Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04114g91089743080.0
YGL227W (VID30)95864212521e-157
AFR242C82361911561e-145
Kwal_47.1917383662210621e-131
KLLA0A01221g87267810441e-128
Scas_712.239734469121e-108
Sklu_2101.3568127820.12
Kwal_23.3488502125820.13
ADL279W493116741.0
Scas_669.1058575741.2
KLLA0D10065g466120731.4
CAGL0F07799g58075731.7
YMR171C550116721.9
CAGL0H07491g511116694.3
Kwal_27.976386848694.6
KLLA0D01408g51848669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04114g
         (897 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces c...  1664   0.0  
YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulate...   486   e-157
AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH] (873480..8...   449   e-145
Kwal_47.19173                                                         413   e-131
KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces c...   406   e-128
Scas_712.23                                                           355   e-108
Sklu_2101.3 YMR171C, Contig c2101 5004-6710                            36   0.12 
Kwal_23.3488                                                           36   0.13 
ADL279W [1462] [Homologous to ScYMR171C - SH] complement(212401....    33   1.0  
Scas_669.10                                                            33   1.2  
KLLA0D10065g complement(851283..852683) similar to sp|Q03212 Sac...    33   1.4  
CAGL0F07799g complement(760681..762423) similar to sp|Q03212 Sac...    33   1.7  
YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protei...    32   1.9  
CAGL0H07491g 732854..734389 similar to sp|P38285 Saccharomyces c...    31   4.3  
Kwal_27.9763                                                           31   4.6  
KLLA0D01408g 120712..122268 some similarities with sp|P22136 Sac...    30   9.2  

>CAGL0I04114g 360592..363324 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30, start by similarity
          Length = 910

 Score = 1664 bits (4308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 822/897 (91%), Positives = 822/897 (91%)

Query: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHSKDEDRNGLLT 60
           MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHSKDEDRNGLLT
Sbjct: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHSKDEDRNGLLT 60

Query: 61  SSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNEKSHMKVP 120
           SSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNEKSHMKVP
Sbjct: 61  SSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNEKSHMKVP 120

Query: 121 GSATKSKFSKDIKKTMNEADDSLQRVHDVLDQYYLNSVSGENINVDSSIDPVERHSVRWR 180
           GSATKSKFSKDIKKTMNEADDSLQRVHDVLDQYYLNSVSGENINVDSSIDPVERHSVRWR
Sbjct: 121 GSATKSKFSKDIKKTMNEADDSLQRVHDVLDQYYLNSVSGENINVDSSIDPVERHSVRWR 180

Query: 181 DHDDIHSESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           DHDDIHSES                                                   
Sbjct: 181 DHDDIHSESERANERDETEAEEEADQIEDEDEDVEENSNDEDDDDDDEDEGEEEDEDAVD 240

Query: 241 ISEEGQERDLQTTSARDSIGSSDRLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTT 300
           ISEEGQERDLQTTSARDSIGSSDRLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTT
Sbjct: 241 ISEEGQERDLQTTSARDSIGSSDRLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTT 300

Query: 301 PNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNAL 360
           PNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNAL
Sbjct: 301 PNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNAL 360

Query: 361 TSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYKIANXXXXXXX 420
           TSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYKIAN       
Sbjct: 361 TSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYKIANDSDDEID 420

Query: 421 XXXXXXXALLELVKNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLDETFV 480
                  ALLELVKNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLDETFV
Sbjct: 421 LEKIDEKALLELVKNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLDETFV 480

Query: 481 GYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNA 540
           GYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNA
Sbjct: 481 GYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNA 540

Query: 541 IPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLID 600
           IPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLID
Sbjct: 541 IPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLID 600

Query: 601 ESQMEIDDDADESQLSLLQKGLILGKDNRISENMVLKPXXXXXXXXXXQDGSMISNLNVM 660
           ESQMEIDDDADESQLSLLQKGLILGKDNRISENMVLKP          QDGSMISNLNVM
Sbjct: 601 ESQMEIDDDADESQLSLLQKGLILGKDNRISENMVLKPDDLLLNTLNTQDGSMISNLNVM 660

Query: 661 INDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQ 720
           INDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQ
Sbjct: 661 INDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQ 720

Query: 721 ELRKLINQREIEKCITFLNDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAG 780
           ELRKLINQREIEKCITFLNDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAG
Sbjct: 721 ELRKLINQREIEKCITFLNDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAG 780

Query: 781 QNLSREFVFNNTIPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQ 840
           QNLSREFVFNNTIPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQ
Sbjct: 781 QNLSREFVFNNTIPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQ 840

Query: 841 LTNSTILKHMKKSSECALDNIVSYSRAMSLTLLNLNAKGKATVYEDDDAKLVDTARY 897
           LTNSTILKHMKKSSECALDNIVSYSRAMSLTLLNLNAKGKATVYEDDDAKLVDTARY
Sbjct: 841 LTNSTILKHMKKSSECALDNIVSYSRAMSLTLLNLNAKGKATVYEDDDAKLVDTARY 897

>YGL227W (VID30) [1771] chr7 (69670..72546) Protein that regulates
           expression of genes that are involved in nitrogen
           metabolism [2877 bp, 958 aa]
          Length = 958

 Score =  486 bits (1252), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/642 (42%), Positives = 391/642 (60%), Gaps = 49/642 (7%)

Query: 284 ALNTQKYMSKKKNNSTTPNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFI 343
           A N       KK NS  P++Y ++GYFLP++W  + NNS+ +S DGIT L+ NP++  ++
Sbjct: 298 ATNVLSNSGSKKKNSMIPDIYKILGYFLPSRWQAQPNNSLQLSQDGITHLQPNPDYHSYM 357

Query: 344 SNDRGDIF---ARNRLRNALTSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSA 400
           + +R        RNRLR +  +S K +F  T+A++ + + K+ IFYYE++VL VTS++SA
Sbjct: 358 TYERSSASSASTRNRLRTSFENSGKVDFAVTWANKSLPDNKLTIFYYEIKVLSVTSTESA 417

Query: 401 HNSNIVVGYK-IANXXXXXXXXXXXXXXALLELVKNFGAGDNNELGGLADIGGTLMG--- 456
            NSNIV+GYK + N              ++     + G  +N     +     T+ G   
Sbjct: 418 ENSNIVIGYKLVENELMEATTKKSVSRSSVAGSSSSLGGSNNMSSNRVPSTSFTMEGTQR 477

Query: 457 ---------RADSTATDPAPGLAKKNTLDETFVGYCGLSGNIS-ITSKEKPYSKPYGRDD 506
                     A S   D +    +K   D    GYCG  G I+  T + K Y+KP+GRDD
Sbjct: 478 RDYIYEGGVSAMSLNVDGSINKCQKYGFDLNVFGYCGFDGLITNSTEQSKEYAKPFGRDD 537

Query: 507 VIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVRTNFGLYEEFVFDI 566
           VIGCGIN+++GS+FFTKNG+ LG A + L ++  +PY+AL+ GNS++TNFGL E+FVFDI
Sbjct: 538 VIGCGINFIDGSIFFTKNGIHLGNAFTDLNDLEFVPYVALRPGNSIKTNFGLNEDFVFDI 597

Query: 567 NQYQKNWKRVAYKNIFKA-----SITSHQF------------PDTKNTLIDESQMEIDDD 609
             YQ  WK +AY++I +      SI                  + K+T ++E  M+ID +
Sbjct: 598 IGYQDKWKSLAYEHICRGRQMDVSIEEFDSDESEEDETENGPEENKSTNVNEDLMDIDQE 657

Query: 610 ADESQLSLLQK---------GLILGKDNRISENMVLKPXXXXXXXXXXQDGSMISNLNVM 660
              +     +K           +LG+DNR  +  +++P           DGS+ + LNVM
Sbjct: 658 DGAAGNKDTKKLNDEKDNNLKFLLGEDNRFIDGKLVRPDVNNINNLSVDDGSLPNTLNVM 717

Query: 661 INDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQ 720
           INDYLIHEGL+DVAKGFLKDLQK ++     N    E +++I+HNE QI++EE +++IRQ
Sbjct: 718 INDYLIHEGLVDVAKGFLKDLQKDAVNV---NGQHSESKDVIRHNERQIMKEERMVKIRQ 774

Query: 721 ELRKLINQREIEKCITFLNDKIPDLLGNNVELHFELRVVQYLIQL-SNSPKIDSNI--LI 777
           ELR LIN+ +I KCI +++++IPDLL NN+EL FEL++  YL+ +  +S K D  I  LI
Sbjct: 775 ELRYLINKGQISKCINYIDNEIPDLLKNNLELVFELKLANYLVMIKKSSSKDDDEIENLI 834

Query: 778 EAGQNLSREFVFNNTIPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDR 837
             GQ LS EF+++  IPQ LRD+F  QLSNVS+LL Y +PL EAP E+S Y S EYLQ+R
Sbjct: 835 LKGQELSNEFIYDTKIPQSLRDRFSGQLSNVSALLAYSNPLVEAPKEISGYLSDEYLQER 894

Query: 838 LFQLTNSTILKHMKKSSECALDNIVSYSRAMSLTLLNLNAKG 879
           LFQ++N+TIL  + K SECAL+N++S +RAM  TLL  NA G
Sbjct: 895 LFQVSNNTILTFLHKDSECALENVISNTRAMLSTLLEYNAFG 936

 Score =  122 bits (307), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 92/143 (64%), Gaps = 8/143 (5%)

Query: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHH-SKDEDRNGLL 59
           M+ ++D+VDREFI  LFP YLL+QPVAYDL  +Y +++K+F K    +  + DE+  G+ 
Sbjct: 1   MSEYMDDVDREFINCLFPSYLLQQPVAYDLWILYLQHRKLFHKLKNTNLINADENPTGV- 59

Query: 60  TSSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNEKSHMKV 119
              +   KL+  T+KEIW KLMNLGVLGT+SF+A ND+YL+Q YKYFY D N+      V
Sbjct: 60  --GMGRTKLTALTRKEIWSKLMNLGVLGTISFEAVNDDYLIQVYKYFYPDVNDFTLRFGV 117

Query: 120 PGSATKS----KFSKDIKKTMNE 138
             S   S    K S D++K   E
Sbjct: 118 KDSNKNSVRVMKASSDMRKNAQE 140

>AFR242C [3434] [Homologous to ScYGL227W (VID30) - SH]
           (873480..875951) [2472 bp, 823 aa]
          Length = 823

 Score =  449 bits (1156), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 253/619 (40%), Positives = 361/619 (58%), Gaps = 47/619 (7%)

Query: 281 LYPALNTQKYMSKKKNNSTTPNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQ 340
            YPA+   K+ +K+K N    +VY+ +GY LP  W  + NNS+LVS+DG T LR NPNWQ
Sbjct: 196 FYPAITDSKHSTKRKGNPLFSDVYSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNWQ 255

Query: 341 PFISNDRGDIFARNRLRNALTSSQKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSA 400
            +   D   I   NRLR ++ ++QK ++ +T+A+  +++KKVAIFYYE++VL VTS++S 
Sbjct: 256 LYSGYDNSPI-VNNRLRTSV-NNQKQQWASTWANACINHKKVAIFYYEIKVLSVTSAQSG 313

Query: 401 HNSNIVVGYKIANXXXXXXXXXXXXXXALLELVKNFGAGDNNELGGL-ADIGGTLMGRAD 459
              NI +G+K  +                        + D  E   L       L G  +
Sbjct: 314 QTCNINIGFKDWSKVASNAGEANTSDPP---------SRDPGEFSALNRQTSNILRGPFE 364

Query: 460 STATDPAPGLAKKNTLDETFVGYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSV 519
            +     P   + +T  + ++ Y G  G I+  S  K YSKPYGRDDVIGCGINYV+G++
Sbjct: 365 GSR----PTSQQSSTGKDVYI-YNGSDGYINDGSLFKSYSKPYGRDDVIGCGINYVDGTI 419

Query: 520 FFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYK 579
           FFTKNG+ LG A   + +++ +PY++LK  NS+RTNFGLYEEF+FDI  YQ +WK  AY 
Sbjct: 420 FFTKNGIHLGTAFKDVAHLDLVPYVSLKPANSIRTNFGLYEEFLFDIVGYQNHWKAKAYH 479

Query: 580 NIFKASITSHQFPDTKNTLIDESQMEIDD-----------------DADESQLSLLQK-- 620
           NIF A I+  +  D      DES+    D                 D D+   S L++  
Sbjct: 480 NIFTA-ISGGEESDFGFEDDDESEENAGDHLDADVQMNDTNAGVGQDYDDINNSTLERNQ 538

Query: 621 ------GLILGKDNRISENMVLKPXXXXXXXXXXQDGSMISNLNVMINDYLIHEGLIDVA 674
                 G +L  D R S   + KP           D S+   LN MINDYLIH GLIDVA
Sbjct: 539 QESHTDGFLLSWDTRFSGGQLYKPDKDKINNISGTDDSIPCTLNTMINDYLIHHGLIDVA 598

Query: 675 KGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEKC 734
           KGFLKDLQK  + N  + +     R +I+H+E QI REE  L+IRQ++R LI   +I +C
Sbjct: 599 KGFLKDLQKDCIPNNNEERT----RSVIRHHERQIKREEENLKIRQDIRLLIKDGDIPRC 654

Query: 735 ITFLNDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAGQNLSREFVFNNTIP 794
           I +++ K P LL  +VEL FE +V +YL+ +    ++  + +++ G  +S EF++N  + 
Sbjct: 655 IKYIDSKFPGLLTKHVELAFEFKVAEYLLAIMKLEQVTIDYVLQKGLEISNEFIYNEKLS 714

Query: 795 QELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKKSS 854
           QELR KF+    ++S+L+ Y++PL E P EL+ Y +P YLQDRLFQL N+TIL  +KK S
Sbjct: 715 QELRQKFKAHFGDISALMAYDNPLVECPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKS 774

Query: 855 ECALDNIVSYSRAMSLTLL 873
           E +L+N++SY+RAM  TL+
Sbjct: 775 ESSLENMISYTRAMVNTLM 793

 Score = 95.9 bits (237), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 84/142 (59%), Gaps = 4/142 (2%)

Query: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHS-KDEDRNGLL 59
           M+  +DE+D +++K+LFP YLLEQP+AY+L  +Y ++KK+F K         +   NG  
Sbjct: 1   MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHKKLFNKLKLKRRVIPNYTENGET 60

Query: 60  TSSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNEKS---H 116
                  KL+Y T+K IW+KL  LGVLG + +D+A DEYLVQ YKYFY+ +N+  +    
Sbjct: 61  ELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQVYKYFYTTHNDRLAGGDR 120

Query: 117 MKVPGSATKSKFSKDIKKTMNE 138
           +   G AT     +D    M E
Sbjct: 121 LLREGEATGGTAGRDEDVAMEE 142

>Kwal_47.19173
          Length = 836

 Score =  413 bits (1062), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 243/622 (39%), Positives = 367/622 (59%), Gaps = 27/622 (4%)

Query: 256 RDSIGSSDRLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTTPNVYNLMGYFLPTQW 315
           RDS GS    +      + KD   + +  L      +K + N  +  +Y  +GY LP  W
Sbjct: 208 RDSTGSRHNQNNSKSPTTEKD---QYFSPLTDGVQNAKLQKNYVSTELYKTLGYPLPHSW 264

Query: 316 MHK-ENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNALTS-SQKTEFVTTYA 373
             +  NN+++VS+DG ++L+ NP  +      RGD    +    + +S S K E+V+T A
Sbjct: 265 DSQFNNNNMVVSADGCSQLKPNPVLEGLPR--RGDSVVGSGFSVSYSSYSAKFEYVSTKA 322

Query: 374 DEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYKIANXXXXXXXXXXXXXXALLELV 433
           +  +S+KK+AIFYYE+R+L VTSS+S  N +I VG+K                 +  +L 
Sbjct: 323 NNFISSKKMAIFYYEIRILSVTSSQSGTNCSIKVGFK-----DVARFQAGSASSSRTDLQ 377

Query: 434 KNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLDETFVGYCGLSGNISITS 493
           ++     N +          +M  A  +++    G ++ +  D+   GYCG  G I+  +
Sbjct: 378 RSDPVSINRQ-------SANMMRAAGDSSSSSNSGKSRGDGFDKGSFGYCGQDGYITDGT 430

Query: 494 KEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVR 553
           + K Y K YGR+DVIGCG+NYV+G++FFTKNG+ LG A + + +V+  P+IALK GN VR
Sbjct: 431 QYKIYGKQYGRNDVIGCGVNYVDGTIFFTKNGLHLGTAFTDVYDVDLAPFIALKPGNMVR 490

Query: 554 TNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADES 613
           TNFGL+EEFVFDI  YQ+  K  AY++I+K+        D  +   DE+  E +  +   
Sbjct: 491 TNFGLHEEFVFDILSYQRMLKSKAYQHIYKSVDGHDGCNDFDSNDHDENDEECESSSGSD 550

Query: 614 QLSLLQKGLILGKDNRISENMVLKPXXXXXXXXXXQDGSMISNLNVMINDYLIHEGLIDV 673
                  G +L  D+R S + + +P           + S    +N MINDYLIHEGLIDV
Sbjct: 551 TTPDKSAGFVLQSDDRFSGDKLYRPEVEKLNNLSTDNESFSCTMNTMINDYLIHEGLIDV 610

Query: 674 AKGFLKDLQKFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEK 733
           AKGFLKDLQK  +    D  +    R +I+HNE QII+EEN L++RQ++R+ IN+ +I +
Sbjct: 611 AKGFLKDLQKDCIPGN-DKDLS---RMVIRHNERQIIKEENNLKVRQDIRRFINEGDITR 666

Query: 734 CITFLNDKIPDLLGNNVELHFELRVVQYLIQLSN--SPKIDSNILIEAGQNLSREFVFNN 791
           CITF++D  P L   N++L FEL+V +YL+   N  S  ID +IL++ GQ L+ EFV+++
Sbjct: 667 CITFIDDLYPGLFEKNIDLLFELKVAEYLLVFVNFKSHSID-DILLK-GQKLTAEFVYDS 724

Query: 792 TIPQELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMK 851
            +PQ+ +  FQ+ LS++S+LL Y++PLTE  ++L+   +P YLQDRLFQL NS +L  ++
Sbjct: 725 QVPQDYKQGFQNHLSDISALLAYDNPLTECSEDLAELLTPAYLQDRLFQLVNSRVLSFLE 784

Query: 852 KSSECALDNIVSYSRAMSLTLL 873
           K SE +L+N+VSY+R M   L+
Sbjct: 785 KKSESSLENMVSYTRGMIDALM 806

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 80/117 (68%), Gaps = 10/117 (8%)

Query: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHHSKDEDRN-GLL 59
           M+ ++D VDR ++++LFP YLLEQP+ ++L  IY  N+K+F      H  K++ +N   +
Sbjct: 1   MSHYMDRVDRAYVRALFPAYLLEQPIGHELWKIYLHNRKLF------HKLKNKGQNVANV 54

Query: 60  TSSILP---PKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYSDNNNE 113
             S +P    +LSY T+KEIW+KLM++GVLGT+ F A  D+YL+Q Y YFY D ++E
Sbjct: 55  KESGIPKHKSELSYATRKEIWEKLMSMGVLGTIPFTAVEDDYLMQVYHYFYPDLDDE 111

>KLLA0A01221g 113308..115926 similar to sp|P53076 Saccharomyces
           cerevisiae YGL227w VID30 singleton, start by similarity
          Length = 872

 Score =  406 bits (1044), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/678 (34%), Positives = 367/678 (54%), Gaps = 79/678 (11%)

Query: 252 TTSARDSIGSSD-------RLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNSTTPNVY 304
           TT   + IG+SD        + R  H +         YP     K+  + K+N     +Y
Sbjct: 216 TTGFENPIGTSDAENIENAEVDRSKHKHKIV-----YYPESKESKHTVQLKSNPVPGEIY 270

Query: 305 NLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGDIFARNRLRNALTSSQ 364
             +GY LP +W+ + +NSIL+S DG   LR NPNW    S  R      +RLR  + S +
Sbjct: 271 KTLGYPLPHKWLLQSDNSILLSQDGCAVLRVNPNWHALSSYGRASPIMNSRLRVNINSKK 330

Query: 365 KTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSAHNSNIVVGYK--------IANXXX 416
           K ++ TT+A+  V++ K AIFY+E+RVL VTSS++  NS+++VG+K        ++    
Sbjct: 331 KQQWATTWANNGVNHTKCAIFYFEIRVLSVTSSQAGRNSHVLVGFKNWAKINDKLSTSEQ 390

Query: 417 XXXXXXXXXXXALLELVKNFGAGDNNELGGLADIGGTLMGRADSTATDPAPGLAKKNTLD 476
                          +++N   G+ N L   +    T+ G  ++ +              
Sbjct: 391 DTTESGSAPSSENFNMLRNVLDGNRNVLNSPSSPSQTIHGDVETYS-------------- 436

Query: 477 ETFVGYCGLSGNISITSKEKPYSKPYGRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLM 536
                Y GL GN    S  + YS+P+G DD++GCG+N++ GS+FFTKNG+FLG A     
Sbjct: 437 -----YSGLDGNKFDASGSQKYSRPFGNDDIVGCGVNFIEGSIFFTKNGIFLGNAFEDCF 491

Query: 537 NVNAIPYIALKSGNSVRTNFGLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKN 596
           +++ +P++++KSGNS+RTNFGL EEF+FDI+QYQ  WK   Y +IFKA      +    N
Sbjct: 492 DIDLVPFVSIKSGNSLRTNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAV----DYDSGLN 547

Query: 597 TLIDESQME----IDDDADESQLSLLQK-------------------GLILGKDNRISEN 633
            + DES  E    + D+ +++     Q+                   G +L +D R S +
Sbjct: 548 LVSDESDNEDLGKLGDEINDTLEPEFQEVASEENDLATDGFEDDQPDGFLLTRDRRFSGD 607

Query: 634 MVLKPXXXXXXXXXXQDGSMISNLNVMINDYLIHEGLIDVAKGFLKDLQKFSLTNPYDNQ 693
            + KP           + S+   LN MINDYLIHEG IDVAKGFLKDLQ+  + N  D +
Sbjct: 608 KLWKPTTPKLNNINSNNDSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCIPNNSDER 667

Query: 694 IQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEKCITFLNDKIPDLLGNNVELH 753
                R +I+HNE QI++EE  L++RQ +R+ I+  EI KC+ ++  + P LL   +EL 
Sbjct: 668 A----RFVIRHNERQIVKEEQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYLELT 723

Query: 754 FELRVVQYLIQLS-NSPK---IDSNILIEAGQNLSREFVFNNTIPQELRDKFQDQLSNVS 809
           FE++   YL+ LS  SP+   IDS  ++  GQ++S +F+ N  I  + R+ F+ +   +S
Sbjct: 724 FEMKCADYLLCLSQQSPENDMIDS--ILSKGQDISEQFLQNRAISDDTREIFKAKFDEIS 781

Query: 810 SLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKKSSECALDNIVSYSRAMS 869
            L+ Y +P  E  ++ S++ +P YLQ+RLFQ  NS IL+++ K S+ +L++++ Y+RAM 
Sbjct: 782 PLMAYSNPSKECANDCSFFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAMV 841

Query: 870 LTLL---NLNAKGKATVY 884
            TL+   + N + K   Y
Sbjct: 842 TTLMENESYNPREKEPAY 859

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 76/108 (70%), Gaps = 4/108 (3%)

Query: 5   LDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIF--CKTPYFHHSKDEDRNGLLTSS 62
           +D +D E++ S+FP+YLL+QP+ +DL  +Y ++KK+F   KT     S D D +G ++  
Sbjct: 6   MDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHKLKTKDELLSADADCSGSVSFQ 65

Query: 63  IL--PPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQAYKYFYS 108
            L  P +LS  T+KEIW+KL  LGVLGT+ +D+ +D+YL+Q +KYFY+
Sbjct: 66  SLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDDYLIQVHKYFYA 113

>Scas_712.23
          Length = 973

 Score =  355 bits (912), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/446 (41%), Positives = 282/446 (63%), Gaps = 29/446 (6%)

Query: 447 LADIGGTLMGRADSTATDPAPGLAK----KNTLDETFVGYCGLSGNISITSKEKPYSKPY 502
           +  +GG +    D + T+   G+ K    K+ L++ F GYCG  G I + ++ K YS+ +
Sbjct: 521 VGALGGVVNADGDDSNTNLGMGIDKSRGNKDGLEDGFFGYCGDDGFICVGTESKKYSQMF 580

Query: 503 GRDDVIGCGINYVNGSVFFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVRTNFGLYEEF 562
           GRDD+IGCGINY++G++FFTKNGVFLG A +++ ++N +P IALK GNSVRTNFG+YEEF
Sbjct: 581 GRDDIIGCGINYIDGTIFFTKNGVFLGTAFTNVYDLNVVPSIALKPGNSVRTNFGIYEEF 640

Query: 563 VFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLSLLQKGL 622
           VFDI  YQ NWK  +   IFK+    + F D K+    E+                +   
Sbjct: 641 VFDIGNYQNNWKNKSLNKIFKS--LDYDF-DCKDGNTTENNQ--------------KASF 683

Query: 623 ILGKDNRISENMVLKPXXXXXXXXXXQDGSMISNLNVMINDYLIHEGLIDVAKGFLKDLQ 682
           +LGKD+RI +  + KP           + S+ + LNVMINDYL+HEG++D+AK FLKDL+
Sbjct: 684 LLGKDDRIDDMNIKKPNSIRLNDLNVNNDSIPNTLNVMINDYLLHEGMVDLAKSFLKDLR 743

Query: 683 KFSLTNPYDNQI----QIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEKCITFL 738
              + +   + +      + +++I +N+ QI +EE ++ IRQE+R+L+ +R IE+CI ++
Sbjct: 744 NDCIEDDIGDNVGNANMNDMKQVIDYNDKQIQKEETLVYIRQEIRRLVLERNIEECIKWI 803

Query: 739 NDKIPDLLGNNVELHFELRVVQYLIQLSNSPKIDS----NILIEAGQNLSREFVFNNTIP 794
           N ++P LL +++EL FE+++ QYLI +  S K       N L+  GQ L  +FV+N  I 
Sbjct: 804 NLQLPGLLESDMELLFEMKLCQYLITIIESSKTKDDKCINDLLRTGQGLYNQFVYNEQID 863

Query: 795 QELRDKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKKSS 854
             LR+ FQ QL+NVSSLL Y+DP+ E   +LS Y S EYL+ RLFQ+ NS +L+ + K S
Sbjct: 864 GALRESFQFQLNNVSSLLAYDDPINEVTGDLSIYVSNEYLEGRLFQIINSKVLQFLNKRS 923

Query: 855 ECALDNIVSYSRAMSLTLLNLNAKGK 880
           +C+L+++V Y+RAM  T++N    G+
Sbjct: 924 DCSLEDMVVYTRAMLSTMMNYKVGGE 949

 Score =  109 bits (272), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 85/147 (57%), Gaps = 31/147 (21%)

Query: 1   MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKTPYFHH----------- 49
           M+ + D++DR+FIKSL+PEYLL QP+AY+L  +Y +++K+F K     H           
Sbjct: 1   MSSYSDQIDRQFIKSLYPEYLLHQPIAYELKALYNQHRKLFSKLSESEHLDPSNRPKSGL 60

Query: 50  SKDED------RNGLLTSSILPP--KLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQ 101
           SK  +      RN  + SS      KL +  KKEIW KLM LGVLGT+SF++AND YL+Q
Sbjct: 61  SKGAEHFDETYRNVSIESSNTSGGDKLPFHIKKEIWHKLMELGVLGTISFESANDNYLIQ 120

Query: 102 AYKYFYSDNNNEKSHMKVPGSATKSKF 128
            YK FY            PG++ KS +
Sbjct: 121 VYKLFY------------PGTSVKSLY 135

 Score = 99.0 bits (245), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 83/132 (62%), Gaps = 12/132 (9%)

Query: 293 KKKNNSTTPNVYNLMGYFLPTQWMHKENNSILVSSDGITELRANPNWQPFISNDRGD--- 349
           K K N   P++Y ++GYFLP QW    NNS+ V+SDG+  L  NPN+Q  ++ +      
Sbjct: 298 KLKKNGVAPDIYRIIGYFLPNQWNPPPNNSLSVTSDGVMNLAPNPNYQKTVTEESTTGSG 357

Query: 350 ---IFARNRLRNALTSS------QKTEFVTTYADEIVSNKKVAIFYYEVRVLDVTSSKSA 400
                 RNRLRN +T +       K++++T  A+ ++ + KV+IFYYE+RVL VTSS +A
Sbjct: 358 TPASIVRNRLRNTITGNLQSGNRSKSDYLTACANNVIPSSKVSIFYYEIRVLTVTSSLNA 417

Query: 401 HNSNIVVGYKIA 412
            NSNI+VG+K A
Sbjct: 418 QNSNIIVGFKYA 429

>Sklu_2101.3 YMR171C, Contig c2101 5004-6710
          Length = 568

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 52/127 (40%), Gaps = 11/127 (8%)

Query: 502 YGRDDVIGCGINYVNGSVFFTKNGVFL-----GEAVSSLMNVNAIPYIALKSGNSVRTNF 556
           Y + D+IG G    +G+VFFT+NG  L     G  +         P +       V  NF
Sbjct: 346 YQKGDIIGIGYRTNSGTVFFTRNGKKLNEKPIGGHIKGWKLKYLYPIVGANVPCKVHVNF 405

Query: 557 GLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLS 616
           G Y  FVF     + N K+  Y       +    + +    ++ ES  E DD  D   +S
Sbjct: 406 GSY-GFVF----IEANVKKWGYAKSHGVKLPPPSYDEYGQDVLLESSYE-DDITDNESVS 459

Query: 617 LLQKGLI 623
            ++  ++
Sbjct: 460 TVEGDIV 466

>Kwal_23.3488
          Length = 502

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 504 RDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNFGL 558
           + DVIG G    +G+VFFT+NG  L E ++   +      Y+    G++    V  NFG 
Sbjct: 299 KGDVIGIGYRTNSGTVFFTRNGKKLNEKSIGGHIKGWKFKYVYPIVGSNIPCKVHVNFGT 358

Query: 559 YEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLSLL 618
           Y  FVF     + N K+  Y       +    + D    ++ ES  E DD  D    S +
Sbjct: 359 Y-GFVF----IEANVKKWGYAKSNGMKLPPPSYEDYSQDVLLESSYE-DDATDNESTSTI 412

Query: 619 QKGLI 623
              +I
Sbjct: 413 DGDII 417

>ADL279W [1462] [Homologous to ScYMR171C - SH]
           complement(212401..213882) [1482 bp, 493 aa]
          Length = 493

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 12/116 (10%)

Query: 504 RDDVIGCGINYVNGSVFFTKNGVFLGEA-VSSLMNVNAIPYIALKSGNSV----RTNFGL 558
           + DVIG G    +G+VFFT+NG  L E  +   +    I Y+    G +V      NFG 
Sbjct: 292 KGDVIGIGYRTRSGTVFFTRNGKKLNEKRIGGHIKGWKIKYLYPIVGANVPCKIHVNFGT 351

Query: 559 YEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQ 614
           Y  FV+     + N K+  Y  +    +    + D    ++ ES  E  D+  E +
Sbjct: 352 Y-GFVY----IEANVKKWGYAKLNGMKLPPPAYEDYDRDVLLESSYE--DEVSEGE 400

>Scas_669.10
          Length = 585

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 504 RDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNFGL 558
           R D+IG G    +G+ FFT+NG  + E ++   +    I Y+    G +    V  NFG 
Sbjct: 325 RGDIIGVGYRTRSGTFFFTRNGKKVSEKSIGGHIKGCKIKYLYPIVGTNVPCKVHVNFGT 384

Query: 559 YEEFVFDINQYQKNW 573
           Y  FV+ I    K W
Sbjct: 385 Y-GFVY-IEANVKKW 397

>KLLA0D10065g complement(851283..852683) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, start by similarity
          Length = 466

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 502 YGRDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNS----VRTNF 556
           + + DVIG G    +G++FFT NG  L E  V   +    + Y+    G++    +  NF
Sbjct: 281 FEKGDVIGIGYRTRSGTIFFTHNGKKLNEKKVGGHIKGWKLKYLYPIVGSNIPCKIHVNF 340

Query: 557 GLYEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLS 616
           G Y  FV+     + N K+  Y       +    + D    ++ ES  E DD +D   ++
Sbjct: 341 GTY-GFVY----IEANVKKWGYSKNAGIKLPPPSYEDYDQDVLLESAFE-DDVSDSESIT 394

>CAGL0F07799g complement(760681..762423) similar to sp|Q03212
           Saccharomyces cerevisiae YMR171c, hypothetical start
          Length = 580

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 7/75 (9%)

Query: 504 RDDVIGCGINYVNGSVFFTKNGVFLGEA-----VSSLMNVNAIPYIALKSGNSVRTNFGL 558
           + D+IG G    +G+VFFT+NG  + E      +         P +       +  NFG 
Sbjct: 326 KGDIIGIGYRTRSGTVFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGS 385

Query: 559 YEEFVFDINQYQKNW 573
           Y  FVF I    K W
Sbjct: 386 Y-GFVF-IEANVKKW 398

>YMR171C (YMR171C) [4126] chr13 complement(603867..605519) Protein
           containing a SPRY (SPla and RYanodine Receptor) domain,
           has moderate similarity to uncharacterized C. albicans
           Orf6.5491p [1653 bp, 550 aa]
          Length = 550

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 11/116 (9%)

Query: 504 RDDVIGCGINYVNGSVFFTKNGVFLGE-AVSSLMNVNAIPYIALKSGNSV----RTNFGL 558
           + D++G G    +G+VFFT+NG  L E +V   +      Y+    G++V      NFG 
Sbjct: 313 KGDIVGIGYRSRSGTVFFTRNGKKLNEKSVGGHIRGWKFQYLYPIIGSNVPCQIHVNFGT 372

Query: 559 YEEFVFDINQYQKNWKRVAYKNIFKASITSHQFPD-TKNTLIDESQMEIDDDADES 613
           Y  FV+     + N K+  Y       +    + D  K+TL++    + D D D S
Sbjct: 373 Y-GFVY----IEANVKKWGYAKSNGIKLPPPSYEDYGKDTLLESGGEDNDFDEDFS 423

>CAGL0H07491g 732854..734389 similar to sp|P38285 Saccharomyces
           cerevisiae YBR158w CST13, hypothetical start
          Length = 511

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 48/116 (41%), Gaps = 9/116 (7%)

Query: 241 ISEEGQERDLQTT-SARDSIGSSDRLSRRAHSYSAKDNASRLYPALNTQKYMSKKKNNST 299
           I+      DL  T S   S+  + R SR+   Y+ K    + Y       + SKK+ N+ 
Sbjct: 34  ITPNSSHEDLSATISNEGSLNFTPRTSRQESLYNMKKIFQKTYSQTKLGLFSSKKQVNTL 93

Query: 300 TPNVYNLMGYFLPTQWMHKENNSILVSS-DGITELRANPNWQPFISNDRGDIFARN 354
              +       LPT     E N+IL S+ + +T LR        ISND  D   RN
Sbjct: 94  ETAIPTTPKQQLPTPTTSPEKNNILWSTPNSLTSLRT-------ISNDLDDCRNRN 142

>Kwal_27.9763
          Length = 868

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 10  REFIKSLFPEYLLEQPVAYDLL---WIYRENKKIFCKTPYFHHSKDED 54
           R+F++S F + + ++P A DLL   WI+   K I  +   F  S DED
Sbjct: 242 RKFLRSCFQKNMFKRPKAQDLLSHEWIFETKKPILER---FKESDDED 286

>KLLA0D01408g 120712..122268 some similarities with sp|P22136
           Saccharomyces cerevisiae YMR282c AEP2 required for the
           expression of subunit-9 of atp synthase singleton,
           hypothetical start
          Length = 518

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 695 QIEEREIIKHNESQIIREENVLRIRQE--LRKLINQREIEKCITFLND 740
           Q+ +R  IK  ++  I E  VL   Q   ++ L+NQ E  KC+ F+N+
Sbjct: 423 QVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNENAKCVDFINE 470

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,848,474
Number of extensions: 1311002
Number of successful extensions: 3675
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3755
Number of HSP's successfully gapped: 51
Length of query: 897
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 786
Effective length of database: 12,753,511
Effective search space: 10024259646
Effective search space used: 10024259646
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)