Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04202g42541919160.0
YGL164C (YRB30)44043710871e-146
Scas_668.1741241910811e-146
Sklu_1546.14293259881e-131
AEL296W4393327059e-89
Kwal_14.15422042043637e-41
Scas_668.2042582682.2
CAGL0H02849g21554653.7
Kwal_26.796057567655.6
AER115W202739647.1
CAGL0J06996g1105120647.4
Kwal_55.2079044986638.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04202g
         (419 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04202g complement(368221..369498) highly similar to sp|P53...   742   0.0  
YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein o...   423   e-146
Scas_668.17                                                           421   e-146
Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement         385   e-131
AEL296W [2209] [Homologous to ScYGL164C - SH] complement(86307.....   276   9e-89
Kwal_14.1542                                                          144   7e-41
Scas_668.20                                                            31   2.2  
CAGL0H02849g complement(263305..263952) highly similar to sp|P40...    30   3.7  
Kwal_26.7960                                                           30   5.6  
AER115W [2620] [Homologous to ScYLR430W (SEN1) - SH] complement(...    29   7.1  
CAGL0J06996g complement(668088..671405) similar to sp|P32873 Sac...    29   7.4  
Kwal_55.20790                                                          29   8.3  

>CAGL0I04202g complement(368221..369498) highly similar to sp|P53107
           Saccharomyces cerevisiae YGL164c, start by similarity
          Length = 425

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/419 (89%), Positives = 375/419 (89%)

Query: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60
           MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI
Sbjct: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60

Query: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120
           VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI
Sbjct: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120

Query: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMFA 180
           NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMFA
Sbjct: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMFA 180

Query: 181 GEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIRRKDETNKFNYVLRI 240
           GEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIRRKDETNKFNYVLRI
Sbjct: 181 GEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIRRKDETNKFNYVLRI 240

Query: 241 DQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERDSPVLVIKTDKNIK 300
           DQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERDSPVLVIKTDKNIK
Sbjct: 241 DQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERDSPVLVIKTDKNIK 300

Query: 301 GKGIHSNSSTEDIEWFALGXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXXXXXXXXXXX 360
           GKGIHSNSSTEDIEWFALG                          A              
Sbjct: 301 GKGIHSNSSTEDIEWFALGSYESTDSDSSSDEDSSDEDNSANYEDANSSNSNIIPSNERS 360

Query: 361 XXXXLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAIRETNSSINKIDEKLER 419
               LLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAIRETNSSINKIDEKLER
Sbjct: 361 SSISLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAIRETNSSINKIDEKLER 419

>YGL164C (YRB30) [1825] chr7 complement(191982..193304) Protein of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.8006p [1323 bp, 440 aa]
          Length = 440

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 232/437 (53%), Positives = 299/437 (68%), Gaps = 20/437 (4%)

Query: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60
           MDEILAKAGSQAVTFAIKSG+SIASTYA+KTIT F+++IPKDDA+RI++L+ KL++R+ I
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISIASTYALKTITNFVVQIPKDDARRIDQLKFKLESRMAI 60

Query: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120
           VS AIDLI+LVAARGNTNL+ TLRLT DL+ EID+FD+KI+E+T+KVEGSR+AKTQ ++I
Sbjct: 61  VSSAIDLIKLVAARGNTNLQITLRLTKDLKEEIDRFDEKINEMTQKVEGSRSAKTQNEAI 120

Query: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMF- 179
            AVE YIKDLL RIEEITPFINLSLTTSGANL+S L   +SPGLLL AS++V +NN  + 
Sbjct: 121 KAVENYIKDLLLRIEEITPFINLSLTTSGANLNSALPYQLSPGLLLKASDFVSENNRKYE 180

Query: 180 ---------AGE----DVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIR 226
                     G+     VQVGPTFE T FS+FY+L SE +    + WKEDMKR   RI R
Sbjct: 181 KAMKSNEKGTGDKEILKVQVGPTFEVTLFSIFYNLTSENNGQSGIVWKEDMKRAKARIYR 240

Query: 227 RKDETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPER 286
                 K++Y ++I+Q F+DGRYH  ++ E+ P+ L +++  I KLFFSVSGKLL+L E+
Sbjct: 241 LNSTGRKYDYFMKIEQDFNDGRYHEDDDKEDTPQELAIDLNHIKKLFFSVSGKLLRLEEQ 300

Query: 287 DSPVLVIKTDKNIKGKGIHSNSST---EDIEWFALGXXXXXXXXXXXXXXXXXXXXXXXX 343
           DSPVLV+K D++   +   S       +DI W+A+                         
Sbjct: 301 DSPVLVLKIDRSDDKENESSEGDKGLLDDITWYAVS-GYEAIEEDEEEDEEEDEEEGKDG 359

Query: 344 XXAXXXXXXXXXXXXXXXXXXLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAI 403
                                LLEYI+RL SLQ ND  SILEV DERLS+YLNDEN N+ 
Sbjct: 360 EERKEEEEEENKLEDKDSSITLLEYIIRLTSLQSNDQKSILEVSDERLSIYLNDENTNSR 419

Query: 404 RE--TNSSINKIDEKLE 418
           ++  +NS+I + ++KL+
Sbjct: 420 KDRISNSTIEETEKKLK 436

>Scas_668.17
          Length = 412

 Score =  421 bits (1081), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 289/419 (68%), Gaps = 15/419 (3%)

Query: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60
           MD++LAKAGSQAVTFAI+SGVS+AS++AIKT+T FI+ IPK+DA+RIE LR KL+NRIEI
Sbjct: 1   MDDLLAKAGSQAVTFAIRSGVSLASSFAIKTLTNFIVHIPKNDARRIESLRAKLENRIEI 60

Query: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120
           VS AIDLI+LVAARGNTNL+STLRLT DL+ EID FD+K+  LTEKV  S+++K+Q+++I
Sbjct: 61  VSSAIDLIKLVAARGNTNLDSTLRLTKDLKQEIDSFDEKMKRLTEKVTTSKSSKSQEEAI 120

Query: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNND--M 178
            +VE YI+DLL RIEE+TPFINLSL T+G +LS+ L   VSPGLLL ASN+V ++ND  +
Sbjct: 121 KSVEAYIEDLLLRIEEVTPFINLSLNTTGTSLSTALPQQVSPGLLLQASNFVSRSNDGKL 180

Query: 179 FAGEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIRRKDETNKFNYVL 238
             G+ ++VGPTF+ T FSVFY++ S      R+TW+EDMKR   +I+R + +  +F Y L
Sbjct: 181 IHGK-LRVGPTFQATVFSVFYNMSSGADPKARITWREDMKRAFIKIVRTESKEKEFEYQL 239

Query: 239 RIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERDSPVLVIKTDKN 298
            I+QSFDDGRYHNTE+ EE P+   ++I QI KLFFS+SGKLL+L ERDSPVLV+KT   
Sbjct: 240 IIEQSFDDGRYHNTEDGEEVPQKTALDISQIRKLFFSISGKLLRLEERDSPVLVLKTVST 299

Query: 299 IKGKGIHSNSSTEDIEWFALGXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXXXXXXXXX 358
            K +     +  E I W+A G                                       
Sbjct: 300 QKKEKNKEKNDLESILWYAFG------------LFEEDEESDDSDEEKEAGELEEQVKSD 347

Query: 359 XXXXXXLLEYILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAIRETNSSINKIDEKL 417
                 LLEYI+RLVSLQ +D  SIL++ DERLS+YLNDE+P A   +   I  +  K+
Sbjct: 348 YSSSISLLEYIIRLVSLQEDDQKSILDINDERLSIYLNDESPRAATVSPKDIEAVTTKI 406

>Sklu_1546.1 YGL164C, Contig c1546 317-1606 reverse complement
          Length = 429

 Score =  385 bits (988), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 200/325 (61%), Positives = 252/325 (77%), Gaps = 13/325 (4%)

Query: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60
           MDEILAKAGSQAVTFAIKSG+S+AS+YAIKT+  F+ KIPKDDA R+E+LR KL+ RIEI
Sbjct: 1   MDEILAKAGSQAVTFAIKSGISLASSYAIKTVANFLTKIPKDDAARLERLRKKLETRIEI 60

Query: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTEKVEGSRTAKTQKDSI 120
           VS AIDLI+LVAA+GNTNL STLRLT DL+ EID FD++I E+T+       AKTQ+ SI
Sbjct: 61  VSPAIDLIKLVAAKGNTNLGSTLRLTKDLKEEIDSFDNRIAEITKNY----GAKTQRASI 116

Query: 121 NAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKNNDMFA 180
           +AVE YI+DLL RIEE+ P INLSLTTSGA+LS+ L   VSPG LL AS+Y+ KNN  F 
Sbjct: 117 DAVENYIRDLLSRIEEVIPLINLSLTTSGASLSAALPQHVSPGSLLHASDYISKNNTQFN 176

Query: 181 G-EDVQVGPTFETTYFSVFYHLPS---EKHNNIRVTWKEDMKRGITRIIRRKDETNKFNY 236
           G +D QVGPTFE T FS+FYH+ +   ++ +  R+TWKEDMK+ I  + RR +    ++Y
Sbjct: 177 GKDDRQVGPTFELTLFSIFYHIVTPDGQEDSRTRITWKEDMKKAIVTLWRRHNSKQDYDY 236

Query: 237 VLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERDSPVLVIKTD 296
            L+I +SFDDGRYH+ +  EE P+ + ++I QI++LFFS SGKLLKL ER+SPVLV+K D
Sbjct: 237 YLKIRESFDDGRYHDLK--EETPKVINVDIYQIIRLFFSASGKLLKLEERNSPVLVLKVD 294

Query: 297 KNIKG--KGIHSNSSTEDIEWFALG 319
            N++   K  H+ +STEDIEWFALG
Sbjct: 295 SNLRSSFKEDHA-TSTEDIEWFALG 318

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (78%)

Query: 373 VSLQFNDDMSILEVKDERLSVYLNDENPNAIRETNSSINKIDEKLER 419
            SLQ ND MSIL+V DERLS+YLNDENPN+I+    +I+ + ++L++
Sbjct: 377 TSLQCNDQMSILQVHDERLSLYLNDENPNSIKAKRYNIDDVTDRLKK 423

>AEL296W [2209] [Homologous to ScYGL164C - SH]
           complement(86307..87626) [1320 bp, 439 aa]
          Length = 439

 Score =  276 bits (705), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 152/332 (45%), Positives = 215/332 (64%), Gaps = 25/332 (7%)

Query: 1   MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDAKRIEKLRIKLQNRIEI 60
           MDE+L++AGSQAV+FAIKS VS+ASTYAIK  T F+  +P+ DA R++KLR +L+ RI+I
Sbjct: 1   MDELLSRAGSQAVSFAIKSSVSLASTYAIKQFTKFLTGVPQQDASRLQKLRRQLETRIDI 60

Query: 61  VSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHELTE-----KVEGSRTAKT 115
           ++ AI LI+L   RGNTNL+STL L  DL+ E+ +F+  +  L+      K+  S+  K 
Sbjct: 61  INNAIVLIKLCVVRGNTNLKSTLSLILDLKDELAEFNGDMEMLSSASVAGKLPASKNGKA 120

Query: 116 QKDSINAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASNYVVKN 175
             D+++ +E  + +L+ RIE + P INLS+TTSG + S  L + VSP LLL ASNYVVK+
Sbjct: 121 GVDAVSLMEAKMSELIHRIELVIPLINLSMTTSGVSSSMKLPSNVSPSLLLQASNYVVKS 180

Query: 176 NDMFAGE----DVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMKRGITRIIRRK--- 228
           N+    +    DVQVGP F  T + +F         + ++ WKE M R   RI+R     
Sbjct: 181 NEQALADNYEKDVQVGPLFSVTVYDIF-------DKSSKIIWKETMARCDLRIVRISSNI 233

Query: 229 -DETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSVSGKLLKLPERD 287
            D   ++NY L + ++FDD RYH+ +  E+KPR L  N+ QI +LFF++SGKLL L ERD
Sbjct: 234 PDRGVEYNYHLELKENFDDDRYHDIK--EDKPRKLHWNVEQITRLFFTMSGKLLNLEERD 291

Query: 288 SPVLVIKTDKNIKGKGIHSNSSTEDIEWFALG 319
           SPVLV+K  K++ G+   S  S E + W A+G
Sbjct: 292 SPVLVLKLVKSLGGE---SGESNESLHWLAVG 320

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/37 (67%), Positives = 33/37 (89%)

Query: 368 YILRLVSLQFNDDMSILEVKDERLSVYLNDENPNAIR 404
           YI++L SLQ +D  SIL+VKDERLS+YLNDENPN+++
Sbjct: 377 YIIKLTSLQNHDQASILDVKDERLSLYLNDENPNSVK 413

>Kwal_14.1542
          Length = 204

 Score =  144 bits (363), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 117/204 (57%), Gaps = 7/204 (3%)

Query: 217 MKRGITRIIRRKDETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSV 276
           M++ +  + R+     +++Y +R+ +SF+DGRYH+ E  +E P+  E +I QI KLFF+ 
Sbjct: 1   MRKALVTVWRKSIGDREYDYFIRLKESFNDGRYHDPE--QETPKLKERDIWQITKLFFTA 58

Query: 277 SGKLLKLPERDSPVLVIKTDKNIKGKGIHSN-SSTEDIEWFALGXXXXXXXXXXXXXXXX 335
           SGKLLKL ER+SPVLV+K DK+IK      + +STED+EW A G                
Sbjct: 59  SGKLLKLEERNSPVLVLKVDKDIKSPFAEDHGTSTEDVEWLAFG----ECDFEADLEESS 114

Query: 336 XXXXXXXXXXAXXXXXXXXXXXXXXXXXXLLEYILRLVSLQFNDDMSILEVKDERLSVYL 395
                                        LLEYI+RL SLQ ND +SIL+V DERLS+YL
Sbjct: 115 ESEAEDEGDDESNYEETTESPVPVSDSIALLEYIIRLASLQCNDQLSILQVHDERLSMYL 174

Query: 396 NDENPNAIRETNSSINKIDEKLER 419
           NDENPN+I+    +++++  KL++
Sbjct: 175 NDENPNSIKSKRYNVDEVTTKLKK 198

>Scas_668.20
          Length = 425

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 99  KIHELTEKVEGSRTAKTQKDSINAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTN 158
           ++HELT+       ++  KD I    L  +++  R   ITP I + +  S    S N T 
Sbjct: 64  RMHELTQ------ASRNDKDLIKKFWLSFREMNYRHTWITPLIIMVIVYSAYFTSGNRTC 117

Query: 159 TVSPGLLLSASNYVVKNNDMFA 180
           T +P  +  A +Y V + D +A
Sbjct: 118 T-NPLHMFVAVSYQVDDTDEYA 138

>CAGL0H02849g complement(263305..263952) highly similar to sp|P40359
           Saccharomyces cerevisiae YJL072c, start by similarity
          Length = 215

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 94  DQFDDKIHELTEKVEGSRTAKTQK-----DSINAVELYIKDL-LDRIEEITPFI 141
           D F D +HEL  KV+  R  +  K       +NA  L + +L L  I E+ PFI
Sbjct: 134 DDFHDPVHELRSKVQDLREIRQTKVLKGLKQLNASHLQLDNLSLLEINELRPFI 187

>Kwal_26.7960
          Length = 575

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 28/67 (41%)

Query: 154 SNLTNTVSPGLLLSASNYVVKNNDMFAGEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTW 213
           S ++   SPG  L+ ++  V   D          PT     + + Y  P E++ +    W
Sbjct: 248 SQMSKPQSPGSSLAGNSPQVLARDSQIPTPAGPPPTMPLPEYQIIYQDPPEQYMSSSTHW 307

Query: 214 KEDMKRG 220
            + +KRG
Sbjct: 308 SDMIKRG 314

>AER115W [2620] [Homologous to ScYLR430W (SEN1) - SH]
            complement(853021..859104) [6084 bp, 2027 aa]
          Length = 2027

 Score = 29.3 bits (64), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 99   KIHELTEKVEGSRTAKTQKDSINAVELYIKDLLDRIEEI 137
            K+ ++  K +GS T+K   D I+ ++L ++DL  +I E+
Sbjct: 1463 KLRDMMNKEDGSPTSKLSTDEISKIQLKLRDLSKKINEL 1501

>CAGL0J06996g complement(668088..671405) similar to sp|P32873
           Saccharomyces cerevisiae YPL115c BEM3 GTPase-activating
           protein for CDC42P and RHO1P, hypothetical start
          Length = 1105

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 17/120 (14%)

Query: 59  EIVSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHEL--------TEKVEGS 110
           ++V Y  D I +V A+ N N  STL    DL+  + + D+  HE         TE+    
Sbjct: 94  KVVVYLRDNIGVVNAKYNVNKNSTLE---DLKKVVTEIDNAKHEHQFALPPRSTERTNNQ 150

Query: 111 RTAKTQKDSINAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTVSPGLLLSASN 170
           RT     D ++  E  +K  L ++ E TP    S T S  + S+   ++  P L  S +N
Sbjct: 151 RTT----DPLDDFENEMK--LKKVSENTPRPTPSATGSFQSNSTKTQSSEEPTLPSSYAN 204

>Kwal_55.20790
          Length = 449

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 41  KDDAKRIEKLRIKLQNRIEIVSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKI 100
           K+  K +E +RI+           ++ IR +    +  ++  +  T DL       +D I
Sbjct: 374 KNSKKFLEDVRIR----------CLENIRFLQGAPSVRMDQEVIPTQDLSALTQDEEDAI 423

Query: 101 HELTEKVEGSRTAKTQKDSINAVELY 126
            EL  + +  R  + +KDS+   ELY
Sbjct: 424 EELNAETDNLRLEQMEKDSMRVGELY 449

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,549,454
Number of extensions: 548296
Number of successful extensions: 2191
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2208
Number of HSP's successfully gapped: 42
Length of query: 419
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 315
Effective length of database: 12,995,837
Effective search space: 4093688655
Effective search space used: 4093688655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)