Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I04092g55654124000.0
Scas_712.226242516541e-77
YGL228W (SHE10)5772555314e-60
KLLA0A01177g6362504511e-48
AFR244C5722444122e-43
Sklu_2433.186272464018e-42
Kwal_47.191847122533543e-35
YFR039C5102322929e-28
CAGL0C02167g4802562441e-21
Scas_687.205712542333e-20
Sklu_2249.21083102692.5
CAGL0K03993g15772653.7
Kwal_55.20421117081665.8
KLLA0D16005g117081658.0
Kwal_26.805963160658.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I04092g
         (547 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...   929   0.0  
Scas_712.22                                                           256   1e-77
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...   209   4e-60
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...   178   1e-48
AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...   163   2e-43
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                        159   8e-42
Kwal_47.19184                                                         140   3e-35
YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...   117   9e-28
CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...    99   1e-21
Scas_687.20                                                            94   3e-20
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          31   2.5  
CAGL0K03993g complement(368661..369134) weakly similar to sp|P53...    30   3.7  
Kwal_55.20421                                                          30   5.8  
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...    30   8.0  
Kwal_26.8059                                                           30   8.1  

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/541 (84%), Positives = 459/541 (84%)

Query: 1   MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPALWNDYLLKNSPAYKNSV 60
           MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPALWNDYLLKNSPAYKNSV
Sbjct: 1   MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPALWNDYLLKNSPAYKNSV 60

Query: 61  HPQLVVAKGKYEELVQPHVKDVCKRVHTQLDRIDKKKYCDLAHSYANLAYQKAQFYYSIS 120
           HPQLVVAKGKYEELVQPHVKDVCKRVHTQLDRIDKKKYCDLAHSYANLAYQKAQFYYSIS
Sbjct: 61  HPQLVVAKGKYEELVQPHVKDVCKRVHTQLDRIDKKKYCDLAHSYANLAYQKAQFYYSIS 120

Query: 121 AGKYVHDFCKSDLYNKNLKRHVERAKEDLSKAYHLAVVRIPQLFTRENVEKFTSSASAYI 180
           AGKYVHDFCKSDLYNKNLKRHVERAKEDLSKAYHLAVVRIPQLFTRENVEKFTSSASAYI
Sbjct: 121 AGKYVHDFCKSDLYNKNLKRHVERAKEDLSKAYHLAVVRIPQLFTRENVEKFTSSASAYI 180

Query: 181 NEKTESLKKEAKQITSDVKKTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           NEKTESLKKEAKQITSDVKKTV                                      
Sbjct: 181 NEKTESLKKEAKQITSDVKKTVESEIKKRTTSSESEEEPIVSTSTIVKTITRTRHSSSST 240

Query: 241 XXXXXXXXXXXXNLXXXXXXXXXXXXXXHQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVK 300
                       NL              HQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVK
Sbjct: 241 TSTKSAEETSEKNLETKEEEDITDIEIDHQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVK 300

Query: 301 KHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGK 360
           KHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGK
Sbjct: 301 KHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGK 360

Query: 361 SQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEEWG 420
           SQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEEWG
Sbjct: 361 SQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEEWG 420

Query: 421 DIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQI 480
           DIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQI
Sbjct: 421 DIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQI 480

Query: 481 KISEFKLLLDNVQNTLQAVTNENGEYLYILRAQANLAFQXXXXXXXXXXXXXXXXXXGEV 540
           KISEFKLLLDNVQNTLQAVTNENGEYLYILRAQANLAFQ                  GEV
Sbjct: 481 KISEFKLLLDNVQNTLQAVTNENGEYLYILRAQANLAFQERERLEKEAEEAKLRKEAGEV 540

Query: 541 N 541
           N
Sbjct: 541 N 541

>Scas_712.22
          Length = 624

 Score =  256 bits (654), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 186/251 (74%), Gaps = 1/251 (0%)

Query: 269 HQAQLQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDN 328
            Q  LQ DFD W++ I++K+  +NK+  +DV K +K ++ +N++ FKDK++ L++E+   
Sbjct: 278 EQQLLQSDFDNWSNTIEQKIASINKLFDKDVAKLIKKEMKSNEQKFKDKIQNLNQESELL 337

Query: 329 FQLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVA 388
           FQ +NKAIQDINCT+ +DP+T + IYFD  G++Q+E+YI R +IR +   T+ TLN L+A
Sbjct: 338 FQDLNKAIQDINCTESLDPQTNETIYFDRNGETQLEQYIERPLIRELFEKTRATLNELIA 397

Query: 389 DIENDVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGK 448
           DI+ND + ++E   K  E+ R++HL  +EEWG+IM+NEWSK++AY+DV+A H +AE E +
Sbjct: 398 DIQNDENVLIEKVNKKVESIRDEHLDVYEEWGEIMVNEWSKRMAYVDVVAAHLNAE-EKE 456

Query: 449 SKTELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEYLY 508
           +K  +SE+NWKKF+ +KKQ++ ARD++ +    I   +  L+N+Q TL+ ++ + GEYLY
Sbjct: 457 AKKTMSEENWKKFLKVKKQVIGARDELVEHVPNIKTMEQFLNNIQETLKMLSKDAGEYLY 516

Query: 509 ILRAQANLAFQ 519
           ILRA+ANLAFQ
Sbjct: 517 ILRARANLAFQ 527

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 61/137 (44%), Gaps = 14/137 (10%)

Query: 1   MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPALWNDYLLKNSPAYKNSV 60
           M+F +K  + + T+   L Y C+    A   QL   CHY+ P  W+ +L   S  YK  V
Sbjct: 1   MKFCSKLFVTVLTLVVSLHYFCQVNDCAD--QLLQICHYTSPNTWDQFLSDKSVTYKLQV 58

Query: 61  HPQLVVAKGKYEELVQPHVKDVCKRVHTQLDR------------IDKKKYCDLAHSYANL 108
            P+++ AK +Y   V+P + ++ ++VH +  R             D   Y +       L
Sbjct: 59  APRIIQAKEQYSIHVEPSLNELYEKVHEKAIRPATVFVMKYYENFDAAPYKNCILKNVAL 118

Query: 109 AYQKAQFYYSISAGKYV 125
              K  FYY+IS    V
Sbjct: 119 IRHKFWFYYNISVKPVV 135

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score =  209 bits (531), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/255 (41%), Positives = 163/255 (63%), Gaps = 8/255 (3%)

Query: 270 QAQLQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNF 329
           QA LQ DFD W+  I +K + V ++  +DV K++  K+      FK K + L  ++   F
Sbjct: 272 QALLQEDFDMWSETILQKTQDVIQLFEKDVSKYINGKLVEEANHFKAKFQSLDDKSKKFF 331

Query: 330 QLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVAD 389
             I+ AI DI C +GID ETGK+I+FD  G ++I +YITRE++R   N+T++TL+ L   
Sbjct: 332 SKISLAINDIECVEGIDSETGKKIFFDKSGSTEISQYITRELVREYFNETRSTLDELTNA 391

Query: 390 IENDVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAE----- 444
           +E D+S+I ++ +K     RE+++  FEEWGDI++NEWSK++AY+DV+  H  A+     
Sbjct: 392 MEKDLSEITDEIEKKVNAIREENVEVFEEWGDIIVNEWSKRMAYVDVINAHMGADDDTTL 451

Query: 445 HEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENG 504
            E K+K+ +   NWKKF+  KKQI+++RDK+A     +S        VQ  + + T E+G
Sbjct: 452 DEEKAKSSV---NWKKFLKGKKQIIESRDKLAHHSADLSRVNAFRQKVQKKILSFTQESG 508

Query: 505 EYLYILRAQANLAFQ 519
           E+LYILR++ANL FQ
Sbjct: 509 EFLYILRSKANLQFQ 523

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 13/117 (11%)

Query: 1   MRFLTKFLLFLATVYFGLKYACE-SPLRAQYPQLQLACHYSQPALWNDYLLKNSPAYKNS 59
           M  L K +  L  +   L+Y CE +       + Q  CHY+ P +WN Y  +N   YKN 
Sbjct: 1   MGKLIKLITTLTVLVSLLQYCCEFNSGSISCERTQTLCHYTNPRVWNTYFSRNCELYKNK 60

Query: 60  VHPQLVVAKGKYEELVQPHVKDVC------------KRVHTQLDRIDKKKYCDLAHS 104
           V P   +   KY+  V+P + D              K +H+Q  + +  KY  L  S
Sbjct: 61  VSPGFDIVARKYDTAVKPVIDDATVKVNKVAIQPAFKVIHSQCKKWNCGKYYQLVRS 117

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score =  178 bits (451), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 146/250 (58%), Gaps = 11/250 (4%)

Query: 273 LQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLI 332
           L+ DF  W   I+ K+    K    D+ +  + K+D       D LK     +  NFQ+I
Sbjct: 316 LRNDFMSWKITIENKLSNTMKDFENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQII 375

Query: 333 NKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIEN 392
            KAI D+NCT+ +DP+T K I+FD +  +Q+ KY+TRE++R   +   +  ++L  +I  
Sbjct: 376 TKAIMDVNCTESVDPKTNKTIWFD-QNNTQLPKYMTRELMREYFSAAHSQFDALSQEIRA 434

Query: 393 DVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHE---DAEHEGKS 449
            + K+ ++     E  R++++  FEEW D+MI EWSK LAY+DV    E   D E E + 
Sbjct: 435 HLRKLADEVNDHVEVLRQENVELFEEWADVMITEWSKNLAYVDVAVNEEKLADLEKEQR- 493

Query: 450 KTELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEYLYI 509
                 KNWK FM +K+Q++  RD + +  +K+   +  ++ VQ +L+ +++ENGEYLYI
Sbjct: 494 ------KNWKDFMKLKRQVIKTRDTLMEHPVKLDSLQSFVNTVQQSLKTLSHENGEYLYI 547

Query: 510 LRAQANLAFQ 519
           LR++ANL FQ
Sbjct: 548 LRSKANLEFQ 557

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score =  163 bits (412), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 148/244 (60%), Gaps = 8/244 (3%)

Query: 276 DFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKA 335
           +F  W   I++K   V +    +V +    + +A    F+  LK +  ++ +++  IN+A
Sbjct: 251 EFSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQA 310

Query: 336 IQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIENDVS 395
           I+DIN T  +DP T + I+FD+ G +Q+ +YITR ++R   +     L ++   I  ++ 
Sbjct: 311 IRDINSTMELDPATNQTIWFDAHG-TQLHQYITRPLMREYFSQANDELANITNHIRAELR 369

Query: 396 KILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSE 455
           ++++      +  R++H+  +EEW D+M++EWS+++AY+DV+    +AE E         
Sbjct: 370 EVVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAEAE-------RN 422

Query: 456 KNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEYLYILRAQAN 515
           +NWK+F+ +KK+++  RD++ +  +K ++ +  L  +Q+TL+ +  ENGEYLYILR++AN
Sbjct: 423 RNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENGEYLYILRSKAN 482

Query: 516 LAFQ 519
           L+FQ
Sbjct: 483 LSFQ 486

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score =  159 bits (401), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 141/246 (57%), Gaps = 9/246 (3%)

Query: 273 LQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLI 332
           +Q ++  W++ +++K         ++V  +   ++++   L    L+ +      +FQ I
Sbjct: 274 VQNEYQAWSNTVERKANTALDAFTKEVHDYEIEQLESVSPLMSSLLQNISNTTQLHFQKI 333

Query: 333 NKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIEN 392
           NKAI DINCT  I  E G+Q++FD  G +Q+++YITR ++R +       L ++  D+  
Sbjct: 334 NKAILDINCTMEIG-ENGEQLFFDRHG-TQLKEYITRPLMRGLFTAANEELTAMSDDLRA 391

Query: 393 DVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTE 452
            + + +       +  R +HL  +EEWGD+MI+EWSK++AY+DV+A  E  + E  S   
Sbjct: 392 RLKEFVNTVNDHVDVIRNEHLEVYEEWGDVMISEWSKRMAYVDVVALDEQDDSEQHS--- 448

Query: 453 LSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEYLYILRA 512
               NWK F+ +K+ ++  RD + +  +K  + ++ L  VQ TL+ +  E+GEYLYILR+
Sbjct: 449 ----NWKNFLKLKRNVIKTRDLLVEHPVKFHDLEVFLKEVQFTLRMLAKESGEYLYILRS 504

Query: 513 QANLAF 518
           +ANL F
Sbjct: 505 KANLTF 510

>Kwal_47.19184
          Length = 712

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 142/253 (56%), Gaps = 18/253 (7%)

Query: 273 LQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQL- 331
           +Q +F+ W++ + +K    N +   D +  ++  +D+     +  +  L +  +D+ Q  
Sbjct: 268 VQDEFEAWSTAVQQKAS--NTLSQFDAE--IQDLVDSKLSEIRPNVTTLLQSISDSCQAY 323

Query: 332 ---INKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVA 388
              INKAI D++C   +DP TG+Q+YF+ +G +Q+ KY+TR ++R   +     +   + 
Sbjct: 324 YRDINKAILDVDCNMELDPVTGEQLYFNRDG-TQLRKYMTRPLMREYFSAAHAHVEERLE 382

Query: 389 DIENDVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGK 448
            +   + K +    K  +  R++ L  +EEWGD+MI+EWSK++AY D+        H   
Sbjct: 383 FVRAQLEKFVAMVNKEVDEIRQESLELYEEWGDVMISEWSKRMAYGDIF-------HAIG 435

Query: 449 SKT--ELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEY 506
           S +  +    NWK+F+ +KK+++  RD++ +   K+      L ++Q TL A+  + GEY
Sbjct: 436 SDSFDQQQHDNWKQFLKLKKRVVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEY 495

Query: 507 LYILRAQANLAFQ 519
           L+ILR+QANLAFQ
Sbjct: 496 LFILRSQANLAFQ 508

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score =  117 bits (292), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 123/232 (53%), Gaps = 8/232 (3%)

Query: 273 LQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLI 332
           L+ +++ W   ID K+     +L  +++   + ++          L  L+   N+    +
Sbjct: 248 LKMEYEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFL 307

Query: 333 NKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIEN 392
           +  I+DINCT   DP   K  YFD  G+ ++E YIT+  I ++L + +  L      + +
Sbjct: 308 DSKIKDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFH 367

Query: 393 DVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTE 452
            +   L +  K+AE+ R +++  +EEWGD+MI++WS+++AY+DV   H + +++  +  E
Sbjct: 368 SLDSFLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYD-PAYIE 426

Query: 453 LSEKNWKKFMAIKKQILDARDKMAKRQIK-------ISEFKLLLDNVQNTLQ 497
            +  NW +FM +KK+++  R+++ K  +        I++ K    N +N +Q
Sbjct: 427 ENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKNNIQ 478

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 123/256 (48%), Gaps = 22/256 (8%)

Query: 277 FDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAI 336
           F+ W  +I +K K +   L ++V   +   + +  + F+  ++ L  + +    ++   +
Sbjct: 214 FNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTV 273

Query: 337 QDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSK 396
           Q+INCT   D  T    Y+D  G+  ++ Y+TR +I   L  T+T L  LV  ++  V  
Sbjct: 274 QNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN 333

Query: 397 ILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEH------EGKSK 450
           ++E      E  R + +  +EEWGD    EWSK +AY D+    ED E       +GK K
Sbjct: 334 MVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIY--DEDGEEPRPLAIDGKGK 391

Query: 451 TELSE--------KNWKKFMAIKKQILDARDKMAKRQI---KISEFKLLLDNVQNTLQAV 499
            E           ++W +F   KK I+  RD++  +Q+   K+ +F+  LD+  ++L+  
Sbjct: 392 GEDQGDDEVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKT 451

Query: 500 TNENGEYLYILRAQAN 515
                  +  LR+QA+
Sbjct: 452 YTAQ---IQSLRSQAD 464

>Scas_687.20
          Length = 571

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 129/254 (50%), Gaps = 12/254 (4%)

Query: 270 QAQLQRDFDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKV----LHKEA 325
           +  L  +F+ W + ++ K    N +L    +  ++  I+   + F +++++    L  E 
Sbjct: 256 KVALNNEFNAWINAVEGKSS--NALLA--FQDEIERSIEREGEYFTNEMEIRLNNLKNEI 311

Query: 326 NDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNS 385
                 I K IQDI+C    DP + + +YFDS G  +I +Y++R ++ ++       ++ 
Sbjct: 312 ESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTRKILEYVSRPLMDSIFLKAHFQIDE 371

Query: 386 LVADIENDV-SKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAE 444
              ++E+ V +  +   +   E   ++++  +EEWGDIMI+EWS+++A  DV++      
Sbjct: 372 FRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWGDIMISEWSRRMAQFDVVSGQ---L 428

Query: 445 HEGKSKTELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENG 504
            +     E S K W++F+ +K ++++ RD +   +   +  + ++ N +  L+ + +E  
Sbjct: 429 LDDDPLFEQSAKKWQRFLDLKHEVVEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEAN 488

Query: 505 EYLYILRAQANLAF 518
                L  +A++AF
Sbjct: 489 NQFEALGKKADVAF 502

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 11/102 (10%)

Query: 339  INCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQ---TTLNSLVADIENDVS 395
            IN  +GI+ E  +Q     + K Q  K      I +M+ + +   T L +++  IE D +
Sbjct: 953  INQNEGINLEEYRQRGNQLQEKFQGMKRKVNPNIMSMIENVEKKETALKTMIKTIEKDKT 1012

Query: 396  KILEDFKKIAENSREQHLTTFEE--------WGDIMINEWSK 429
            KI E  +K+ E  R+  L T+E+        +GD++ N ++K
Sbjct: 1013 KIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAK 1054

>CAGL0K03993g complement(368661..369134) weakly similar to sp|P53218
           Saccharomyces cerevisiae YGR030c POP6, start by
           similarity
          Length = 157

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 350 GKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSKILEDFKKIAENSR 409
           G  +  D    SQ  +YI  +++ TML +  T  N +   +  +  KI +    + +N +
Sbjct: 9   GTNVEIDLSNFSQCSEYIKNQILPTMLGEPNTEFNYITTKVSKN-DKIKDKVSSLEKNVK 67

Query: 410 EQHLTTFEEWGD 421
           + +      +GD
Sbjct: 68  DNNFVIIASYGD 79

>Kwal_55.20421
          Length = 1170

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 20/81 (24%)

Query: 380  QTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEE--------WGDIMINEWSKKL 431
            ++ L ++++ IE D  KI E   K+ E  RE  + T+E+        +GD++ N ++K  
Sbjct: 997  ESALKTMISTIEKDKRKIQETVAKLNEYKRETLIKTWEKVTVDFGNIFGDLLPNSFAK-- 1054

Query: 432  AYLDVLAPHEDAEHEGKSKTE 452
                 L P      EGKS TE
Sbjct: 1055 -----LVP-----IEGKSVTE 1065

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
            Saccharomyces cerevisiae YFR031c SMC2 chromosome
            segregation protein, start by similarity
          Length = 1170

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 20/81 (24%)

Query: 380  QTTLNSLVADIENDVSKILEDFKKIAENSREQHLTTFEE--------WGDIMINEWSKKL 431
            +T L +++  IE D  KI E  +K+ E  RE  + T+E+        +GD++ N ++K  
Sbjct: 997  ETALKTMIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAK-- 1054

Query: 432  AYLDVLAPHEDAEHEGKSKTE 452
                 L P      EGK  TE
Sbjct: 1055 -----LEP-----SEGKDVTE 1065

>Kwal_26.8059
          Length = 631

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 306 KIDANDKLFKDKLKVLHKEANDNFQLINKAIQDINCTQGIDPETGKQIYFDSEGKSQIEK 365
           K+D  DK+++ K  ++ K+ +    L++KAIQ I        E    +YF  +G  Q++K
Sbjct: 521 KLDFVDKIYRAKSALMDKQFHQQETLLDKAIQSIPKDSTTLSEVQALLYFSLQGNQQLQK 580

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,163,812
Number of extensions: 669250
Number of successful extensions: 3235
Number of sequences better than 10.0: 104
Number of HSP's gapped: 3321
Number of HSP's successfully gapped: 111
Length of query: 547
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 440
Effective length of database: 12,891,983
Effective search space: 5672472520
Effective search space used: 5672472520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)