF--------SSEASDDD---KDKIVKQLHTILQPFLLRRIKSDVETSLLPKK 373

Query: 611 YEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQP-----LKAIGVLKKLCNHPDLI 665
            E  ++V ++  Q++ Y  +++ +D+   V G  GS+      L  +  L+K CNHP L 
Sbjct: 374 -ELNLYVGMSSMQRKWYKQILE-KDLD-AVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF 430

Query: 666 KXXXXXXXXXXXXIPDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNY 725
                          D        + D    ++     +   L K   E   ++++ S  
Sbjct: 431 ---------------DGAEPGPPYTTDEHLVYNSAKLKVLDKLLKKLKEDGSRVLIFSQM 475

Query: 726 TQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 785
           ++ LD++E  C  R Y   R+DG+ +   R + +D +N P+ ++FIFLL+++AGG GINL
Sbjct: 476 SRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTRAGGLGINL 535

Query: 786 IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLS 845
             A+ ++L D DWNP AD QA+ R  R GQKK   ++R ++  ++EEKI +R + K+ L 
Sbjct: 536 TTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLD 595

Query: 846 SCVV 849
             V+
Sbjct: 596 QLVI 599

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  210 bits (535), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 249/513 (48%), Gaps = 64/513 (12%)

Query: 376  IMADEMGLGKTLQCIALMWT--LLRQ-------GPQGKRLISKCIIVCPSSLVNNWANEL 426
            I+ D+MGLGKTLQ I ++ +   LRQ         + + L S  +IVCP SL  +W  E 
Sbjct: 1301 ILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVETRPLPS--LIVCPPSLTGHWEQEF 1358

Query: 427  VKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVK 486
             ++  P  L+ L   G  S+       + +A               +++ SYD  R ++ 
Sbjct: 1359 EQY-AP-FLTVLVYAGGPSTRYPLRGKLGDA--------------DIVVTSYDVARNDID 1402

Query: 487  QLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSN 546
             +   +    + DEGH +KN  S    A+ SI    R+IL+GTPIQN++ E ++L +F  
Sbjct: 1403 IISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNNVVELWSLFDFLM 1462

Query: 547  PGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT-NDILSK 605
            PG LG+   F+  F  PI  SR++  +  + ++G   L+ L   V  F++RR   D+LS 
Sbjct: 1463 PGFLGSEKAFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKEDVLSD 1522

Query: 606  YLPCKYEHVIFVNLTPFQKQVYNMLIK------SRDIKKVVKGDGGSQPLKAIGVLKKLC 659
             LP K     +  L+  Q+Q+Y    K       RDI+  ++ +  +   +A+  ++KLC
Sbjct: 1523 -LPPKIIQDYYCELSDLQRQLYKDFAKKQKNIVERDIENTMELESKNHIFQALQYMRKLC 1581

Query: 660  NHPDLIKXXXXXXXXXXXXIPDDYSIPTGKSRDVQ-TQFSGKFAILERFL---------- 708
            NHP L+                DY   TG   D+     + K   L   L          
Sbjct: 1582 NHPSLVLSKDHPQYNQV----QDYLSQTGM--DIHDIAHAPKLGALRNLLLECGIGVQDV 1635

Query: 709  --HKIKTESDDKIV------LISNYTQTLDLIERMCRNRHYASV---RLDGTMSINKRQK 757
              + I   S + ++      +       LD+IE     ++  SV   RLDG++    RQK
Sbjct: 1636 DQNSISLPSSENVISQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLDGSVESRDRQK 1695

Query: 758  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
            +V +FN+    +   LL++K GG G+NL GA+ +I ++ DWNP  D QA+ R  R GQKK
Sbjct: 1696 VVRKFNEDPSID-CLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMDRAHRLGQKK 1754

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD 850
               +YR I+ G++EEKI   Q  KM+++S VV+
Sbjct: 1755 VVNVYRIITKGSLEEKIMGLQKFKMNIASTVVN 1787

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score =  208 bits (530), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 162/518 (31%), Positives = 242/518 (46%), Gaps = 62/518 (11%)

Query: 374  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
             CI+ADEMGLGKT Q I+ +  L +    G  L+     V PSS + NW  E  K+    
Sbjct: 522  SCILADEMGLGKTCQVISFLAYLKQTHHNGPHLV-----VVPSSTLENWLREFNKFCPHL 576

Query: 434  TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDT---LRRNVKQLQN 490
             + P    G +   A     + E   N  Q         V++ +Y+     + +V  L+N
Sbjct: 577  KVEPYY--GSQQERAELRDILEE---NEGQYD-------VIVTTYNLAAGTKYDVSFLRN 624

Query: 491  TEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 550
                +++ DEGH LKN  S  F  L  IN   R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 625  RNFDVVVYDEGHMLKNSMSERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPNLF 684

Query: 551  GTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCK 610
             ++ +          R+ DAD   N +   E  ++    ++  FI+RR  D + K+LP K
Sbjct: 685  VSKKDDLATVFKQKTRTSDADKGYNPL-LAEHAIERAKTMMKPFILRRKKDQVLKHLPRK 743

Query: 611  YEHVIFVNLTPFQKQVYNMLIKS-----RDIKKVVKGDGGSQPLKA--IGVLKKLCNHPD 663
            + H++   +T  QK +Y   IK      R IK+ VK +  S+ +    I  L+K   HP 
Sbjct: 744  HNHILHCEMTELQKTLYQQEIKQVMEHRRKIKEGVKMEKASRNVSKNLIMALRKASIHPL 803

Query: 664  LIKXXXXXXXXXXXX-----------------IPDDYSIPTG----------------KS 690
            L +                             I +D S  T                 K 
Sbjct: 804  LFRHIYNDKIISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKLCCKFPSLYKFKL 863

Query: 691  RDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTM 750
            +  +   SGK   L+  LHKI     +K+++ S +TQ LD++E +    +   +RLDG  
Sbjct: 864  QSDEWMNSGKVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNIKFLRLDGQT 923

Query: 751  SINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 810
             +N RQ L+DRF + +    +FLLS+KAGG GINL+ AN +I+ D  +NP  D+QA  R 
Sbjct: 924  QVNDRQSLIDRFYEDDTIP-VFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRA 982

Query: 811  WRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848
             R GQ K+  +   IS  TIEEKI      K++L + +
Sbjct: 983  HRVGQTKEVQVTTLISRDTIEEKILHLAKNKLALDTHI 1020

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  206 bits (523), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 152/519 (29%), Positives = 245/519 (47%), Gaps = 61/519 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q IAL+  +     +G  LI+      P S V NW NE  ++  P+  
Sbjct: 219 ILADEMGLGKTIQSIALLAFIYEMDTKGPFLIA-----APLSTVENWMNEFARF-APDI- 271

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
            P+         A+    + +  KN       N  + V+I SY+ + R+++ + + +   
Sbjct: 272 -PVLKYYNSEGQAARHAMMGKFFKN-------NKGEGVIITSYEIIIRDIELILSYQWKF 323

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           L+ DEGHRLKN +      L  IN   R++L+GTP+QN+L E ++LLNF  P +      
Sbjct: 324 LIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNNLGELWSLLNFILPNIFSDFEI 383

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSN---IVSKFIIRR-TNDILSKYLPCKY 611
           F + F+   L    +      + + E +  L+SN   I+  F++RR   ++L+  LP K 
Sbjct: 384 FNKWFDFSDLNLESSSEKLTKIINDELEKNLISNLHTILKPFLLRRLKKNVLAGSLPPKR 443

Query: 612 EHVIFVNLTPFQKQVYNMLIKS------------------------------RD-IKKVV 640
           E++I   +TP QK+ Y   +K                               RD I+  +
Sbjct: 444 EYIITCPVTPLQKKYYKQALKGNLKQTIQKQAIKDFFTLNAEYIGTVSNKSIRDFIEWKL 503

Query: 641 KGDGGSQPLKAIGVLKKLCN---HPDLIKXXXXXXXXXXXXIPDDYSI-------PTGKS 690
             D    P   IG ++KL +   H +L+             I +   +       PT  +
Sbjct: 504 SADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQNMMIQLRQIVNSTYLFYFPLLEPTDLT 563

Query: 691 RDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTM 750
            +   + SGK  +L++ + ++  +   K+++ S +   LDLIE      ++ S R+DG+M
Sbjct: 564 LENLLKTSGKLQVLQKLVPEL-IKKKHKVLIFSQFVSMLDLIEDWSELNNFISCRIDGSM 622

Query: 751 SINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARV 810
             N R++ ++ F+    +  +FLLS++A G GINL  A+ +I+ D DWNP  D QA+ R 
Sbjct: 623 QNNSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAMDRA 682

Query: 811 WRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            R GQ K   +YR     TIE  I  R   K  L   V+
Sbjct: 683 HRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLVI 721

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
            (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  206 bits (524), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 161/537 (29%), Positives = 257/537 (47%), Gaps = 85/537 (15%)

Query: 375  CIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
            CI+ADEMGLGKT Q I+ +  L  Q   G  L+     V PSS + NW  E  K+     
Sbjct: 492  CILADEMGLGKTCQVISFLAYLKEQNHTGPHLV-----VVPSSTLENWLREFKKFCPQLK 546

Query: 435  LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP------VLIISYDTLRRN---V 485
            + P     ++                  +A+ R+I++        ++ +Y+    N   V
Sbjct: 547  IEPYYGSQQE------------------RAELRDILEENDGQYDAIVTTYNLASGNKADV 588

Query: 486  KQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 545
              L+N +  +++ DEGH LKN  S  FT L  I+   R++L+GTP+QN+L E  +LL F 
Sbjct: 589  SFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLLTGTPLQNNLRELMSLLEFI 648

Query: 546  NPGL-LGTRNEFRRNFEIPILRSRDADAT-DNDVKSGEQKLQLLSNIVSKFIIRRTNDIL 603
             P L +  ++E    F+    R+R +D+  D +    ++ +     I+  FI+RR  D +
Sbjct: 649  MPSLFVSKKDELAAVFK---QRARTSDSNKDYNPLLAQEAIDRAKTIMKPFILRRRKDQV 705

Query: 604  SKYLPCKYEHVIFVNLTPFQKQVYN----MLIKSRDIKK--VVKGDGGSQPLKA------ 651
             K+LP K+ H+ + ++TP Q+ +YN    ++++ R + +  V+  D G + L A      
Sbjct: 706  LKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMVRDGVLPTDAGERALVAQSTSKN 765

Query: 652  -IGVLKKLCNHPDLIKXXXXXXXXXXXX-----------------IPDDYS--------- 684
             I  L+K   HP L +                             I +D S         
Sbjct: 766  LIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPEYADSGNRDYIREDMSYMCDLELHR 825

Query: 685  ----IPTGKSRDVQT---QFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCR 737
                 P+  S  +       SGK   L+  L +      +K ++ S +TQ LD++E +  
Sbjct: 826  LCCRFPSLASFQLSEPTWMASGKVHRLQPLL-RAAIARREKTLVFSLFTQVLDILELVLS 884

Query: 738  NRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPD 797
            +   A +RLDG+  +N RQ L+DRF+  +    +FLLS+KAGG GINL+ AN +I+ D  
Sbjct: 885  SLGIAFLRLDGSTPVNDRQALIDRFH-TDTDVPVFLLSTKAGGFGINLVCANHVIIFDQS 943

Query: 798  WNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKED 854
            +NP  D+QA  R  R GQ ++  +   +S  T+EEKI Q    K++L S V D + D
Sbjct: 944  FNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEKILQLARHKLALDSSVSDRRAD 1000

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH]
           (980963..985231) [4269 bp, 1422 aa]
          Length = 1422

 Score =  203 bits (517), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 144/481 (29%), Positives = 234/481 (48%), Gaps = 41/481 (8%)

Query: 376 IMADEMGLGKTLQCIALM-WTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNT 434
           I+ADEMGLGKT+Q ++ + W +  +   G  L+     V P S +  W     KW  P  
Sbjct: 378 ILADEMGLGKTVQTVSFISWLIFARRQNGPHLV-----VVPLSTMPAWQETFEKW-APEL 431

Query: 435 LSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVG 494
                +  +KS          E   N      +NI   VL+ +Y+ + ++  +L   +  
Sbjct: 432 NCVYYMGNQKSR---DVIREYEFYTNPHTKGKKNIKFNVLLTTYEYILKDRLELGAIKWQ 488

Query: 495 LLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRN 554
            L  DE HRLKN +S  + +L S     R++++GTP+QN++ E  AL+NF  PG      
Sbjct: 489 FLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNIKELAALVNFLMPGKFTIDQ 548

Query: 555 EFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHV 614
           E   +FE             N  +  E  ++ L   +  +I+RR    + K LP K E +
Sbjct: 549 EI--DFE-------------NQDEKQENYIRDLHKRLQPYILRRLKKDVEKSLPSKTERI 593

Query: 615 IFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQ--PLKAIGVLKKLCNHPDLIKXXXXXX 672
           + V L+  Q + Y  ++ +++   +  G  G+    L  +  LKK  NHP L        
Sbjct: 594 LRVELSDVQTEYYKNIL-TKNYNALTAGTKGTHFSLLNIMNELKKASNHPYLFGNAENRV 652

Query: 673 XXXXXXIPDDYSIPTGKSRD----VQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQT 728
                           +SR+         SGK  +L++ L ++K +   ++++ S   + 
Sbjct: 653 LAKFGD--------GNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGH-RVLIFSQMVRM 703

Query: 729 LDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGA 788
           LD++      +     RLDGT+  ++R+  +D FN P+  +F+FLLS++AGG GINL+ A
Sbjct: 704 LDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTA 763

Query: 789 NRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848
           + +I+ D DWNP AD QA+AR  R GQK    +YRF+S  T+EE++ +R   KM L   +
Sbjct: 764 DTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMILEYAI 823

Query: 849 V 849
           +
Sbjct: 824 I 824

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  200 bits (509), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 243/520 (46%), Gaps = 62/520 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q IAL+  +     +G  LI+      P S V+NW NE  K+  P   
Sbjct: 241 ILADEMGLGKTIQSIALLSFIYEMDTKGPFLIA-----APLSTVDNWMNEFAKF-APEI- 293

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
            P+     K    +G  +  + +K + +   R   + V++ SY+ + R+   +   +   
Sbjct: 294 -PIL----KYYSQNGQDARQKLLKKFFKNNNR---EGVIVTSYEMIIRDANIIMGEQWKF 345

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           L+ DEGHRLKN +      L  IN   R++L+GTP+QN+LSE ++LLNF  P +      
Sbjct: 346 LIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDIFADFEI 405

Query: 556 FRRNFEIPILRSRDADATDNDVKSGEQKLQLLSN---IVSKFIIRRTNDILSK-YLPCKY 611
           F + F+   L  +   A  N + + E +  L+SN   I+  F++RR   ++ K  LP K 
Sbjct: 406 FNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLKDVLPPKR 465

Query: 612 EHVIFVNLTPFQKQVYNML----IKSRDIKKVVKGDG-------GSQPLKAI--GVLKKL 658
           E+++   L+P Q + Y M     +K    K++VK          G+   K+I   +  KL
Sbjct: 466 EYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEYIGTVSNKSIRDFIDYKL 525

Query: 659 CNHPD------LIKXXXXXXXXXXXXIPDD-------------------YSIPTGKSRDV 693
              PD      +IK               +                   +  P  +  D+
Sbjct: 526 SEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLFFFPYMEPEDI 585

Query: 694 QTQF----SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGT 749
              +    SGK  +L++    +  +   KI++ S +   LDL+E       + S+R+DG 
Sbjct: 586 TLDYLLASSGKLQMLQKLAIPL-IKKGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGG 644

Query: 750 MSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALAR 809
           +    R++ +D FN       IFLLS++A G GINL+ A+ +I+ D DWNP  D QA+ R
Sbjct: 645 VDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDR 704

Query: 810 VWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
             R GQ K   +YRF    TIE  I  R   K  L   V+
Sbjct: 705 CHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLERMVI 744

>Kwal_47.18077
          Length = 809

 Score =  199 bits (507), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 154/521 (29%), Positives = 242/521 (46%), Gaps = 65/521 (12%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN-- 433
           I+ADEMGLGKTLQ IAL+  +      G  LI+      P S ++ W NE  ++  P+  
Sbjct: 202 ILADEMGLGKTLQSIALLAFITEMDTGGPFLIA-----APLSTLDTWVNEFSRF-APDIQ 255

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEV 493
            L   +  G+     S   S+ +      + QG      V+I SY+ + R+++ + + + 
Sbjct: 256 VLKYYSTQGQ-----SYRQSLLKKFFKSTKGQG------VVITSYEIIIRDIELILSYQW 304

Query: 494 GLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTR 553
             L+ DEGHR+KN +      L  IN   R++++GT +QN+LSE ++LLNF  P +    
Sbjct: 305 KFLIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQNNLSELWSLLNFIMPDIFADF 364

Query: 554 NEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSN---IVSKFIIRRTNDI-LSKYLPC 609
             F + F+   L  + +    N + + E +  L+SN   I+  F++RR   + L+  LP 
Sbjct: 365 EIFHKWFDFSDLELKSSSQGLNRLINDELEKNLISNLHAILKPFLLRRLKKVVLAGSLPP 424

Query: 610 KYEHVIFVNLTPFQKQVY----NMLIKSRDIKKVVKG----------------------- 642
           K E+++   LT  QK++Y    N  +K    K+ +K                        
Sbjct: 425 KREYIVNCPLTSVQKKLYKSALNGKLKQAIFKQAIKDFFVLNSDQIGQVSNKSIRDFMEW 484

Query: 643 -------DGGSQPLKAIGVLKKLCNHPDLIKXXXXXXXXXXXXIPDDYSI-------PTG 688
                  D  ++ L+ +  L K   H  L+             + D   +       P  
Sbjct: 485 KLNANDEDPDTEILQQMDKLYKQHIHRALLNKRLQNPMVQLRQVVDSTLLFFFPFINPEK 544

Query: 689 KSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDG 748
            + D   Q SGK  IL++ +  +  +   K+++ + +   LDLIE  C        R+DG
Sbjct: 545 LTLDFLLQSSGKLQILQQLVPPL-IKKGHKVLIFTQFVGMLDLIEDWCELNDVRVCRIDG 603

Query: 749 TMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 808
           +M    RQ+ ++RFNDP+     FL+S++AGG GINL  A+ +IL D DWNP  D QA  
Sbjct: 604 SMGNETRQEHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQATD 663

Query: 809 RVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           R  R GQ K   +YR     TIE  I  R + K  L   V+
Sbjct: 664 RTHRIGQTKPVIVYRLCCDNTIEHVILTRAASKRKLEKMVI 704

>Scas_548.4
          Length = 1054

 Score =  194 bits (492), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 155/528 (29%), Positives = 245/528 (46%), Gaps = 75/528 (14%)

Query: 374  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
             CI+AD+MGLGKT Q I+    L +    G  L+     V PSS + NW  E  K+    
Sbjct: 516  SCILADDMGLGKTCQVISFFAYLKQINEPGPHLV-----VVPSSTLENWLREFQKFCPTL 570

Query: 434  TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRN---VKQLQN 490
             + P    G ++  A     + E ++  A          V++ +Y+    N   V  L+N
Sbjct: 571  KIEPYY--GSQNERAD----LREILERTAGQYD------VIVTTYNLAAGNKYDVSFLRN 618

Query: 491  TEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLL 550
             +  +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L 
Sbjct: 619  RQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTPLQNNLRELMSLLEFIMPALF 678

Query: 551  GTRNEFRRNFEIPILRSRDADATDNDVKSG---EQKLQLLSNIVSKFIIRRTNDILSKYL 607
             ++ E   +    + + R     DN   +    ++ ++    ++  FI+RR  D + K+L
Sbjct: 679  ISKKESLAS----VFKQRAKTTDDNKGHNPLLVQEAIERAKTMMKPFILRRRKDQVLKHL 734

Query: 608  PCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDG-------------GSQPLKAIGV 654
            P K+  + +  +   Q+++Y+  IK+    K +  DG              S     I  
Sbjct: 735  PAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMILDGTLPDDPKERAKIQSSSSSNLIMT 794

Query: 655  LKKLCNHPDLIKXXXXXXXXXXXX-----------------IPDDYSI------------ 685
            L+K   HP L +                             I +D S+            
Sbjct: 795  LRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVDGNIEFIKEDMSVMTDFELHRLCLN 854

Query: 686  -PTGKSR----DVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRH 740
             P   SR    + +   SGK   L R L +I  E  +K+++ S +TQ LD++E +    +
Sbjct: 855  FPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERKEKVLIFSLFTQVLDILELVLSELN 914

Query: 741  YASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNP 800
            Y  +RLDG+  +N RQ L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP
Sbjct: 915  YKFLRLDGSTQVNDRQSLIDKFYEDDTIP-IFILSTKAGGFGINLVCANNVIIFDQSFNP 973

Query: 801  AADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848
              D+QA  R  R GQ K+  I   I+  +IEEKI+Q    K++L S +
Sbjct: 974  HDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQLAKNKLALDSHI 1021

>Kwal_26.7123
          Length = 1081

 Score =  193 bits (491), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 157/541 (29%), Positives = 251/541 (46%), Gaps = 89/541 (16%)

Query: 370  RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKW 429
            R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 540  RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594

Query: 430  LGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP------VLIISYDTLRR 483
                 + P     ++                  +A+ R+I++       V++ +Y+    
Sbjct: 595  CPDLKIEPYYGSQQE------------------RAELRDILEDNDGQYDVIVTTYNLASG 636

Query: 484  N---VKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 540
            N   V  L+N    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +
Sbjct: 637  NKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMS 696

Query: 541  LLNFSNPGL-LGTRNEFRRNFEIPILRSRDADAT-DNDVKSGEQKLQLLSNIVSKFIIRR 598
            LL F  P L +  +N+    F     R+R +D+  D +    ++ +     ++  FI+RR
Sbjct: 697  LLEFIMPNLFISKKNDLSAVFR---QRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRR 753

Query: 599  TNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKS-RDIKKVV---------------KG 642
              D + K+LP K+  + +  ++  Q+ +YN  I+   D K+++               K 
Sbjct: 754  RKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLREREEEGSAEEPRPTKK 813

Query: 643  DGGSQPLK-AIGVLKKLCNHPDL-----------------IKXXXXXXXXXXXXIPDDY- 683
            +GG+Q  K  I  L+K   HP L                 +K            I +D  
Sbjct: 814  NGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMS 873

Query: 684  ----------------SIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQ 727
                            S+   + ++ +   SGK   L + L  I     +K+++ S +TQ
Sbjct: 874  YMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQ 933

Query: 728  TLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIG 787
             LD++E      +   +RLDG+  +N RQ L+D+F+D +    +F+LS+KAGG GINL+ 
Sbjct: 934  MLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVC 992

Query: 788  ANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSC 847
            AN +I+ D  +NP  D+QA  R  R GQ K   I   I+  +IEEKI Q    K++L + 
Sbjct: 993  ANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTY 1052

Query: 848  V 848
            +
Sbjct: 1053 I 1053

>Kwal_27.11388
          Length = 1334

 Score =  123 bits (308), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 88/304 (28%), Positives = 152/304 (50%), Gaps = 33/304 (10%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+++  L     +   +    I+V P+S ++NW NE+ K+L    +
Sbjct: 616 ILADEMGLGKTVQSISVLAHL----AENYNIWGPFIVVTPASTLHNWVNEISKFLPDFKI 671

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQ---GRNIVKPVLIISYDTLRRNVKQLQNTE 492
            P   +G    +           + W + Q   G++    V++ SY  +  +   LQ  +
Sbjct: 672 LPYWGNGNDRKILR---------RFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQKMK 722

Query: 493 VGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 552
              ++ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P L  +
Sbjct: 723 WQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFDS 782

Query: 553 RNEFRRNFEIPILRSRDADA-TDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKY 611
            +EF   F      S+D ++   ++ K  +Q+L+ L  I+  F++RR    +   L  K 
Sbjct: 783 HDEFSDWF------SKDIESHAQSNTKLNQQQLRRLHMILKPFMLRRIKKNVQSELGEKI 836

Query: 612 EHVIFVNLTPFQKQVYNMLIKSR------DIKKVVKGDGGSQP---LKAIGVLKKLCNHP 662
           E  +  +LT  Q ++Y +L KS+       I+     D  S     +  +   +K+CNHP
Sbjct: 837 EIDVMCDLTRRQHKLYQVL-KSQMSAAYDAIENAAGSDEASSDQNIVNTVMQFRKVCNHP 895

Query: 663 DLIK 666
           DL +
Sbjct: 896 DLFE 899

 Score =  108 bits (271), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 94/165 (56%), Gaps = 7/165 (4%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L  +K ++D ++++    T+ +DL+E     R Y  +RLDG+  +  R+ 
Sbjct: 1169 STKLKKLDELLVNLK-KNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRD 1227

Query: 758  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
            LV D    PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1228 LVHDWQTKPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1285

Query: 817  KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAK---EDVERL 858
            +   +YR +  GTIEE++  R   K  +   V++ K   +D+++L
Sbjct: 1286 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQEKDIQQL 1330

>Scas_669.20
          Length = 1397

 Score =  120 bits (300), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 144/314 (45%), Gaps = 55/314 (17%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K++    +
Sbjct: 667 ILADEMGLGKTVQSISVLAHL----AEKHNIWGPYLVVTPASTLHNWVNEITKFVPQFKI 722

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP----------------VLIISYD 479
            P                       W  A  R +++                 V+I SY 
Sbjct: 723 LPY----------------------WGNAADRKVLRKFWDRKNLRYTKDSPFHVMITSYQ 760

Query: 480 TLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYF 539
            +  +V  LQ  +   ++ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +
Sbjct: 761 MVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELW 820

Query: 540 ALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT 599
           ALL+F  P L  + +EF   F   I    +A+   N      Q+L+ L  I+  F++RR 
Sbjct: 821 ALLHFIMPSLFDSHDEFSEWFAKDIESHAEANTQLN-----HQQLRRLHMILKPFMLRRV 875

Query: 600 NDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKA-------I 652
              +   L  K E  +  +LT  Q ++Y +L KS      ++   GS    +       +
Sbjct: 876 KKNVQSELGDKIEIDVLCDLTQRQAKLYQVL-KSTSNYDAIENAAGSDEFSSDQNLVNTV 934

Query: 653 GVLKKLCNHPDLIK 666
              +K+CNHPDL +
Sbjct: 935 MQFRKVCNHPDLFE 948

 Score =  108 bits (271), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 87/156 (55%), Gaps = 4/156 (2%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L ++K E   ++++    T+ +DL+E     R Y  +RLDG+  +  R+ 
Sbjct: 1219 SAKLKKLDELLVQLKREGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1277

Query: 758  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
            LV D    PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1278 LVHDWQTKPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1335

Query: 817  KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAK 852
            +   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1336 RQVTVYRLLIRGTIEERMRDRAKQKEQVQQVVMEGK 1371

>Kwal_55.20143
          Length = 1494

 Score =  120 bits (300), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 146/307 (47%), Gaps = 40/307 (13%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKT+Q I+L+  L  +    GP         +I+ P+S++ NW  E  ++  
Sbjct: 693 ILADEMGLGKTIQTISLLAYLACEKHNWGPH--------LIIVPTSVLLNWEMEFKRF-- 742

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
                  A   K  +         E  K W +    +    V I SY  +  +    +  
Sbjct: 743 -------APGFKVLTYYGSPQQRKEKRKGWNRPDAFH----VCITSYQLVVHDQHSFKRK 791

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
           +   ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P   G
Sbjct: 792 KWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAG 851

Query: 552 TR---------NEFRRNFEIP---ILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRT 599
           T            F++ F  P   I+++ +  A D + +    KL     ++  +++RR 
Sbjct: 852 TNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTVTKLH---QVLRPYLLRRL 908

Query: 600 NDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLC 659
              + K +P K+EHV++  L+  Q+ +Y+  +     K+ +        +  +  L+K+C
Sbjct: 909 KADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRAQTKETLSSGNFMSIINCLMQLRKVC 968

Query: 660 NHPDLIK 666
           NHPDL +
Sbjct: 969 NHPDLFE 975

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 93/169 (55%), Gaps = 7/169 (4%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L   L  +K     + ++ +  T+ LD++E+      Y  +RLDG   I +RQ L
Sbjct: 1217 GKLQKLATLLRDLKN-GGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEERQIL 1275

Query: 759  VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 818
             +RFN  + +   F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1276 TERFN-TDNRITAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1334

Query: 819  CFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQL 867
              IYRF+S  TIE  I ++ + K  L + V+   +     F+ D L +L
Sbjct: 1335 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQRGD-----FTTDYLTKL 1378

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  112 bits (280), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 91/171 (53%), Gaps = 6/171 (3%)

Query: 683 YSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYA 742
           Y  P   S DV  Q SGK  IL++ + K+  E   K+++ S +   LDLIE  C    + 
Sbjct: 18  YIQPEELSLDVLLQTSGKLQILQQLVPKLINEGH-KVLIFSQFVNMLDLIEDWCELNDFQ 76

Query: 743 SVRLDGTMSINKRQKLVDRFN----DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDW 798
           + R+DG+M    RQ+ + +FN    D    + +FLLS++AGG GINL  A+ +++ D DW
Sbjct: 77  ACRIDGSMDNEVRQEQIGKFNSKTTDSHAND-VFLLSTRAGGLGINLTAADSVVIFDSDW 135

Query: 799 NPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           NP  D QA+ R  R GQ +   +YR     T+E  I  R   K  L   V+
Sbjct: 136 NPQVDLQAMDRTHRIGQDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLVI 186

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  117 bits (294), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 146/304 (48%), Gaps = 35/304 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKT+Q IAL+  L  +    GP         +I+ P+S++ NW  E  ++  
Sbjct: 693 ILADEMGLGKTIQTIALLAYLACEKENWGPH--------LIIVPTSVLLNWEMEFKRF-- 742

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
                  A   K  S         E  + W +    +    V I SY  +  +    +  
Sbjct: 743 -------APGFKVLSYYGSPQQRKEKRRGWNKLDAFH----VCITSYQLVVHDQHSFKRK 791

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-- 549
           +   ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+++E ++LL F  P    
Sbjct: 792 KWQYMILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFLMPQTAL 851

Query: 550 -------LGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDI 602
                      + F++ F  P+ +   A+ +++D ++  + +  L  ++  +++RR    
Sbjct: 852 ENGKISGFADLDAFQQWFGKPVDKIIAANDSEHDDET-RRTVSKLHQVLRPYLLRRLKAD 910

Query: 603 LSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHP 662
           + K +P KYEH+++  L+  Q+ +Y+  +     K  +        +  +  L+K+CNHP
Sbjct: 911 VEKQMPAKYEHILYCRLSKRQRFLYDDFMSRAQTKATLASGNFMSIINCLMQLRKVCNHP 970

Query: 663 DLIK 666
           DL +
Sbjct: 971 DLFE 974

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 94/171 (54%), Gaps = 4/171 (2%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L   L ++K E   + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1217 GKLQSLAVLLRRLKEEGH-RALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1275

Query: 759  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1276 TERFNTDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1333

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
            D  IYRF S  TIE  I ++ + K  L + V+   E     FS  +++ L 
Sbjct: 1334 DVHIYRFASEHTIESNILKKANQKRQLDNIVIQKGEFTTDYFSRLSVKDLL 1384

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 96/171 (56%), Gaps = 4/171 (2%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L   L ++K +   + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1178 GKLQKLAILLQQLK-DGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLDGATKIEDRQIL 1236

Query: 759  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
             +RFN DP+    +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1237 TERFNSDPKIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1294

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
            D  IYRF+S  TIE  I ++ + K  L   ++   E     FS  +++ LF
Sbjct: 1295 DVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEFTTDYFSKLSVKDLF 1345

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/307 (27%), Positives = 146/307 (47%), Gaps = 40/307 (13%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 650 ILADEMGLGKTIQTISLLSYLACEKHNWGPH--------LIVVPTSVLLNWEMEFKRF-- 699

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
                  A   K  +         E  K W +    +    V I+SY  + ++    +  
Sbjct: 700 -------APGFKVLTYYGNPQQRKEKRKGWNKPDAFH----VCIVSYQLIVQDQHSFKRK 748

Query: 492 EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-- 549
           +   ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+++E ++LL F  P    
Sbjct: 749 KWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVI 808

Query: 550 -------LGTRNEFRRNFEIPILRSRDADAT---DNDVKSGEQKLQLLSNIVSKFIIRRT 599
                      + F++ F  P+ +  +   T   DN+ K   +KL     ++  +++RR 
Sbjct: 809 DGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLH---QVLRPYLLRRL 865

Query: 600 NDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLC 659
              + K +P KYEH+++  L+  Q+ +Y+  +     K  +        +  +  L+K+C
Sbjct: 866 KADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVC 925

Query: 660 NHPDLIK 666
           NHPDL +
Sbjct: 926 NHPDLFE 932

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 88/310 (28%), Positives = 146/310 (47%), Gaps = 38/310 (12%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K+L    +
Sbjct: 728  ILADEMGLGKTVQSISVLAHL----AENHNIWGPFLVVTPASTLHNWVNEISKFLPQFKI 783

Query: 436  SPLAVDGKKSSLASGATSVAEAIKNWAQAQGR---NIVKPVLIISYDTLRRNVKQLQNTE 492
             P   +     +           K W +   R   N    V++ SY  +  +   LQ  +
Sbjct: 784  LPYWGNANDRKVLR---------KFWDRKNLRYNKNAPFHVMVTSYQMVVTDANYLQKMK 834

Query: 493  VGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGT 552
               ++ DE   +K+  S  +  L S +C  R++L+GTPIQN + E +ALL+F  P L  +
Sbjct: 835  WQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDS 894

Query: 553  RNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYE 612
             +EF   F   I    +A     + K  +Q+L+ L  I+  F++RR    +   L  K E
Sbjct: 895  HDEFNEWFSKDIESHAEA-----NTKLNQQQLRRLHMILKPFMLRRVKKNVQSELGDKIE 949

Query: 613  HVIFVNLTPFQKQVYNMLIKSR------DIKKVVKGDGGSQP----------LKAIGVLK 656
              +  +LT  Q ++Y +L KS+       I+     D  S            + A+   +
Sbjct: 950  IDVLCDLTQRQAKLYQVL-KSQISTNYDAIENAATNDSTSNSASNSGSDQNLINAVMQFR 1008

Query: 657  KLCNHPDLIK 666
            K+CNHPDL +
Sbjct: 1009 KVCNHPDLFE 1018

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 89/156 (57%), Gaps = 4/156 (2%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L K+K+E   ++++    T+ +DL+E     R Y  +RLDG+  +  R+ 
Sbjct: 1298 SAKLRKLDELLVKLKSEGH-RVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1356

Query: 758  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
            LV D   +PE   F+FLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1357 LVHDWQTNPEI--FVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1414

Query: 817  KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAK 852
            +   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1415 RQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1450

>Scas_646.3*
          Length = 1456

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 89/152 (58%), Gaps = 4/152 (2%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L + L  +K ++  + ++ +  T+ LD++ER      Y  +RLDG   +  RQ L
Sbjct: 1189 GKLQKLAKLLQDLK-DNGHRALIFTQMTKVLDVLERFLNYHGYIYMRLDGATKVEDRQIL 1247

Query: 759  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1248 TERFNNDPRVT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1305

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            D  IYRF+S  TIE  I ++ + K  L + V+
Sbjct: 1306 DVHIYRFVSEHTIESNILKKANQKRQLDNVVI 1337

 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 145/305 (47%), Gaps = 36/305 (11%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWL- 430
           I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 666 ILADEMGLGKTIQTISLLAYLACEKQNWGPH--------LIVVPTSVLLNWEMEFKRFCP 717

Query: 431 GPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQN 490
           G   L+      ++           E  K W +    +    V I+SY  + ++    + 
Sbjct: 718 GLKVLTYYGSPQQRK----------EKRKGWNKPDAFH----VCIVSYQLVVQDQHSFKR 763

Query: 491 TEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL- 549
            +   ++ DE H +KN  S  + AL + N  RR++++GTP+QN+L+E ++LL F  P   
Sbjct: 764 KKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLYFLMPQTV 823

Query: 550 --------LGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTND 601
                       + F++ F  P+ +  +  A        ++ +  L  ++  +++RR   
Sbjct: 824 IDGKKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPYLLRRLKA 883

Query: 602 ILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNH 661
            + K +P KYEH+++  L+  Q+ +Y+  +     K  +        +  +  L+K+CNH
Sbjct: 884 DVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSRSQTKATLASGNFMSIVNCLMQLRKVCNH 943

Query: 662 PDLIK 666
           PDL +
Sbjct: 944 PDLFE 948

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 98/156 (62%), Gaps = 1/156 (0%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            SGK   L++ L  I  +  +K+++ + +TQ LD++E++    +Y  +RLDG+  +N RQ 
Sbjct: 948  SGKVDALKKLLDDIINKKREKVLIFTLFTQVLDILEKVLSTLNYKFLRLDGSTQVNDRQT 1007

Query: 758  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
            ++D+F D +    IF+LS++AGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 MIDKFYD-DNTIPIFMLSTRAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKE 853
            +  +   I+  +IEEKI+Q    K++L S V  +++
Sbjct: 1067 EVTVTTLITKDSIEEKIFQLAKTKLALDSQVSSSED 1102

 Score =  103 bits (256), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 124/266 (46%), Gaps = 29/266 (10%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
            CI+AD+MGLGKT Q I+ +  L + G     LI     V PSS + NW  E  K+    
Sbjct: 592 SCILADDMGLGKTCQVISFLAYLKQIGQPSPHLI-----VVPSSTLENWLREFQKFCPSL 646

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRN---VKQLQ 489
            + P    G +   A           +  +   RN  K  V++ +Y+    N   V  L+
Sbjct: 647 KIEPYY--GTQQERA-----------DLREILERNDGKYDVIVTTYNLAAGNKYDVSFLK 693

Query: 490 NTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 549
                +++ DEGH LKN  S  F  L  I+   R++L+GTP+QN+L E  +LL F  P L
Sbjct: 694 TRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLKELMSLLEFIMPNL 753

Query: 550 LGTRNEFRRNFEIPILRSRDADATDNDVKS---GEQKLQLLSNIVSKFIIRRTNDILSKY 606
             ++ E        + + R   + DN   +    +Q +     ++  FI+RR  D + K+
Sbjct: 754 FVSKKESL----AAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFILRRRKDQVLKH 809

Query: 607 LPCKYEHVIFVNLTPFQKQVYNMLIK 632
           LP K+    +  +   Q+++YN  +K
Sbjct: 810 LPAKHVRTSYCAMNDTQREIYNREVK 835

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 152/309 (49%), Gaps = 38/309 (12%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
            I+ADEMGLGKT+Q I+++  L     +   +    ++V P+S ++NW NE+ K++    +
Sbjct: 744  ILADEMGLGKTVQSISVLAHL----AEHHNIWGPFLVVTPASTLHNWVNEISKFVPQFKI 799

Query: 436  SPLAVDGKKSSLASGATSVAEAIKN-WAQAQGRNIVKP---VLIISYDTLRRNVKQLQNT 491
             P            G+ +  + ++  W +   R   K    V+I SY  +  +   LQ  
Sbjct: 800  LPYW----------GSANDRKVLRKFWDRKNLRYSEKSPFHVMITSYQMVVADASYLQKM 849

Query: 492  EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLG 551
            +   ++ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P L  
Sbjct: 850  KWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPSLFD 909

Query: 552  TRNEFRRNFEIPILRSRDADA-TDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCK 610
            + +EF   F      SRD ++  + +    +Q+L+ L  I+  F++RR    +   L  K
Sbjct: 910  SHDEFNEWF------SRDIESHAEGNSSLNQQQLRRLHMILKPFMLRRIKKNVQSELGDK 963

Query: 611  YEHVIFVNLTPFQKQVYNMLIK--SRDIKKV---------VKGDGGSQP--LKAIGVLKK 657
             E  +  +LT  Q ++Y +L    S +   +         + G G S    + A+   +K
Sbjct: 964  IEIDVMCDLTQRQTKLYQVLKSQMSSNYDAIENAAAEGSDIAGGGNSDQSIINAVMQFRK 1023

Query: 658  LCNHPDLIK 666
            +CNHPDL +
Sbjct: 1024 VCNHPDLFE 1032

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 90/156 (57%), Gaps = 4/156 (2%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L ++K ++D ++++    T+ +DL+E     R Y  +RLDG+  +  R+ 
Sbjct: 1294 SAKLKKLDELLVELK-KNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRD 1352

Query: 758  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
            LV D   +PE   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1353 LVHDWQTNPEI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1410

Query: 817  KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAK 852
            K   +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1411 KQVTVYRLLVRGTIEERMRDRAKQKEQVQQVVMEGK 1446

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 99/163 (60%), Gaps = 1/163 (0%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            SGK   L++ L  I  +  +K+++ S +TQ LD++E +     Y  +RLDG+  +N RQ 
Sbjct: 948  SGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVNDRQL 1007

Query: 758  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
            L+D+F + +    IF+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 1008 LIDKFYEDKDIP-IFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTK 1066

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFS 860
            +  I   I+  +IEEKI+Q    K++L S + + K+  + L S
Sbjct: 1067 EVNITTLITKDSIEEKIHQLAKNKLALDSYISEDKKSQDVLES 1109

 Score =  111 bits (278), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 129/266 (48%), Gaps = 29/266 (10%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
            CI+AD+MGLGKT Q I+    L +    G  L+     V PSS + NW  E  K+    
Sbjct: 592 SCILADDMGLGKTCQVISFFAYLKQINEPGPHLV-----VVPSSTLENWLREFQKFAPAL 646

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK-PVLIISYDTLRRN---VKQLQ 489
            + P            G+    E +++  +   RN  K  V++ +Y+    N   V  L+
Sbjct: 647 KIEPYY----------GSLQEREELRDILE---RNAGKYDVIVTTYNLAAGNKYDVSFLK 693

Query: 490 NTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL 549
           N    +++ DEGH LKN  S  F  L  I    R++L+GTP+QN+L E  +LL F  P L
Sbjct: 694 NRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNL 753

Query: 550 LGTRNEFRRNFEIPILRSRDADATDNDVKS---GEQKLQLLSNIVSKFIIRRTNDILSKY 606
             ++ E   +F+  I + R     DN   +    ++ +     ++  FI+RR  D + K+
Sbjct: 754 FISKKE---SFD-AIFKQRAKTTDDNKNHNPLLAQEAITRAKTMMKPFILRRRKDQVLKH 809

Query: 607 LPCKYEHVIFVNLTPFQKQVYNMLIK 632
           LP K+ H+ +  L   QK++Y+  I+
Sbjct: 810 LPPKHTHIQYCELNAIQKKIYDKEIQ 835

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  115 bits (288), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/258 (31%), Positives = 134/258 (51%), Gaps = 21/258 (8%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTL 435
           I+ADEMGLGKT+Q IAL+  +     +G  L++      P S ++NW NE  K+  P+ L
Sbjct: 244 ILADEMGLGKTVQSIALLAFIYEMDTKGPFLVT-----APLSTLDNWMNEFAKF-APD-L 296

Query: 436 SPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGL 495
             L   G      +G    +  +KN+ +  G      ++I SY+ + R+   + +     
Sbjct: 297 PVLKYYG-----TNGYKERSAKLKNFFKQHGGT---GIVITSYEIILRDTDLIMSQNWKF 348

Query: 496 LLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNE 555
           L+ DEGHRLKN +      L  IN   R++L+GTP+QN+L+E ++LLNF  P +      
Sbjct: 349 LIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFADFEI 408

Query: 556 FRRNFEIPILRSRDADATD--NDVKSGEQKLQLLSN---IVSKFIIRRTND-ILSKYLPC 609
           F + F+   L       ++  N + + E +  L+SN   I+  F++RR    +L+  LP 
Sbjct: 409 FNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANILPP 468

Query: 610 KYEHVIFVNLTPFQKQVY 627
           K E++I   +T  Q++ Y
Sbjct: 469 KREYIINCPMTSAQEKFY 486

 Score =  115 bits (287), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 95/167 (56%), Gaps = 1/167 (0%)

Query: 683 YSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYA 742
           Y  P   + +   + SGK  IL++ +  + +E   K+++ S +   LDLIE  C    +A
Sbjct: 587 YLHPEDLTLETLLKTSGKLQILQKLIPPLISEGH-KVLIYSQFVNMLDLIEDWCDLNSFA 645

Query: 743 SVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 802
           + R+DG+++   R+  +++FN  + +  IFLLS++A G GINL+GA+ ++L D DWNP  
Sbjct: 646 TFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQV 705

Query: 803 DQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
           D QA+ R  R GQ+    +YR     TIE  I  R + K +L   V+
Sbjct: 706 DLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVI 752

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p DNA
            helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 96/170 (56%), Gaps = 2/170 (1%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L   L ++K ++  + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1246 GKLQKLAILLQQLK-DNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQIL 1304

Query: 759  VDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKD 818
             +RFN  + +  +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +D
Sbjct: 1305 TERFN-TDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRD 1363

Query: 819  CFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
              IYRF+S  TIE  I ++ + K  L + V+   +     FS  ++R L 
Sbjct: 1364 VHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLL 1413

 Score =  115 bits (288), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 79/304 (25%), Positives = 142/304 (46%), Gaps = 34/304 (11%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
            I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 718  ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEFKRF-- 767

Query: 432  PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
                   A   K  +         E  K W +    +    V I+SY  + ++    +  
Sbjct: 768  -------APGFKVLTYYGSPQQRKEKRKGWNKPDAFH----VCIVSYQLVVQDQHSFKRK 816

Query: 492  EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-- 549
                ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P    
Sbjct: 817  RWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVI 876

Query: 550  -------LGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDI 602
                       + F++ F  P+ +  +        K  ++ +  L  ++  +++RR    
Sbjct: 877  DGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKAD 936

Query: 603  LSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHP 662
            + K +P KYEH+++  L+  Q+ +Y+  +     K  +        +  +  L+K+CNHP
Sbjct: 937  VEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHP 996

Query: 663  DLIK 666
            +L +
Sbjct: 997  NLFE 1000

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  115 bits (288), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 153/308 (49%), Gaps = 41/308 (13%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
            I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ +++ 
Sbjct: 768  ILADEMGLGKTVQSISVLAHLADRYNIWGP--------FIVVTPASTLHNWVNEISRFVP 819

Query: 432  PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQ---GRNIVKPVLIISYDTLRRNVKQL 488
               + P             A       K W +     GR+    V++ SY  +  +   L
Sbjct: 820  QFKILPYW---------GNANDRKTLRKFWDRKHLRYGRDAPFHVMVTSYQMVVSDASYL 870

Query: 489  QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548
            Q  +   ++ DE   +K+  S  +  L S +C  R++L+GTPIQN++ E +ALL+F  P 
Sbjct: 871  QKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTPIQNNMQELWALLHFIMPS 930

Query: 549  LLGTRNEFRRNFEIPILRSRDADA-TDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYL 607
            L  + +EF   F      S+D ++  +++ +  +++L+ L  ++  F++RR    +   L
Sbjct: 931  LFDSHDEFSDWF------SKDIESHAESNTELNQEQLRRLHMVLKPFMLRRIKKNVQSEL 984

Query: 608  PCKYEHVIFVNLTPFQKQVYNMLIKSR------DIKKVVKGDGGSQPLKAIGVL---KKL 658
              K E  +  +LT  Q ++Y +L KS+       I+     D  +   K + ++   +K+
Sbjct: 985  GDKIEIDVLCDLTFRQAKLYQVL-KSQVSGGYDAIENAAGNDDVTSDQKLVNLVMEFRKV 1043

Query: 659  CNHPDLIK 666
            CNHPDL +
Sbjct: 1044 CNHPDLFE 1051

 Score =  115 bits (287), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 97/168 (57%), Gaps = 6/168 (3%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L K+K E D ++++    T+ +DL+E     R Y  +RLDG+  ++ R+ 
Sbjct: 1318 SAKLKKLDELLVKLK-EEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRD 1376

Query: 758  LV-DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
            LV D    P+   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ 
Sbjct: 1377 LVHDWQTKPDI--FIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQT 1434

Query: 817  KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD--AKEDVERLFSVD 862
            +   +YR +  GTIEE++  R   K  +   V++  AKE+ +++  V+
Sbjct: 1435 RQVTVYRLLIRGTIEERMRDRAKQKEHVQQVVMEGKAKENKQKIIEVE 1482

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 142/304 (46%), Gaps = 34/304 (11%)

Query: 376  IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
            I+ADEMGLGKT+Q I+L+  L  +    GP         +IV P+S++ NW  E  ++  
Sbjct: 787  ILADEMGLGKTIQTISLLAYLACEKENWGPH--------LIVVPTSVLLNWEMEFKRF-- 836

Query: 432  PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNT 491
                   A   K  +         E  K W +    +    V I SY  +  +    +  
Sbjct: 837  -------APGFKVLTYYGSPQQRREKRKGWNKPDAFH----VCITSYQLVVHDQHSFKRK 885

Query: 492  EVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGL-- 549
            +   ++ DE H +KN  S  + AL + N  RR++L+GTP+QN+L+E ++LL F  P    
Sbjct: 886  KWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAELWSLLYFLMPQTAL 945

Query: 550  -------LGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDI 602
                       + F++ F  P+ +  +        +  ++ +  L  ++  +++RR    
Sbjct: 946  ENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLHQVLRPYLLRRLKAD 1005

Query: 603  LSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHP 662
            + K +P KYEH+I+  L+  Q+ +Y+  +     K+ +        +  +  L+K+CNHP
Sbjct: 1006 VEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRAQTKETLASGNFMSIINCLMQLRKVCNHP 1065

Query: 663  DLIK 666
            DL +
Sbjct: 1066 DLFE 1069

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 89/152 (58%), Gaps = 4/152 (2%)

Query: 699  GKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKL 758
            GK   L + L  +K ++  + ++ +  T+ LD++E+      Y  +RLDG   I  RQ L
Sbjct: 1310 GKLQKLAQLLQNLK-DNGHRALIFTQMTKVLDILEQFLNFHGYLYMRLDGATKIEDRQIL 1368

Query: 759  VDRFN-DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
             +RFN DP     +F+LSS++GG GINL GA+ +I  D DWNPA D+Q   R  R GQ +
Sbjct: 1369 TERFNSDPRIT--VFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTR 1426

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVV 849
            D  IYRF+S  TIE  I ++ + K  L + V+
Sbjct: 1427 DVHIYRFVSDHTIESNILKKANQKRHLDNVVI 1458

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 151/315 (47%), Gaps = 48/315 (15%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ----GPQGKRLISKCIIVCPSSLVNNWANELVKWLG 431
           I+ADEMGLGKT+Q I+++  L  +    GP         I+V P+S ++NW NE+ K++ 
Sbjct: 677 ILADEMGLGKTVQSISVLAHLAERYNIWGP--------FIVVTPASTLHNWVNEIQKFVP 728

Query: 432 PNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGR---NIVKPVLIISYDTLRRNVKQL 488
              + P   +G    +           + W +   R   +    V+I SY  +  +   L
Sbjct: 729 DFKILPYWGNGNDRKILR---------RFWDRKHLRYSKDAPFHVMITSYQMIVSDAAYL 779

Query: 489 QNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 548
           Q  +   ++ DE   +K+  S  +  L S +C  R++L+GTPIQN + E +ALL+F  P 
Sbjct: 780 QKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPS 839

Query: 549 LLGTRNEFRRNFEIPILRSRDADA-TDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYL 607
           L  + +EF   F      S+D ++   ++ +  +Q+L+ L  I+  F++RR    +   L
Sbjct: 840 LFDSHDEFNDWF------SKDIESHAQSNTQLNQQQLRRLHMILKPFMLRRIKKNVQSEL 893

Query: 608 PCKYEHVIFVNLTPFQKQVYNMLIKSR------DIKKVVKGDGG----------SQPLKA 651
             K E  +  +LT  Q ++Y +L KS+       I+       G          S+ +  
Sbjct: 894 GDKIEIDVMCDLTHRQAKLYQVL-KSQVSASYDAIENAASNSSGDDSGNMSLSDSKIMNT 952

Query: 652 IGVLKKLCNHPDLIK 666
           +   +K+CNHPDL +
Sbjct: 953 VMEFRKVCNHPDLFE 967

 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 86/155 (55%), Gaps = 2/155 (1%)

Query: 698  SGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQK 757
            S K   L+  L ++K   + ++++    T+ +DLIE     R Y  +RLDG+  +  R+ 
Sbjct: 1239 SAKLKKLDELLVRLKA-GEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRD 1297

Query: 758  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 817
            LV  +   +   FIFLLS++AGG GINL  A+ +I  D DWNP  D QA+ R  R GQ K
Sbjct: 1298 LVHDWQ-TKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTK 1356

Query: 818  DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAK 852
               +YR +  GTIEE++  R   K  +   V++ K
Sbjct: 1357 QVTVYRLLIKGTIEERMRDRAKQKEHVQQVVMEGK 1391

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 90/147 (61%), Gaps = 4/147 (2%)

Query: 715  SDDKIVLISNYTQTLDLIERMCRN-RHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFL 773
            +D+K+++ S +T   D+++   +   + + +R DGTM+ N R  +++RF   E  E + L
Sbjct: 1417 TDEKLIVFSQFTTFFDILQFFIKKVLNVSYLRYDGTMNGNVRASVIERFYR-EKNERLLL 1475

Query: 774  LSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEK 833
            +S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q+++ +I+R +   TIE++
Sbjct: 1476 ISMKAGNSGLTLTCANHVILVDPFWNPYVEEQAMDRCYRISQQREVYIHRLLLKNTIEDR 1535

Query: 834  IYQRQSMKMSLSSCVVDAKE--DVERL 858
            I + Q+ K +L    +D  E  +V RL
Sbjct: 1536 IVELQNRKRTLVENAMDPTELREVNRL 1562

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 79/332 (23%), Positives = 140/332 (42%), Gaps = 50/332 (15%)

Query: 374  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC---IIVCPSSLVNNWANELVKWL 430
            G ++AD+MGLGKT+Q IALM          +   S C   ++V P +++  W +E+   +
Sbjct: 917  GGLLADDMGLGKTVQAIALMLA-------NRSADSTCKTNLVVGPVAVLRVWHDEINTKV 969

Query: 431  GPNTLSPLAV----DGKKSS-----------LASGATSVAEAIKNW-AQAQGRNIVKPVL 474
                   + +     GKK             L S  T   E  K+W A+ QG +     L
Sbjct: 970  KKQAQFSVMIYGGFGGKKVENFKAMHNYDVVLVSYQTLAVEFKKHWPARLQGTSENGGQL 1029

Query: 475  IISYDTLRRNVKQLQN----------TEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
                     N  +L+N          +    ++ DE   +KN  +    A  ++N   R 
Sbjct: 1030 PEVASIKAMNSMKLRNEYWSPFFSDDSNFYRIILDEAQNIKNKQTQAAKACCTLNGTYRW 1089

Query: 525  ILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKL 584
             LSGTPIQN++ E ++LL F          +F+ +    +L SR  D    D K   +K+
Sbjct: 1090 ALSGTPIQNNILELYSLLRFLRIAPYNREQKFKEDIGNALL-SRGGDFDSMDTKRALKKV 1148

Query: 585  QLLSNIVSKFIIRRTN----------DILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSR 634
            ++L   +   ++RR            ++ +K++  K + +   +L  ++   +   I++R
Sbjct: 1149 RVL---LRAIMLRRAKTSQINGQPILELPAKHIRKKEDILDGQDLEFYKSLEHETAIQAR 1205

Query: 635  DIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIK 666
             +    K    S  L  +  L++ C H +L+K
Sbjct: 1206 ALLNERKASSSSNILTLLLRLRQACCHQELVK 1237

>Kwal_47.17771
          Length = 972

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 91/158 (57%), Gaps = 6/158 (3%)

Query: 717 DKIVLISNYTQTLDLIE---RMCRNRHYASV-RLDGTMSINKRQKLVDRFNDPEGQEF-I 771
           ++IV+ S ++  LD+IE     C ++    V + DG +S+ +R K++  F   +     I
Sbjct: 816 EQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERSKVLQDFAVKDMTRLKI 875

Query: 772 FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
            LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ R+ R GQ  +  + RFI   +IE
Sbjct: 876 LLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQVNNVKVVRFIIEHSIE 935

Query: 832 EKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
           EK+ + Q  K +L    VDA ED  R   ++ ++ LF+
Sbjct: 936 EKMLRIQERKRTLGEA-VDADEDERRKRRIEEIKMLFE 972

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 120/302 (39%), Gaps = 73/302 (24%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC----------------------- 410
           G I+ADEMGLGKT+  +A++ T+      GK  + +                        
Sbjct: 335 GGILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYA 394

Query: 411 ----IIVCPSSLVNNWANELVK-----------WLGPNTLSPLAVDGK-KSSLASGATSV 454
               ++V P SL++ W  E  K           + G NT S  ++  K KS      T+ 
Sbjct: 395 SGTTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNTSSLKSLLTKTKSPPTVLITTY 454

Query: 455 AEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTA 514
                 W++   +N            +  +V  L + E   ++ DEGH ++N ++ T  +
Sbjct: 455 GTVQHEWSRLLNKN----------GQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRS 504

Query: 515 LDSINCPRRVILSGTPIQNDLSEYFALLNF------SNPGLLGT-------RNEFRRNFE 561
           L  +   R  IL+GTPI N L + ++L+ F      S  G   T       +  ++  F+
Sbjct: 505 LMDLKSTRSWILTGTPIINRLDDLYSLVKFMRLEPWSQIGYWKTFVSDPFEKKNYKAAFD 564

Query: 562 I------PILRSRDADATDNDVKSGEQKLQLLSN--IVSKFIIRRTNDILSKYLPCKYEH 613
           I      P++  R     D D   G++ ++L     I+ K    +  D L KY   K E 
Sbjct: 565 IVSSILEPVILRRTKGMRDVD---GKRLVELPPKEVIIEKVAFNKNEDALYKYFLNKAES 621

Query: 614 VI 615
            +
Sbjct: 622 SV 623

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 87/160 (54%), Gaps = 6/160 (3%)

Query: 695  TQFSGKFAILERFL-HKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASV----RLDGT 749
            T+ S K   L R L H   T +++++V+ S ++  LD++E   R    + +    + DG 
Sbjct: 906  TKKSSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGR 965

Query: 750  MSINKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALA 808
            + + +R  ++ +F +    +  + LLS KAGG G+NL  A+   +MDP W+P  + QA+ 
Sbjct: 966  LDLKERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMD 1025

Query: 809  RVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848
            R+ R GQ     IYRFI   +IEEK+ + Q  K SL   V
Sbjct: 1026 RIHRIGQSNTVKIYRFIVENSIEEKMLRIQEKKRSLGEFV 1065

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 111/265 (41%), Gaps = 60/265 (22%)

Query: 374 GCIMADEMGLGKTLQCIAL----------MWTLLRQGPQGKRL-------------ISKC 410
           G I+ADEMGLGKT+  +AL          + T  ++ P    L              S  
Sbjct: 455 GGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTT 514

Query: 411 IIVCPSSLVNNWANELVK-----------WLGPNT--LSPLAVDGKKSSLASGATSVAEA 457
           +IV P SL+  W NE V+           +   N   L  L V  +KS  +   T+    
Sbjct: 515 LIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLVK-QKSPPSVVLTTYGVV 573

Query: 458 IKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDS 517
              W++ Q            +D    N + L + E   ++ DEGH ++N  + T  A+ +
Sbjct: 574 QTEWSKLQ-----------QFDYEASN-EGLFSVEFFRIILDEGHNIRNRTTKTSKAVMA 621

Query: 518 INCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDV 577
           +   R+ +L+GTPI N L + F+L+ F N         F    +I   R   +D  +   
Sbjct: 622 LTSRRKWVLTGTPIMNRLDDLFSLIKFMN---------FEPWCKIDYWRQFVSDPFEK-- 670

Query: 578 KSGEQKLQLLSNIVSKFIIRRTNDI 602
           K     L+++  ++   ++RRT ++
Sbjct: 671 KDYSSALEVIQAVMGPILLRRTKNM 695

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 99/178 (55%), Gaps = 9/178 (5%)

Query: 699  GKFAILERFLHKIKTES-DDKIVLISNYTQTLDLIERMCRNRHYASVRL-----DGTMSI 752
             K   L R L +++  S  +++V+ S ++  LD++E    N  Y+S +L     DG +S+
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQL-NEVYSSNKLKVYKFDGRLSL 1033

Query: 753  NKRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 811
             +R  +++ F   +   + + LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ 
Sbjct: 1034 KERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIH 1093

Query: 812  RDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
            R GQ     + RF+  G+IEEK+ + Q  K +L    +D  ED  R   ++ ++ LF+
Sbjct: 1094 RIGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEA-MDTDEDERRKRRIEEIQMLFE 1150

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 89/213 (41%), Gaps = 55/213 (25%)

Query: 374 GCIMADEMGLGKTLQCIALMW-----------TLLRQG--------------PQGKRLIS 408
           G I++DEMGLGKT+  ++L+            +L  Q               P+      
Sbjct: 508 GGILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAYK 567

Query: 409 KCIIVCPSSLVNNWANELVK-----------WLGPNTLSPLAVDGKKSSLASGATSVAEA 457
             +I+ P SL+  W +E  K           + G N  S  ++  K+ +  +   +    
Sbjct: 568 TTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTVVLTTYGI 627

Query: 458 IKN-WAQAQG-----RNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLT 511
           ++N W +        R++ +   I S +  R             ++ DEGH ++N  ++T
Sbjct: 628 VQNEWTKLSKDGTNIRSLGRTSGIFSIEFFR-------------IILDEGHTIRNKSTIT 674

Query: 512 FTALDSINCPRRVILSGTPIQNDLSEYFALLNF 544
             A+  ++   R IL+GTPI N L + ++L+ F
Sbjct: 675 SKAVLELSSKYRWILTGTPIINRLDDLYSLVKF 707

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 98/178 (55%), Gaps = 7/178 (3%)

Query: 698  SGKFAILERFLHKIK-TESDDKIVLISNYTQTLDLIERMCRNR----HYASVRLDGTMSI 752
            S K   L R L +I+ T   ++I++ S ++  LD++E   R+          + DG + +
Sbjct: 938  STKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRLDM 997

Query: 753  NKRQKLVDRFNDPEGQEF-IFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 811
             +R +++++F+D +     + LLS K GG G+NL  A+R  +MDP W+P  + QA+ R+ 
Sbjct: 998  KERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDRIH 1057

Query: 812  RDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
            R GQ++   + RFI   ++EEK+ + Q  K  L   +V+  E   R   ++ ++ LFQ
Sbjct: 1058 RIGQQQTVKVVRFIIDNSVEEKMLRIQERKRMLGD-IVEGDEAERRQKRIEEIQMLFQ 1114

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 89/347 (25%), Positives = 144/347 (41%), Gaps = 84/347 (24%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISK------------------------ 409
           G I+ADEMGLGKT+  +AL+ T        K++ S                         
Sbjct: 479 GGILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKH 538

Query: 410 -------CIIVCPSSLVNNWANELVK-----------WLGPNTLSPLAVDGKKSSLASGA 451
                   +IV P SL+N W +E  K           + G N       D +   L   A
Sbjct: 539 DTYAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNNI-----KDLRAYVLGPNA 593

Query: 452 TSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLT 511
            SV              I+    II  +  R +   L N     ++ DEGH ++N  + T
Sbjct: 594 PSV--------------IITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRT 639

Query: 512 FTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDAD 571
             A+ ++   R+ IL+GTPI N L + F+L+ F N       N ++R   +P  +   A 
Sbjct: 640 SKAVIALRSSRKWILTGTPIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYAQ 699

Query: 572 ATDNDVKSGEQKLQLLSNIVSKFIIRRT---NDILSK---YLPCKYEHVIFVNLTPFQKQ 625
           A D           +++ ++   ++RRT    D+  K    LP K   V  + L+  +K+
Sbjct: 700 AFD-----------VINAVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKR 748

Query: 626 VYNMLIKSRD--IKK-VVKGD---GGSQPLKAIGVLKKLCNHPDLIK 666
           VY  +++  +  +K+ + KGD     +  L  I  L+++C H DL+K
Sbjct: 749 VYQSMLEDAENSVKEGLAKGDLLKNYTNILVHILRLRQVCCHLDLLK 795

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 90/155 (58%), Gaps = 5/155 (3%)

Query: 708  LHKIKTESD-DKIVLISNYTQTLDLIERMCRNR-HYASVRLDGTMSINKRQKLVDRFNDP 765
            ++K+  +SD +KI++ S +T  LDL+E +   R   + ++  G M+   R +++ RF   
Sbjct: 1241 INKVFEKSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSE 1300

Query: 766  EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI 825
            E +  + L+S KAG  G+ L  AN ++++DP WNP  ++QA  R +R  Q ++  ++R  
Sbjct: 1301 EDKR-VLLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLF 1359

Query: 826  STGTIEEKIYQRQSMKMSLSSCVVDAK--EDVERL 858
               ++E++I + Q +K  +    +DAK  +D+ +L
Sbjct: 1360 IKNSVEDRILELQKLKRDMVDAAMDAKKIKDINKL 1394

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 91/207 (43%), Gaps = 53/207 (25%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
           G ++AD+MGLGKT+Q IALM    R   + K+     +IV P S++  W  E+   +  +
Sbjct: 754 GGLLADDMGLGKTVQAIALMLAN-RSSNESKKT---NLIVAPVSVLRVWKGEIETKIKES 809

Query: 434 TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTL------------ 481
           +    A+ G       G   +    ++W +    +    V+++SY TL            
Sbjct: 810 SDFNSAIYG-------GVNGIK--FRSWDKLSNFD----VILVSYQTLANELKKHWPERL 856

Query: 482 RRNVKQL------------------------QNTEVGLLLADEGHRLKNGDSLTFTALDS 517
           + + KQL                         ++    ++ DEG  +KN  +    A  +
Sbjct: 857 KTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQAAKACCT 916

Query: 518 INCPRRVILSGTPIQNDLSEYFALLNF 544
           +N   R ILSGTPIQN++ E ++L+ F
Sbjct: 917 VNSVYRWILSGTPIQNNMEELYSLIRF 943

>Scas_721.100
          Length = 1137

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 98/177 (55%), Gaps = 7/177 (3%)

Query: 699  GKFAILERFLHKIK-TESDDKIVLISNYTQTLDLIERMCRNRHYASV----RLDGTMSIN 753
             K + L + L  ++ + + +++V+ S ++  LD++E   +      V    + DG +S+ 
Sbjct: 962  AKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVAKIYKFDGRLSLK 1021

Query: 754  KRQKLVDRFNDPE-GQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWR 812
            +R  ++  F   +  ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R
Sbjct: 1022 ERSTVLQDFQIKDLSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRIHR 1081

Query: 813  DGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
             GQ  +  + RFI   +IEEK+ + Q  K ++    +DA ED  R   ++ ++ LF+
Sbjct: 1082 IGQTNNVKVVRFIIENSIEEKMLRIQERKRTIGEA-MDADEDERRKRRIEEIKMLFE 1137

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 90/205 (43%), Gaps = 44/205 (21%)

Query: 374 GCIMADEMGLGKTLQCIALMWTL----------LRQG---------PQGKRLISKC-IIV 413
           G I++DEMGLGKT+  +AL+ +           L +G         P  K   SK  +IV
Sbjct: 501 GGILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIV 560

Query: 414 CPSSLVNNWANELVKWLGPNTL-SPLAVDGKKSSLASGAT------SVAEAIKNWAQAQG 466
            P SL+N W  E  K    + + S +   G  SSL    T      +V        Q++ 
Sbjct: 561 VPMSLLNQWNTEFNKANNSSDMRSEIYYGGNVSSLKKLLTKTHNPPTVVITTYGIVQSEW 620

Query: 467 RNIVKPVLIISYDTLRRNVKQLQNTEVGL-------LLADEGHRLKNGDSLTFTALDSIN 519
             I K          ++N+     +  GL       ++ DEGH ++N  +LT  A+  + 
Sbjct: 621 SKIFK----------KQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLT 670

Query: 520 CPRRVILSGTPIQNDLSEYFALLNF 544
              + +L+GTPI N L + ++L+ F
Sbjct: 671 SKCKWVLTGTPIINRLDDLYSLVRF 695

>CAGL0K07766g 770935..773427 highly similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 DNA repair
           protein, start by similarity
          Length = 830

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 92/172 (53%), Gaps = 2/172 (1%)

Query: 698 SGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQ 756
           S K   L   L+K+++     K ++ S +T  LDL+E   +   + +V+L G+MS  +R 
Sbjct: 658 STKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRD 717

Query: 757 KLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQK 816
           + +  F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ 
Sbjct: 718 QTIKYFMDNIECE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQY 776

Query: 817 KDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
           +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 777 RPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAINRLTPADLQFLF 828

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 88/200 (44%), Gaps = 35/200 (17%)

Query: 359 LEALKKSQSNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSS 417
           LE L    S     Y G ++ADEMG+GKT+Q IAL+     + P         ++V P+ 
Sbjct: 230 LEGLHWMLSQEDSIYNGGVLADEMGMGKTIQTIALLMNDRSKKPS--------LVVAPTV 281

Query: 418 LVNNWANELVKWLGPNTLSPLAVDG----------KKSSLASGATSVAEAI---KNWAQA 464
            +  W NE+ +      LS     G          K   +     SV E++   +N+   
Sbjct: 282 ALMQWKNEIEQHTN-GALSTYIYHGASRTINIHDLKDIDVILTTYSVLESVFRKQNYGFR 340

Query: 465 QGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
           +   +VK   +            L N +    + DE H +K+  S T  A++++   +R 
Sbjct: 341 RKNGLVKEKSL------------LHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRW 388

Query: 525 ILSGTPIQNDLSEYFALLNF 544
            LSGTP+QN + E ++L+ F
Sbjct: 389 CLSGTPLQNRIGEMYSLIRF 408

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
           repair protein involved in G2 repair of inactive genes,
           component of the nucleotide excision repair factor four
           (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
           complex, has DNA helicase domain of Snf2p family [2373
           bp, 790 aa]
          Length = 790

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 93/174 (53%), Gaps = 2/174 (1%)

Query: 696 QFSGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINK 754
           Q S K   L   L+K+++     K ++ S +T  LDL+E   +   + +V+L G+MS  +
Sbjct: 616 QSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQ 675

Query: 755 RQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDG 814
           R + +  F +    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R G
Sbjct: 676 RDETIKYFMNNIQCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 734

Query: 815 QKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
           Q +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 735 QYRPVKITRFCIEDSIEARIIELQEKKANMIHATINQDEAAISRLTPADLQFLF 788

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 98/202 (48%), Gaps = 35/202 (17%)

Query: 359 LEALKKSQSNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSS 417
           LE L    S     Y G ++ADEMG+GKT+Q IAL+   L + P         ++V P+ 
Sbjct: 189 LEGLHWLISQEESIYAGGVLADEMGMGKTIQTIALLMNDLTKSPS--------LVVAPTV 240

Query: 418 LVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLII- 476
            +  W NE+ +    +T   L +      +  GA+   + IK+    QG ++V     + 
Sbjct: 241 ALMQWKNEIEQ----HTKGQLKI-----YIYHGASRTTD-IKD---LQGYDVVLTTYAVL 287

Query: 477 -------SYDTLRRN--VKQ---LQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRV 524
                  +Y   R+N   KQ   L N +   ++ DE H +K+  S T  A++++   +R 
Sbjct: 288 ESVFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNLKTQKRW 347

Query: 525 ILSGTPIQNDLSEYFALLNFSN 546
            LSGTP+QN + E ++L+ F N
Sbjct: 348 CLSGTPLQNRIGEMYSLIRFLN 369

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
           (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 88/167 (52%), Gaps = 1/167 (0%)

Query: 702 AILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDR 761
           A+LE   +   +    K ++ S +T  LDL+E   +   + + +L G+M+  +R + ++ 
Sbjct: 579 ALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPTQRAETINY 638

Query: 762 FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 821
           F D    E +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I
Sbjct: 639 FMDNVHCE-VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQHRPVKI 697

Query: 822 YRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
            RF    +IE +I + Q  K ++    +   E      +  +L+ LF
Sbjct: 698 TRFCIEDSIESRIIELQEKKANMIHATLGQDEGAVNRLTPADLQFLF 744

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 88/188 (46%), Gaps = 27/188 (14%)

Query: 366 QSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANE 425
           Q NN    G ++ADEMG+GKT+Q I+L+     +GP         ++V P+  +  W NE
Sbjct: 156 QENNERYRGGVLADEMGMGKTVQMISLLLHA-NKGPT--------LVVAPTVALIQWKNE 206

Query: 426 LVKWLGPNTLSPLAVDGKKSSLASGATSVAEAI-KNWA--------QAQGRNIVKPVLII 476
           + K+ G   L  L   G   S  S   + A+ +   +A        Q QG      V+  
Sbjct: 207 IDKYTG-GALRSLVFHGPGRSAVSEELAAADVVLTTYAVLESVYRKQTQGFRRKAGVV-- 263

Query: 477 SYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLS 536
                 R    L   +   ++ DE H +K+  S T  +++++   RR  L+GTP+QN + 
Sbjct: 264 ------REQSPLHAVDFYRVVLDEAHNIKDRSSGTARSVNALRAVRRWCLTGTPLQNRIG 317

Query: 537 EYFALLNF 544
           E ++L+ F
Sbjct: 318 EMYSLIRF 325

>Kwal_23.3660
          Length = 768

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 718 KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 777
           K ++ S +T  LDL+E   +   + +V+L G+M+  +R + +  F D    E +FL+S K
Sbjct: 617 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMDNTHCE-VFLVSLK 675

Query: 778 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQR 837
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 676 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIEL 735

Query: 838 QSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
           Q  K ++    ++  +      +  +L+ LF
Sbjct: 736 QEKKANMIHATINQDDAAINRLTPGDLQFLF 766

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 86/189 (45%), Gaps = 9/189 (4%)

Query: 359 LEALKKSQSNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSS 417
           LE L    S     Y G ++ADEMG+GKT+Q IAL+   + + P         ++V P+ 
Sbjct: 167 LEGLHWLISQEHSVYNGGVLADEMGMGKTIQTIALLMNDVTKKPS--------LVVAPTV 218

Query: 418 LVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIIS 477
            +  W NE+ +  G    + +     ++S       V   +  +A  +     +      
Sbjct: 219 ALMQWKNEIEQHTGGKLKTHIFHGANRTSNVGEFKDVDVLLTTYAVLESVFRKQNYGFKR 278

Query: 478 YDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSE 537
              + +    L N     ++ DE H +K+  S T  A++S+   ++  L+GTP+QN + E
Sbjct: 279 KSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTEKKWCLTGTPLQNRIGE 338

Query: 538 YFALLNFSN 546
            ++L+ F N
Sbjct: 339 MYSLIRFLN 347

>Scas_591.10
          Length = 772

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 95/175 (54%), Gaps = 4/175 (2%)

Query: 696 QFSGKFAILERFLHKIKTESDD-KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINK 754
           Q S K   L   L+K+++     K ++ S +T  LDL+E   +   + +V+L G+MS  +
Sbjct: 598 QSSTKIEALVEELYKLRSPVRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQ 657

Query: 755 RQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRD 813
           R + +  F N+ E +  +FL+S KAGG  +NL  A+++ ++DP WNP+ + Q+  RV R 
Sbjct: 658 RDETIKYFMNNIECE--VFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 715

Query: 814 GQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
           GQ +   I RF    +IE +I + Q  K ++    ++  E      +  +L+ LF
Sbjct: 716 GQFRPVKITRFCIEDSIESRIIELQEKKANMIHATINQDEAAIGRLTPADLQFLF 770

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 90/206 (43%), Gaps = 43/206 (20%)

Query: 359 LEALKKSQSNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSS 417
           LE L        G + G ++ADEMG+GKT+Q IAL+   L + P         ++V P+ 
Sbjct: 171 LEGLHWLIQQEEGIFKGGVLADEMGMGKTIQTIALLMNDLTKRPS--------LVVAPTV 222

Query: 418 LVNNWANELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIIS 477
            +  W NE+ +            DGK        TS    IK  ++         V++ +
Sbjct: 223 ALMQWKNEINQ----------HTDGKLKVYMFHGTSKNIDIKTLSEYD-------VVLTT 265

Query: 478 YDTLR-----------------RNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINC 520
           Y  L                  + +  L N E   ++ DE H +K+  S T  A++++  
Sbjct: 266 YAVLESVFRKQNYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNNLKT 325

Query: 521 PRRVILSGTPIQNDLSEYFALLNFSN 546
            +R  L+GTP+QN + E ++L+ F N
Sbjct: 326 QKRWCLTGTPLQNRIGEMYSLIRFLN 351

>Kwal_14.1868
          Length = 1357

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 78/149 (52%), Gaps = 5/149 (3%)

Query: 703  ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYAS-VRLDGTMSINKRQKLVDR 761
            I+     K KTE   KI++ S +T   DL++   R    A  +R DG+M    R   ++ 
Sbjct: 1184 IIRDVFLKSKTE---KIIVFSQFTTFFDLLQHFIRKDLGAQYLRYDGSMDSQSRAATIEE 1240

Query: 762  FNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 821
            F     +  I L+S KAG  G+ L  AN +IL+DP WNP  ++QA+ R +R  Q +D  +
Sbjct: 1241 FYR-SLERRILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQAMDRCYRISQTRDVQV 1299

Query: 822  YRFISTGTIEEKIYQRQSMKMSLSSCVVD 850
            +R +   ++E++I + Q  K  L    +D
Sbjct: 1300 HRLLVKNSVEDRILELQKKKRELVEIAMD 1328

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/337 (24%), Positives = 147/337 (43%), Gaps = 63/337 (18%)

Query: 374  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC---IIVCPSSLVNNWANEL-VKW 429
            G ++AD+MGLGKT+Q IALM          K  +  C   +IV P +++  W  E+  K 
Sbjct: 696  GGLLADDMGLGKTVQAIALMLA-------NKSGVENCKTNLIVAPVAVLRVWQAEVKTKV 748

Query: 430  LGPNTLSPLAVDGKKSS--------------LASGATSVAEAIKNW-----AQAQGRNIV 470
               + L  L   G   +              L S  T  +E  K+W       ++   I 
Sbjct: 749  KKTSGLKVLIYGGGNGAKVENYRSLLRHDVVLVSYQTLASELKKHWPARLSEDSEEAKIT 808

Query: 471  KPVLIISYDTLRRNVKQ-----LQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVI 525
                + + ++L+   +         ++   ++ DE   +KN  + +  A  +++   R  
Sbjct: 809  DIPDLKALNSLKERKEYWSPFYCNESKFYRIILDEAQNIKNKKTQSAKACCTLDATYRWA 868

Query: 526  LSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQ 585
            LSGTP+QN++ E ++L+ F          +F+ +   P+ ++ + D   +D +   +K+Q
Sbjct: 869  LSGTPMQNNIMELYSLIRFLKISPYKREQKFKLDIGNPLGKATN-DYDSHDRQQAIKKVQ 927

Query: 586  LLSNIVSKFIIRRTND-------ILSKYLPCKYEHVIFVN----LTPFQKQVYNMLIKSR 634
            +L   +   ++RRT D       IL   LP K    I  N    L   + Q Y+ L +++
Sbjct: 928  VL---LRAIMLRRTKDSKIDGKPILE--LPEK----IITNREDVLQGAELQFYSDL-EAK 977

Query: 635  DIKKVVK-----GDGG-SQPLKAIGVLKKLCNHPDLI 665
            + KKV K       G  S  L  +  L++ C HP+L+
Sbjct: 978  NQKKVEKLLNNRAKGSYSSILTLLLRLRQACCHPELV 1014

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 90/162 (55%), Gaps = 6/162 (3%)

Query: 713  TESDDKIVLISNYTQTLDLIERMCRNRHYASV----RLDGTMSINKRQKLVDRFNDPE-G 767
            + + +++V+ S ++  LD++E+   +     V    + DG +S+ +R  ++  F   +  
Sbjct: 1009 SSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSLKERTSVLADFAVKDYS 1068

Query: 768  QEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIST 827
            ++ I LLS KAGG G+NL  A+   +MDP W+P+ + QA+ R+ R GQ     + RFI  
Sbjct: 1069 RQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLHRIGQTNSVKVMRFIIQ 1128

Query: 828  GTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNLRQLFQ 869
             +IEEK+ + Q  K ++    +D  ED  R   ++ ++ LF+
Sbjct: 1129 DSIEEKMLRIQEKKRTIGEA-MDTDEDERRKRRIEEIQMLFE 1169

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 140/349 (40%), Gaps = 84/349 (24%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISK------------------------ 409
           G I++DEMGLGKT+      ++L+   P    ++ K                        
Sbjct: 527 GGILSDEMGLGKTVAA----YSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKP 582

Query: 410 -----CIIVCPSSLVNNWANELVK-----------WLGPNTLSPLAVDGKKSSLASGATS 453
                 +IV P SL+  W+NE  K           + G N  S   +  K  +  +   +
Sbjct: 583 YASKTTLIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNVSSLKTLLTKTKTPPTVVLT 642

Query: 454 VAEAIKN-WAQ-AQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLT 511
               ++N W + ++GR   + V I S          L +     ++ DEGH ++N  ++T
Sbjct: 643 TYGIVQNEWTKHSKGRMTDEDVNISS---------GLFSVNFYRIIIDEGHNIRNRTTVT 693

Query: 512 FTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDAD 571
             A+ ++    + +L+GTPI N L + ++L+ F         N ++     P        
Sbjct: 694 SKAVMALQGKCKWVLTGTPIINRLDDLYSLVKFLELDPWRQINYWKTFVSTPF------- 746

Query: 572 ATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSK------YLPCKYEHVIFVNLTPFQKQ 625
               + K+ +Q   +++ I+   ++RRT  +  K       LP K    + +   PF K 
Sbjct: 747 ----ESKNYKQAFDVVNAILEPVLLRRTKQMKDKDGKPLVELPPKE---VVIKRLPFSKS 799

Query: 626 ---VYNMLIKSRDI---KKVVKGD---GGSQPLKAIGVLKKLCNHPDLI 665
              +Y  L+   ++     + +GD     S  L  I  L+++C HP LI
Sbjct: 800 QDLLYKFLLDKAEVSVKSGIARGDLLKKYSTILVHILRLRQVCCHPGLI 848

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 91/168 (54%), Gaps = 7/168 (4%)

Query: 685  IPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNR-HYAS 743
            +P  +S +  T+      +++R   +  TE   KI++ S +T   +++E   +N+ ++  
Sbjct: 1433 VPNFESLEPSTKIEQCIQVIQRVFDESATE---KIIIFSQFTTFFEILEHFLKNKLNFPY 1489

Query: 744  VRLDGTMSINKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAA 802
            ++  G+M+  +R  +++ F  DPE +  I L+S KAG  G+ L  AN ++++DP WNP  
Sbjct: 1490 LKYIGSMNAQRRSDVINEFYRDPEKR--ILLISMKAGNSGLTLTCANHVVIVDPFWNPYV 1547

Query: 803  DQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVD 850
            ++QA  R +R  Q K   +++     ++E++I + Q  K  +    +D
Sbjct: 1548 EEQAQDRCYRISQTKKVQVHKLFIKDSVEDRISELQKRKKEMVDSAMD 1595

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 113/260 (43%), Gaps = 36/260 (13%)

Query: 366  QSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC---IIVCPSSLVNNW 422
            Q  N    G ++AD+MGLGKT+Q IALM          +   SKC   +IV P S++  W
Sbjct: 956  QVENSAKKGGLLADDMGLGKTIQAIALMLA-------NRSEESKCKTNLIVAPVSVLRVW 1008

Query: 423  ANEL---VKWLGPNTLSPLAVDGK------------KSSLASGATSVAEAIKNWAQA-QG 466
              EL   VK     T       G              + L S  T   E  K+W +   G
Sbjct: 1009 KGELETKVKKRAKFTTFIFGGSGNGKVKHWRDLARYDAVLVSYQTLANEFKKHWPKKLDG 1068

Query: 467  RNIVKPVL--IISYDTLRRNVKQLQ-----NTEVGLLLADEGHRLKNGDSLTFTALDSIN 519
                 P +  I + + L+ + +        ++    +L DEG  +KN ++    A  +IN
Sbjct: 1069 EQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFYRILLDEGQNIKNKNTRASKACCTIN 1128

Query: 520  CPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKS 579
               R +LSGTPIQN + E ++L+ F           F+ +      R++     + D K+
Sbjct: 1129 GMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQRFKLDIGRFFQRNKQYQYDNEDRKN 1188

Query: 580  GEQKLQLLSNIVSKFIIRRT 599
              +K+++L N +   ++RR+
Sbjct: 1189 ALRKVRVLLNAI---MLRRS 1205

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
           Saccharomyces cerevisiae YBR114w RAD16 nucleotide
           excision repair protein, start by similarity
          Length = 800

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 83/151 (54%), Gaps = 1/151 (0%)

Query: 718 KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSK 777
           K ++ S +T  LDL+E   +   + +V+L G+M+  +R + +  F +    E +FL+S K
Sbjct: 649 KSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMENIHCE-VFLVSLK 707

Query: 778 AGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQR 837
           AGG  +NL  A+++ ++DP WNP+ + Q+  RV R GQ +   I RF    +IE +I + 
Sbjct: 708 AGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRIIEL 767

Query: 838 QSMKMSLSSCVVDAKEDVERLFSVDNLRQLF 868
           Q  K S+    ++  E      +  +L+ LF
Sbjct: 768 QEKKASMIHATINQDEAAINRLTPADLQFLF 798

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 92/199 (46%), Gaps = 29/199 (14%)

Query: 359 LEALKKSQSNNRGAY-GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSS 417
           LE L   Q      Y G ++ADEMG+GKT+Q IAL+ + + + P         ++V P+ 
Sbjct: 199 LEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIALLMSDITRKPS--------LVVAPTV 250

Query: 418 LVNNWANELVK----------WLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGR 467
            +  W NE+ +          + G N  + L  D K   +     +V E++    + Q  
Sbjct: 251 ALMQWKNEIEQHTNKKLSVYMYHGANRTNNLG-DFKDVDVILTTYAVLESV---YRKQVY 306

Query: 468 NIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILS 527
              +    +   +L      L +     ++ DE H +K+  S T  A++S+   +R  LS
Sbjct: 307 GFKRKAGTVKEKSL------LHSINFYRVILDEAHNIKDRTSNTAKAVNSLQTKKRWCLS 360

Query: 528 GTPIQNDLSEYFALLNFSN 546
           GTP+QN + E ++L+ F N
Sbjct: 361 GTPLQNRIGEMYSLIRFLN 379

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 80/139 (57%), Gaps = 2/139 (1%)

Query: 713  TESDDKIVLISNYTQTLDLIERMCR-NRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFI 771
            + +D+K+V+ S +T   +++    + N     +R DG+MS ++R   ++ F        +
Sbjct: 1443 SNTDEKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQDNNYR-V 1501

Query: 772  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
             L+S KAG  G+ L  AN +IL DP WNP  ++QA+ R  R  Q+++ +++R +   ++E
Sbjct: 1502 MLISMKAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVE 1561

Query: 832  EKIYQRQSMKMSLSSCVVD 850
            ++I + Q+ K +L +  +D
Sbjct: 1562 DRIVELQNKKKTLVNLAMD 1580

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 143/343 (41%), Gaps = 69/343 (20%)

Query: 374  GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
            G ++AD+MGLGKT+Q +AL   L+   P+ K  I   ++V P +++  W +E+   +  +
Sbjct: 940  GGLLADDMGLGKTVQSLAL---LMANKPEPKSAIKTTLVVAPVAVLRVWKDEVAVKIKKD 996

Query: 434  TLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQ------ 487
                + + G       G  + +   ++W      +IV    ++SY TL    K+      
Sbjct: 997  VNVKVVIFG-------GGENNSSKFRSWKDLAEYDIV----LVSYQTLASEFKKHWPLSW 1045

Query: 488  ---------------LQN----------------TEVGLLLADEGHRLKNGDSLTFTALD 516
                           L N                +E   ++ DE   +KN  +    A  
Sbjct: 1046 KNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFYRVILDEAQNIKNKKTQAAKACC 1105

Query: 517  SINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDND 576
            +I+   R  LSGTPIQN++ E ++L+ F          +F  +    +   +  D  D++
Sbjct: 1106 TISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEAKFHSDIGAVLNTKKPYDYNDSE 1165

Query: 577  VKSGEQKLQLLSNIVSKFIIRRTND-------ILSKYLPCKYEHVIFVNLTPFQKQVYNM 629
             +   +K+Q+L   +   ++RRT         IL   LP K+       L   + + Y  
Sbjct: 1166 RQRAMKKVQVL---LRAIMLRRTKTSQIDGKPILQ--LPEKHLKESANKLEGDELEFYQA 1220

Query: 630  L-IKSRD-IKKVV----KGDGGSQPLKAIGVLKKLCNHPDLIK 666
            L  KSRD  KK++    K    S  L  +  L++ C H +L+K
Sbjct: 1221 LESKSRDKAKKMLESKQKQGAYSSILTLLLRLRQACLHSELVK 1263

>Scas_674.12d
          Length = 1323

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 82/159 (51%), Gaps = 7/159 (4%)

Query: 708  LHKIKTESD-DKIVLISNYTQTLDLIERMCRNR-HYASVRLDGTMSINKRQKLVDRFNDP 765
            + K+   SD +KI++ S +T   D+ +           ++  G M+  +R  ++ +F   
Sbjct: 1156 IKKVFENSDTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITKFYR- 1214

Query: 766  EGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFI 825
            +  E I L+S KAG  G+ L  AN +I++DP WNP  ++QA  R +R  Q ++  ++R  
Sbjct: 1215 QANERILLISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVHRLF 1274

Query: 826  STGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSVDNL 864
               ++E++I + Q  K  +    VDA  D  +L  V+ L
Sbjct: 1275 IKDSVEDRIAELQEKKREM----VDAAMDPSKLKEVNRL 1309

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 141/324 (43%), Gaps = 41/324 (12%)

Query: 374 GCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN 433
           G ++AD+MGLGKT+Q IALM           +     +IV P +++  W  EL   +   
Sbjct: 671 GGLLADDMGLGKTVQGIALMLA----NRSKDQACKTNLIVAPVAVLRVWGGELETKIKKE 726

Query: 434 TLSPLAVDGKKSSLA-------------SGATSVAEAIKNWAQAQGRNIVK-PVL--IIS 477
                 + G    LA             S  T   E  K+W  + G++  + P +  + +
Sbjct: 727 ANFSAFIYGGGDKLATWKELSEYDAIMVSYPTLAIEFKKHWPASLGKDQKQLPAIPQLAA 786

Query: 478 YDTLRRNVKQLQ-----NTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQ 532
            ++L++  +         +    ++ DEG  +KN  +    A  S++   R + SGTPIQ
Sbjct: 787 MNSLKKKDEYFSPFFCNESTFYRIILDEGQNIKNKKTRAAKACCSLDATYRWVFSGTPIQ 846

Query: 533 NDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADATDNDVKSGEQKLQLLSNIVS 592
           N + E ++L+ F           F  +   P LR ++ +  D D K   +K+Q+L   +S
Sbjct: 847 NSMDELYSLIRFLRIPPYHREERFMADIGRPFLR-KNGNYDDFDRKQAIKKVQVL---LS 902

Query: 593 KFIIRRT-NDILSKY----LPCKYEHVIFVNLTPFQKQVY------NMLIKSRDIKKVVK 641
             ++RR+ +D++       LP K   +    L   + + Y      N  +  R +K+  K
Sbjct: 903 AIMLRRSKSDMIDGKPLLELPPKQIEIDSAALEGDELEFYTDLEAKNRKLAERLLKRKAK 962

Query: 642 GDGGSQPLKAIGVLKKLCNHPDLI 665
           G+  S  L  +  L++ C H +L+
Sbjct: 963 GNYSS-VLTLLLRLRQACVHSELV 985

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 86/157 (54%), Gaps = 6/157 (3%)

Query: 698  SGKFAILERFLHKIK-TESDDKIVLISNYTQTLDLIERMCRNRHYAS----VRLDGTMSI 752
            S K   L + L +++ T   +++V+ S ++  LD++E    +    +     + DG +++
Sbjct: 951  SSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNL 1010

Query: 753  NKRQKLVDRF-NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVW 811
              R +++D F      +  I LLS KAGG G+NL  A+R  +MDP W+P+ + QA+ RV 
Sbjct: 1011 KDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVH 1070

Query: 812  RDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCV 848
            R GQ+ +  I RFI   +IEEK+   Q  K +L   V
Sbjct: 1071 RIGQESNVKIIRFIMENSIEEKMLSIQDRKRTLGEAV 1107

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 88/209 (42%), Gaps = 51/209 (24%)

Query: 374 GCIMADEMGLGKTLQCIALMWTL-----------LRQGPQG---------KRLISK-CII 412
           G ++ADEMGLGKT+  +A++  +            R+   G         K   SK  +I
Sbjct: 495 GGLLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLI 554

Query: 413 VCPSSLVNNWANELVKW-LGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVK 471
           V P SL+  W  E  K    PN    +   G+  +L +  T                   
Sbjct: 555 VVPMSLLFQWQKEFEKANNNPNAHCEIYYGGRAGNLITLLTKTKNP-------------P 601

Query: 472 PVLIISYDTLRRNVKQL---------QNTEVGL-------LLADEGHRLKNGDSLTFTAL 515
            +++ SY  ++    +L         Q   +GL       ++ DEGH ++N  + T  A+
Sbjct: 602 TIILTSYGVIQSEWSKLPRCNNNRIEQGAAIGLFSVEFFRIVIDEGHSIRNRTTRTSKAV 661

Query: 516 DSINCPRRVILSGTPIQNDLSEYFALLNF 544
             ++  R+ +L+GTPI N L + F+L+ F
Sbjct: 662 MDLSSSRKWVLTGTPIINRLDDLFSLVKF 690

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 90/178 (50%), Gaps = 19/178 (10%)

Query: 703  ILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRF 762
            I ++ L K   + + +IV+ S+++  L ++  +    +    R    +   K  K VD F
Sbjct: 1338 IKQQHLEKEPHKKNPQIVIFSSHSAFLSILSTLLTAHNVTHAR---PLRNTKFAKAVDTF 1394

Query: 763  -NDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFI 821
              DP       LL+  +   G+ L+ A  LIL++P  + + + QA++R+ R GQK   ++
Sbjct: 1395 RKDPNCT--CLLLNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYV 1452

Query: 822  YRFISTGTIEEKIYQRQS------------MKMSLSSCVV-DAKEDVERLFSVDNLRQ 866
            + F+   T+EE I + ++            ++ S S   V +A++++ER FS+DN+ +
Sbjct: 1453 WNFMVRNTVEESIMKYKAVLEGKKKKKTEELRASGSKISVEEAEQEIERNFSMDNITE 1510

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 13/72 (18%)

Query: 367 SNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQ------------GPQGKRLISKCIIVC 414
           S+ + A G ++ADEMGLGKT++ + L+ T +R               +  R +   +IVC
Sbjct: 346 SSGKKARG-VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVC 404

Query: 415 PSSLVNNWANEL 426
           P S++  W +E+
Sbjct: 405 PESILQQWIDEI 416

>Kwal_14.1287
          Length = 1518

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 718  KIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFN-DPEGQEFIFLLSS 776
            +I++ S Y++ L L+ ++ +     S++   T    K  K+V++F  +PE      LL+ 
Sbjct: 1332 QIIIYSQYSEFLGLLSKVLKQH---SIQHCNTAGSGKFSKIVEKFKKNPEVT--CLLLNV 1386

Query: 777  KAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFIS---------- 826
                 G+ L+ A  + +MDP  N + + QA+ R  R GQ ++ +++ F+           
Sbjct: 1387 TRQATGLTLVNATHVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIVR 1446

Query: 827  -TGTIEEKIYQRQSMKMSLSSCVVDAKEDV 855
              G +EE+I  RQ +K   S  +   +E++
Sbjct: 1447 LKGVLEERIASRQRLKTQPSKTIPMKREEI 1476

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQ---GPQ----GKRLISKC---IIVCPSSLVNNWANE 425
           ++++EMGLGKTL+ +ALM    R     P      K+ I K    +IVCP S++  W +E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 426 L 426
           +
Sbjct: 416 V 416

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 67/125 (53%), Gaps = 7/125 (5%)

Query: 718  KIVLISNYTQTLDLIERMCRNRHYASVR-LDGTMSINKRQKLVDRFN-DPEGQEFIFLLS 775
            +IV+ S Y + L+++  + +     S++ L  T ++    K+V+ F  DPE      LL 
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQN---SIKFLTTTKNVRNFAKVVETFKADPEIT--CLLLD 1413

Query: 776  SKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIY 835
            +K    G+ LI A  + L++P  N + + QA+ R+ R GQ  + +++ F+   T+E  I 
Sbjct: 1414 TKRQASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSIL 1473

Query: 836  QRQSM 840
            + +S+
Sbjct: 1474 RYKSI 1478

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 38/67 (56%), Gaps = 15/67 (22%)

Query: 376 IMADEMGLGKTLQCIAL--------------MWTLLRQGPQGKRLISKCIIVCPSSLVNN 421
           ++++EMGLGKT++ +AL              ++ ++  G + +R+ +  +IVCP  +V  
Sbjct: 381 MLSEEMGLGKTVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMRRVKTN-LIVCPQVIVQQ 439

Query: 422 WANELVK 428
           W +E+ K
Sbjct: 440 WLDEIAK 446

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 75/150 (50%), Gaps = 13/150 (8%)

Query: 693  VQTQFSGKFAILERFLHKIKTESDD------KIVLISNYTQTLDLIERMCRNRHYASVRL 746
            ++  F  K   + + +  ++ +S+       +++L S  T+ L +I ++ +  H     +
Sbjct: 1350 IKESFGAKIDFVIKLISYLRLKSEQENADPPQVILYSQKTEYLKVIGKVLKLYH-----I 1404

Query: 747  DGTMSINKRQKLVDRFNDPEGQEFI--FLLSSKAGGCGINLIGANRLILMDPDWNPAADQ 804
            +    ++    + +  N+ + Q  +   LL+ K  G G+NLI A  + L+DP  N + + 
Sbjct: 1405 EHLACLSNTANVGETINNFKRQPSVTCLLLNVKTLGAGLNLINAKHIFLLDPILNNSDEL 1464

Query: 805  QALARVWRDGQKKDCFIYRFISTGTIEEKI 834
            QA+ R  R GQ ++ F++ F+   T+EE I
Sbjct: 1465 QAMGRNNRIGQDEETFVWNFMIRNTVEENI 1494

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 93/235 (39%), Gaps = 45/235 (19%)

Query: 376 IMADEMGLGKTLQCIALMW-----------TLLRQGPQGKRLISKCIIVCPSSLVNNWAN 424
           ++A+EMGLGKT++ ++L+            T +    +        +I+CP++++  W  
Sbjct: 388 VLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLE 447

Query: 425 ELVKWLGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRN 484
           E+   L  N+L      G  + +     +V EA++   Q         +++ SY+ +   
Sbjct: 448 EIE--LHANSLKWYTYRG-YNEIMKDCKTVDEAVQQLCQYD-------IIVTSYNIIATE 497

Query: 485 VKQ----------------------LQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPR 522
           V                        L   +   ++ DE   L++  + +      ++   
Sbjct: 498 VHHAEFNRSIRSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIH 557

Query: 523 RVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPI-LRSRDADATDND 576
              +SGTPIQN +  +  ++++          +F R  +  I LR+   D T ND
Sbjct: 558 TWGVSGTPIQN-IYNFRMIMSYLKLHPFCDEVDFIRTLQEEIKLRNEAKDYTSND 611

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
            Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 40/63 (63%)

Query: 772  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
             LL+ ++ G G+NL+ A  + L+DP  N   + QA++R  R GQ+++ +++ F+   T+E
Sbjct: 1350 LLLNIRSLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVE 1409

Query: 832  EKI 834
            E I
Sbjct: 1410 ESI 1412

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 13/68 (19%)

Query: 371 GAYGCIMADEMGLGKTLQCIALMWTLLRQG---------PQGKRLISKC---IIVCPSSL 418
           GA G ++A+EMGLGKTL+ +AL+    R+           +  ++ISKC   +IVCP S+
Sbjct: 349 GAKG-VLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSI 407

Query: 419 VNNWANEL 426
           +  W +E+
Sbjct: 408 LKQWIDEM 415

>Scas_573.9
          Length = 1502

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 39/65 (60%)

Query: 772  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
             LL+ K  G G+NL+ A  + L+DP  N + + QA+ R  R GQK + +++  I   ++E
Sbjct: 1384 LLLNVKTLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVE 1443

Query: 832  EKIYQ 836
            E I++
Sbjct: 1444 ENIFK 1448

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 10/60 (16%)

Query: 376 IMADEMGLGKTLQCIALMW----------TLLRQGPQGKRLISKCIIVCPSSLVNNWANE 425
           ++++EMGLGKT++ +AL+           + +    +  R  +  +IVCP++++  W NE
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 772  FLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIE 831
             L++ K    G+ L  A  +ILM+P       +QA+ R+ R GQ KD F++  ++  T E
Sbjct: 1352 LLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVWHLMTRNTAE 1411

Query: 832  E 832
            E
Sbjct: 1412 E 1412

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 376 IMADEMGLGKTLQCIALMWTLLRQG----------PQGKRLISK--CIIVCPSSLVNNWA 423
           I++D+ GLGKT++ +AL+    R+           P+G+ ++     +I CP  ++  W 
Sbjct: 353 ILSDDTGLGKTVETLALVCLHRRKFRPDEPRSYTLPEGREILKAKTTLICCPGPILQQWL 412

Query: 424 NE 425
           +E
Sbjct: 413 DE 414

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 13/68 (19%)

Query: 362 LKKSQSNNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKC---IIVCPSSL 418
           L   +SN RG    ++AD+MGLGKT+Q IALM          +  +  C   +IV P ++
Sbjct: 897 LNVEKSNKRGG---LLADDMGLGKTVQAIALMIA-------NRSELESCKTNLIVAPVAV 946

Query: 419 VNNWANEL 426
           +  W  E+
Sbjct: 947 LRVWQAEI 954

>KLLA0F23716g join(complement(2216857..2218129), some similarities
           with ca|CA1415|CaDBP2.exon2 Candida albicans
           ATP-dependent RNA helicase of DEAD box family, exon 2
           (by homology), hypothetical start
          Length = 554

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 69/153 (45%), Gaps = 15/153 (9%)

Query: 704 LERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFN 763
           L + L     + D KI++ ++  +T D I    R   + ++ + G  + N+R  ++  F 
Sbjct: 348 LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 764 DPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYR 823
              G+  I ++++     GI++ G N +I  D    P   +  + R+ R G        R
Sbjct: 408 --SGRSPI-MVATDVAARGIDVKGINYVINYD---MPGNIEDYVHRIGRTG--------R 453

Query: 824 FISTGT-IEEKIYQRQSMKMSLSSCVVDAKEDV 855
             STGT I       +S+  +L   + +AK+D+
Sbjct: 454 AGSTGTAISFFTEGNKSLGAALIKIMREAKQDI 486

>Kwal_34.16080
          Length = 290

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 828 GTIEEKIYQRQSMKMSLSSCVV-DAKEDVERLFSVDNLRQLFQFNDKT 874
           G+IEEKIY RQ  K  L++ ++ D K+  +R F  + L+ LF    ++
Sbjct: 4   GSIEEKIYHRQIFKQFLTNKILTDPKQ--KRFFKSNELQDLFSLGGES 49

>KLLA0D08932g 751943..752779 similar to sp|P09064 Saccharomyces
           cerevisiae YPL237w SUI3 translation initiation factor
           eIF2 beta subunit singleton, start by similarity
          Length = 278

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 528 GTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRDADAT 573
           G P Q+ LS +F +LN +NP L G R+  +     PI + RD   T
Sbjct: 121 GLPYQDLLSRFFKILNTNNPELAGDRSGPKFKIPPPICQ-RDGKKT 165

>KLLA0B09900g 866210..867571 no similarity, hypothetical start
          Length = 453

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 488 LQNTEVGLLLADEGHRLK--NGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFS 545
           L N E+     DEG R K   G+S++  +L   + PRR ++ G+P Q+ L +  +  N  
Sbjct: 15  LNNYEMNF--DDEGDRSKFLTGNSVSPRSLSKAHFPRRHMIKGSPAQHTLLQS-SSENVL 71

Query: 546 NPGL-LGTRNEFR---RNFEIPILRSRDADATDNDVKSGEQKLQLLSNIV 591
            P + LG  N      RNF  P     +   +DND  S EQ+L+  S++ 
Sbjct: 72  RPAIKLGNNNTAAIRMRNFSFP-----NDMQSDNDTAS-EQELRRPSSLT 115

>YNL137C (NAM9) [4458] chr14 complement(368595..370055)
           Mitochondrial ribosomal protein of the small subunit,
           member of E. coli ribosomal protein S4 family [1461 bp,
           486 aa]
          Length = 486

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 396 LLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPN-TLSPLAVDGKKSSLASGATSV 454
             + G   + +ISKC    P  L++  A E+   + PN T      DG KS+L SG   +
Sbjct: 291 FFKSGEIRREIISKC---QPDELIS-LATEM---MNPNETTKKELSDGAKSALRSGKRII 343

Query: 455 AEAIKNWAQ 463
           AE++K W +
Sbjct: 344 AESVKLWTK 352

>Kwal_27.9999
          Length = 264

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 222 NKTLQELLGNSPFNPTESMKKKFANVPVVIDPKLAKI 258
           N++LQ  LGN+ F   + +K++  N  + +DP++AK+
Sbjct: 221 NESLQIELGNA-FKQIDILKRQLTNAGIAVDPEIAKL 256

>Sklu_2393.10 YIL162W, Contig c2393 16513-18165
          Length = 550

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 534 DLSEYFALLNFSNPGLLGTRNEFRRNFEIPILRSRD--ADATDN-DVKSGEQKLQLLS 588
           DL ++    NFS+ GLLG + E     ++PI+R  D  +++TD+ D K+ E+ +  LS
Sbjct: 204 DLKKWELYSNFSHHGLLGYQYECPGLAKVPIVRQSDDNSNSTDSADSKANEKWVMFLS 261

>Scas_588.16
          Length = 693

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 698 SGKFAILERFLHKI----KTESDDKIVLISNYTQTLDLIERMCRNRHYASVRLDGT 749
           SGKF + ++ L K+    K E   K++LIS+  + LD++E     +     R+ GT
Sbjct: 126 SGKFKVFQQLLFKLLDKEKDEVSKKVLLISHSIKELDILEGFLLGQKVRIKRISGT 181

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 848 VVDAKEDVERLFSV-DNLRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAA--MLYGD 904
           + D + DVE++    +++++++ F     CD H     +  NKH Q ++      +L   
Sbjct: 44  IKDMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRDI 103

Query: 905 ATTWNHLNHKALEKTNDHLL 924
           +T    LN++ +EK  +HLL
Sbjct: 104 STNGTWLNNQRIEKDRNHLL 123

>Scas_700.19
          Length = 700

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 6/74 (8%)

Query: 70  TVSYAGLDVDSKDEVDGKENIYDELGERVIKKRRVDALSARRLMEDPTR-LDTIEVTLKK 128
           +V +   D+ S DE + ++ +YDE   +    R V+ +S    ++D +R L+T+E+T  +
Sbjct: 564 SVPFIQQDLSSGDEDEDEDYVYDEELNKTFN-RTVEDIS----IDDISRHLETLEITQSE 618

Query: 129 SFHVPIKGYVQRHS 142
               P +G  +RHS
Sbjct: 619 DMETPQEGSNRRHS 632

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,870,417
Number of extensions: 1286123
Number of successful extensions: 4574
Number of sequences better than 10.0: 132
Number of HSP's gapped: 4335
Number of HSP's successfully gapped: 226
Length of query: 928
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 817
Effective length of database: 12,753,511
Effective search space: 10419618487
Effective search space used: 10419618487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)