Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I01034g78377139860.0
Scas_699.3776877216160.0
YOR035C (SHE4)78979215970.0
AER389C7587459381e-115
KLLA0E16742g6616048541e-104
Kwal_55.199912752974741e-53
Scas_717.6*1400113790.31
KLLA0E05225g175599790.32
Kwal_56.23885167495712.3
KLLA0D13596g49291693.8
YLR127C (APC2)853117694.2
KLLA0D18051g303129684.6
KLLA0E18920g577120668.7
Sklu_1528.1578119669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I01034g
         (771 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces cer...  1540   0.0  
Scas_699.37                                                           627   0.0  
YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein r...   619   0.0  
AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH] (1367924..1...   365   e-115
KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534 Saccha...   333   e-104
Kwal_55.19991                                                         187   1e-53
Scas_717.6*                                                            35   0.31 
KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces c...    35   0.32 
Kwal_56.23885                                                          32   2.3  
KLLA0D13596g complement(1172223..1173701) similar to sp|P39937 S...    31   3.8  
YLR127C (APC2) [3537] chr12 complement(395759..398320) Component...    31   4.2  
KLLA0D18051g complement(1523490..1524401) similar to sgd|S000258...    31   4.6  
KLLA0E18920g complement(1672341..1674074) similar to sp|P38932 S...    30   8.7  
Sklu_1528.1 YGL095C, Contig c1528 469-2205                             30   9.2  

>CAGL0I01034g 84159..86510 similar to sp|P51534 Saccharomyces
           cerevisiae YOR035c SHE4, start by similarity
          Length = 783

 Score = 1540 bits (3986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/771 (98%), Positives = 760/771 (98%)

Query: 1   MSVSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKRVASAQLPEIEKVLIRS 60
           MSVSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKRVASAQLPEIEKVLIRS
Sbjct: 1   MSVSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKRVASAQLPEIEKVLIRS 60

Query: 61  YQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMVLLDELRTRIHY 120
           YQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMVLLDELRTRIHY
Sbjct: 61  YQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMVLLDELRTRIHY 120

Query: 121 GEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPD 180
           GEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPD
Sbjct: 121 GEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPD 180

Query: 181 EFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKER 240
           EFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKER
Sbjct: 181 EFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKER 240

Query: 241 ATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTW 300
           ATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTW
Sbjct: 241 ATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTW 300

Query: 301 SFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRM 360
           SFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRM
Sbjct: 301 SFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRM 360

Query: 361 LRIHEVFRNEIIKLAKKESGTNPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSMY 420
           LRIHEVFRNEIIKLAKKESGTNPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSMY
Sbjct: 361 LRIHEVFRNEIIKLAKKESGTNPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSMY 420

Query: 421 ANMGADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNM 480
           ANMGADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNM
Sbjct: 421 ANMGADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNM 480

Query: 481 TRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYRSLTRILISTDPALIFNKYSPL 540
           TRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYRSLTRILISTDPALIFNKYSPL
Sbjct: 481 TRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYRSLTRILISTDPALIFNKYSPL 540

Query: 541 NAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLDRYEXXXXXXXXXXXPTSNGEE 600
           NAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLDRYE           PTSNGEE
Sbjct: 541 NAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLDRYEALLALTNLAATPTSNGEE 600

Query: 601 ICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNF 660
           ICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNF
Sbjct: 601 ICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNF 660

Query: 661 NTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELT 720
           NTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELT
Sbjct: 661 NTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELT 720

Query: 721 QRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALEKSLVNQNVGGEY 771
           QRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALEKSLVNQNVGGEY
Sbjct: 721 QRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALEKSLVNQNVGGEY 771

>Scas_699.37
          Length = 768

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/772 (44%), Positives = 497/772 (64%), Gaps = 21/772 (2%)

Query: 3   VSKDAIETLCEELDKSATISIDEKSYQEALDEI-KDIIVRKKRVASAQLPEIEKVLIRSY 61
           +S   I  LC E +K   + ++ + Y EALDEI  + I   + + S Q   +E VL R+Y
Sbjct: 1   MSDKVIADLCLEFEKKLRVPVEPEKYNEALDEIFMNDIEGIENIGSKQ---VETVLSRAY 57

Query: 62  QDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMVLLDELRTRIHYG 121
           Q H+ S+ +L E+I  ++ K+L+LFE LS+ ++H+L+G F  + +T+ L+ EL+ RIHYG
Sbjct: 58  QAHSSSRVYLHELILKDIPKSLNLFESLSIQTVHILIGSFETANDTIPLIKELKDRIHYG 117

Query: 122 EDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPDE 181
           ED + KYLLS ++Q L+K++Y ++   F+VRD+CLR  EPD   + L+IFT L   + ++
Sbjct: 118 EDTHPKYLLSCIVQSLNKYSYAWDQIEFIVRDVCLRMGEPDFKSIGLIIFTLLQESFEEQ 177

Query: 182 FKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKERA 241
           F  KF   +D LI+EAE D+G++PL LIVEI TELYP+LT +CSE+ L     K+ KE+A
Sbjct: 178 FYKKFTNIIDSLILEAEADVGNDPLSLIVEIFTELYPALTNICSELFLGSELDKLFKEKA 237

Query: 242 TSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTWS 301
              + D+ F  KLLKLLS+ACIDE VR  I+E Y++ LE S++  ++K  +A+VLIKTWS
Sbjct: 238 MHNNEDE-FIKKLLKLLSVACIDENVRNFIAENYLDMLERSLKLEQFKTYSAVVLIKTWS 296

Query: 302 FLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRML 361
           F KLK + I  L + L DNFL +  L+ +D ++   N   V  IEGLAYLTLK  +K  L
Sbjct: 297 FTKLKGVTIGDLGTTLTDNFLMN--LKIDDGQSL--NDECVMCIEGLAYLTLKKQMKMTL 352

Query: 362 RIHEVFRNEIIKLAKKESGT--NPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSM 419
           R HE F   II L KK+     +   +GIL+I+ N++  P D T         ++  L  
Sbjct: 353 RYHEEFSTTIINLLKKQDTPVDDSVKYGILVILGNISTYPMDVTM-DGAMDPQALQDLKT 411

Query: 420 YANMGADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYN 479
           Y+ + +   +  ++V ++ E+V  + +K+ILK +LL+ ++TK  ++SPGS+QQ +RI+YN
Sbjct: 412 YSELKSPKKRDANDVIENNEDVTRYIQKYILKTELLSYLRTKLAEVSPGSRQQIIRIIYN 471

Query: 480 MTRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYRSLTRILISTDPALIFNKYSP 539
           +TR +ENIS+ V+QG    ++EYL +K+DK    RLLA RSLT++L  +DP LIFNKYS 
Sbjct: 472 LTRARENISASVEQGCVVTVIEYLANKKDKKEPTRLLALRSLTKMLTLSDPKLIFNKYSR 531

Query: 540 LNAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLDRYEXXXXXXXXXXXPTSNGE 599
           L AIPFL++L+ T     E       NP L  D+ I   D YE             SN +
Sbjct: 532 LTAIPFLYELLQTPSLSAE-------NP-LSTDELITTQDSYEALCALTNLASTEDSNAD 583

Query: 600 EICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRN 659
           ++CK +     YW+ I NL+L++N+L+QR+TLELI+NLM +PL +AAK FNF NPQSLRN
Sbjct: 584 DVCKQVVTDVNYWSIIENLILDDNILVQRATLELIANLMCYPLSIAAKIFNFENPQSLRN 643

Query: 660 FNTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIEL 719
           FN LV+L+EL+D+A+QRA+AA+FANI  SVP I++ L +K  LI +A  I  +Q DD  L
Sbjct: 644 FNILVKLLELNDVAAQRAVAAIFANISSSVPLIAQTLLDKKELIEKATGIFAEQIDDEAL 703

Query: 720 TQRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALEKSLVNQNVGGEY 771
            QRL +FF+ LFE  P K E  + K  +L +N NL+  LE  +   ++  EY
Sbjct: 704 RQRLFVFFFSLFELLPSKEEDSR-KFDSLTRNTNLKMTLESLMKRDDIEPEY 754

>YOR035C (SHE4) [4847] chr15 complement(397734..400103) Protein
           required for mother cell-specific expression of HO and
           receptor mediated as well as membrane lipid endocytosis
           [2370 bp, 789 aa]
          Length = 789

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/792 (43%), Positives = 516/792 (65%), Gaps = 49/792 (6%)

Query: 3   VSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKRVASAQLP----------- 51
           +    I++LC   DK+   + D + Y +A++ I  +   +++  S ++P           
Sbjct: 11  IDSSTIDSLCAAFDKTLKSTPDVQKYNDAINTIFQL---RQKSESGKMPADLTNSEALKD 67

Query: 52  --EIEKVLIRSYQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMV 109
             +IE++L RSYQDH+ES+  L ++I++++  AL+LFE+LS  SIHV VG F + + T+ 
Sbjct: 68  RQKIEEILTRSYQDHSESRVHLSKLIQNDIPFALNLFEILSRSSIHVFVGCFSNKDATIA 127

Query: 110 LLDELRTRIHYGEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLL 169
           LL+EL+ RIHYGED ++ YLLSI+LQLL+KF Y F +  FLV++L LR  E +V  MML+
Sbjct: 128 LLNELQIRIHYGEDTHVTYLLSIILQLLNKFKYNFKEVRFLVKELILRISEDEVKSMMLI 187

Query: 170 IFTQLNYRYPDEFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLL 229
           IF +L   +  +F    ++ M  LI+EAE D+G++PL +IV+ L+ELYPSLT LCSE+ L
Sbjct: 188 IFAELQSSFQKDFDKAVVDFMSSLIVEAEIDVGNDPLSIIVKTLSELYPSLTTLCSEIFL 247

Query: 230 TRGAGKMLKERATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYIETLETSMQFSEYK 289
           T+G  K+ K+R   E+ D  F  +LL+LLS ACIDET+R +I+E Y++ LE S+   + +
Sbjct: 248 TKGLSKLFKKRVF-EEQDLQFTKELLRLLSSACIDETMRTYITENYLQLLERSLNVEDVQ 306

Query: 290 VLAALVLIKTWSFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLV------- 342
           + +ALVL+KTWSF KL  I++ +L+ I ++     A+      +  + N++ V       
Sbjct: 307 IYSALVLVKTWSFTKLTCINLKQLSEIFIN-----AISRRIMPKIENVNESAVKLEEVPK 361

Query: 343 --YTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLAKKESGTNPNYFGILIIIANLTALPN 400
              ++E LAYL+LK  +K M+R +E F   ++ + K +  T+  Y G+L+I+ANL+ LP 
Sbjct: 362 VEMSVEALAYLSLKASVKIMIRSNESFTEILLTMIKSQKMTHCLY-GLLVIMANLSTLP- 419

Query: 401 DKTNPTNQTHSGSMAQLSMYANM-GADTNKLKDNVPDSEEEVKEFQEKFILKKDLLADMK 459
           +++N ++Q    S+  L  YA++ G   +K+     +S+E++  F EK+IL+ +L++ +K
Sbjct: 420 EESNGSSQ----SINDLKNYADLKGPGADKVGAE-KESKEDILLFNEKYILRTELISFLK 474

Query: 460 TKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSKQDKGVAVRLLAYR 519
            + +++SP  KQQ +R++YN+TR K  I  C+ QG TT ILEYL +KQD G  +R+L  R
Sbjct: 475 REMHNLSPNCKQQVVRVIYNITRSKNFIPQCISQGGTTIILEYLANKQDIGEPIRILGCR 534

Query: 520 SLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELNPLLENDDNIEVLD 579
           +LTR+LI T+P LIF KYS LNAIPFLF+L+  +   ++       NP L ND+ I++ D
Sbjct: 535 ALTRMLIFTNPGLIFKKYSALNAIPFLFELLPRSTPVDD-------NP-LHNDEQIKLTD 586

Query: 580 RYEXXXXXXXXXXXPTSNGEEICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMS 639
            YE            TS+GEE+CK I +T  YW++I NLML+EN+ +QRSTLELISN+MS
Sbjct: 587 NYEALLALTNLASSETSDGEEVCKHIVSTKVYWSTIENLMLDENVPLQRSTLELISNMMS 646

Query: 640 HPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAALFANIVISVPFISEELYEK 699
           HPL +AAKFFN  NPQSLRNFN LV+L++L D+ SQRA+AA+FANI  ++P I++EL  K
Sbjct: 647 HPLTIAAKFFNLENPQSLRNFNILVKLLQLSDVESQRAVAAIFANIATTIPLIAKELLTK 706

Query: 700 DVLISRAIRILNDQNDDIELTQRLIIFFYGLFEYAPEKPESQKAKEKNLFKNANLRKALE 759
             LI  AI++  DQ DDIEL QRL++ F+GLFE  P+   ++      L +N  L+ AL 
Sbjct: 707 KELIENAIQVFADQIDDIELRQRLLMLFFGLFEVIPDNGTNEVYPL--LQENQKLKDALN 764

Query: 760 KSLVNQNVGGEY 771
            SL   + G E+
Sbjct: 765 MSLKRGDSGPEF 776

>AER389C [2889] [Homologous to ScYOR035C (SHE4) - SH]
           (1367924..1370200) [2277 bp, 758 aa]
          Length = 758

 Score =  365 bits (938), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 266/745 (35%), Positives = 431/745 (57%), Gaps = 62/745 (8%)

Query: 28  YQEALDEIKDIIVRKKRVASAQLPEIEKVLIRSYQDHTESKKFLREIIKSNVGKALDLFE 87
           Y +ALDE+    V    V + +  +IE+V++   +DHTES+    ++ ++  G  L+L E
Sbjct: 37  YIKALDEL----VSGSSVINVE--DIEEVVLHCIKDHTESRNHFLQLSRTRPGSLLELLE 90

Query: 88  MLSLPSIHVLVGIFFDSEETMVLLDELRTRIHYGEDPNIKYLLSIVLQLLSKFTYVFNDF 147
             S  SI  +V  F ++++T  +L E++ ++    +    + + ++ QLL K  Y F+D 
Sbjct: 91  YGSGKSIPAIVDAFSNAQDTNAVLREIQ-KLLQDRNRTPAWYIQLIYQLLEKNWYTFSDL 149

Query: 148 SFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPDEFKVKFLETMDVLIMEAEEDIGDE-PL 206
           +FLVR L  R     V P+ L++F +L+  YP +F+ +F +T+D L +EA  D+G E  L
Sbjct: 150 AFLVRVLPRRMDSEQVRPLSLVLFARLHSSYPSDFEKEFTDTIDTLAIEA--DVGIEGSL 207

Query: 207 CLIVEILTELYPSLTGLCSEVLLTRGAGKMLKERATSEDSDKNFRSKLLKLLSIACIDET 266
             ++  LTEL+P L  LCS++LL     ++L++ +T    ++      L LLS+ACID+T
Sbjct: 208 DAVLLTLTELFPLLPLLCSQLLLKPELQQVLRDESTR---NRKTLLLALNLLSVACIDDT 264

Query: 267 VRVHISEKYIETLETSMQFSEYKVLAALVLIKTWSFLKLKHIDINKLASILVDNFLDSAV 326
           VR +I++  ++ LET+   S+ K+ A++VLIKTW+F KL+ IDI +L +  V   L S V
Sbjct: 265 VRRYIADNLLKELETAFSDSDTKLYASIVLIKTWAFKKLQSIDIEQLCATCVTE-LQSPV 323

Query: 327 LESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLAKKESGTNPNYF 386
           ++                +EGLAYLTLK  ++  +R        +++L KK   ++  Y 
Sbjct: 324 VKRR-----------AIAVEGLAYLTLKSTVRISIRADGDSSLILVQLLKKNPDSSTIY- 371

Query: 387 GILIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSEEEVKEFQE 446
           GIL  + NLTA P++++     +   S+  L  YA++    +  ++ + D ++E+  F E
Sbjct: 372 GILSTLVNLTASPSEQS-----SEQKSLNALKAYADLHVPASGKQEPLED-DDEIDAFIE 425

Query: 447 KFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSK 506
            +IL   ++  +++  N +    K+Q  +++Y +T+ +  I SCV+QG TT +LEYL   
Sbjct: 426 DYILDLQVIGTLRSSKNVLMANCKEQLAKLIYQVTKSRPFIQSCVKQGATTFLLEYLNDA 485

Query: 507 QDKGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELN 566
               + +++LA R+L RILI+TDP L+F+++SP+N++P LF LI                
Sbjct: 486 PVHNI-IQILAARALARILINTDPKLLFHRHSPMNSVPALFGLI---------------- 528

Query: 567 PLLENDDNIEVL------DRYEXXXXXXXXXXXPTSNGEEICKSISNTPKYWNSIVNLML 620
           P+L+  DN E L      D YE            +S  EE+ K I +  +YW  ++N +L
Sbjct: 529 PILDGLDNEEALSYLTTRDSYEALLALTNLAATDSS--EELAKVIVSNNRYWLKLMNCVL 586

Query: 621 NENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAA 680
           +E + IQRS LEL++NLM+ P+ +AAKFFN +NP+S +NF+TLV L+ L+DI SQRAIAA
Sbjct: 587 DETVQIQRSALELLANLMARPINIAAKFFNLANPESRKNFDTLVCLLRLEDIRSQRAIAA 646

Query: 681 LFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELTQRLIIFFYGLFEYAPEKPES 740
           +FANI  S+PFI+EEL ++D LI   I  L +Q +D EL QRL+ F   L E +P K +S
Sbjct: 647 IFANIAGSIPFIAEELLKEDELIKAVILTLKEQCEDEELMQRLLFFIDALLEVSPSKNDS 706

Query: 741 QKAKEKNLFKNANLRKALEKSLVNQ 765
                  L  N +L K L+K ++ +
Sbjct: 707 HL-----LVDNKDLYKTLQKLVITK 726

>KLLA0E16742g 1482505..1484490 weakly similar to sp|P51534
           Saccharomyces cerevisiae YOR035c SHE4 required for
           mother cell-specific gene expression singleton,
           hypothetical start
          Length = 661

 Score =  333 bits (854), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 210/604 (34%), Positives = 335/604 (55%), Gaps = 55/604 (9%)

Query: 136 LLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQLNYRYPDEFKVKFLETMDVLIM 195
           +L+ +   +    FL R + LR    ++ P++L+    L   + D  + K    +  L++
Sbjct: 59  MLAGYVKDWGQLEFLCRRILLRSSIQEIRPLLLVTMKSLMSNHSDNTEQKCGNILQQLLI 118

Query: 196 EAEEDIGDEPLCLIVEILTELYPSLTGLCSEVLLTRGAGKMLKERATSEDSDKNFRSKLL 255
           EAEED G+  L L+V+ ++ ++P   G+C ++ L+     +L     S   D++  +  L
Sbjct: 119 EAEEDSGNVSLRLLVDAMSLVFPICLGVCRDMFLSTDFQDILTRNLNSSADDEHLVNGAL 178

Query: 256 KLLSIACIDETVRVHISEKYIETLETSMQFSEYKVLAALVLIKTWSFLKLKHIDINKLAS 315
           +LL+++CIDE VR  I+E Y++TL+ S +  +YKVL ALVLIK WSF K++   +N   +
Sbjct: 179 RLLAVSCIDEAVRRFIAEHYLKTLQQSFKVEKYKVLTALVLIKIWSFTKIEKETLNSCIN 238

Query: 316 ILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLA 375
           + +D+  +   +E                 E LAYLTLK  ++ +LR +     +II+L 
Sbjct: 239 LFIDSLSNGENIE--------------INTEALAYLTLKPSVRVLLRGNGDVCLKIIELI 284

Query: 376 KKESGTNPNYFGILIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVP 435
           K +  T  + +G+LII+AN++  P+   +  ++  +               TN+ K++ P
Sbjct: 285 KSQDTTPTDLYGLLIILANVSEHPSQNEDTVDKLKAS------------LKTNQEKNDEP 332

Query: 436 DSE--EEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQ 493
             E  ++++EF   +I+  DL+  +K+    +S  S  Q +RI+YN+TR K  IS CV+Q
Sbjct: 333 TLENVKDIEEFNRDYIIDLDLIGSLKSI--KLSTSSYNQAIRIIYNVTRDKTQISECVKQ 390

Query: 494 GVTTNILEYLVSKQD-KGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGT 552
           G    +L +L  K++       LL+ R+L++ LI  +P   F+KYSPL+A PFLF+    
Sbjct: 391 GAGLMLLVFLAQKRNLSKDEWYLLSIRALSKTLIYVNPETAFSKYSPLSAAPFLFE---- 446

Query: 553 TESGEETQEKIELNPLLENDDNIE-----VLDRYEXXXXXXXXXXXPTSNGEEICKSISN 607
                        N  L ND+ +       LD YE             + G ++ K I +
Sbjct: 447 -------------NLPLPNDNALSELQFTQLDTYEALLALTNLAT--INQGVDLGKIILS 491

Query: 608 TPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLI 667
             +YW+SI NL+L+ ++ IQRSTLELISNLMS+P+ ++AKFF F NP+S +NF  LV+L+
Sbjct: 492 NAQYWDSIENLLLDSSVRIQRSTLELISNLMSNPMAISAKFFCFENPKSAQNFEILVKLL 551

Query: 668 ELDDIASQRAIAALFANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELTQRLIIFF 727
           EL DI SQRA+AA+FANI  +VPFI +EL EK  LI  AIR+   QN D +L  RL++  
Sbjct: 552 ELHDIQSQRAVAAIFANIASTVPFICKELSEKRNLIETAIRVFKTQNTDTDLRIRLLVLL 611

Query: 728 YGLF 731
             +F
Sbjct: 612 SSIF 615

>Kwal_55.19991
          Length = 275

 Score =  187 bits (474), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/297 (39%), Positives = 169/297 (56%), Gaps = 22/297 (7%)

Query: 389 LIIIANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSEEEVKEFQEKF 448
           ++++ANL++ P D+++   +   G    L  YA++    N LKD    + EEV  F +K+
Sbjct: 1   MVVLANLSS-PLDESSSRQRALQG----LQAYADLKRPDN-LKDVASPTNEEVLAFNKKY 54

Query: 449 ILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSKQD 508
           IL  + L  +K+ F D S GS  Q +RI++N++R KE I+  VQQG    +LE L S + 
Sbjct: 55  ILDLNTLGLLKSGFRDQSSGSNLQLVRIIHNLSRNKEFINESVQQGSVAVLLETLASIKM 114

Query: 509 KGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELNPL 568
                +LLA RSL RIL   +P L+F ++S L A+P+LF+LI        TQ        
Sbjct: 115 PA-DFKLLALRSLARILAMVNPELVFRRFSALTAVPYLFELIPV-----PTQPA------ 162

Query: 569 LENDDNIEVLDRYEXXXXXXXXXXXPTSNGEEICKSISNTPKYWNSIVNLMLNENLLIQR 628
             ++D I+  D YE             S  + IC+ I  +P YW  +  L+L+  + IQR
Sbjct: 163 --SNDQIDPKDTYEALLALTNLVTIQES--DSICQKIVASPVYWEQLEGLILDTTVEIQR 218

Query: 629 STLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAALFANI 685
           S LEL+ NLM+  L +A KFFNF NPQSLRNFN LV+L+ L DI SQ A+  +FANI
Sbjct: 219 SVLELLCNLMAGSLHLAVKFFNFDNPQSLRNFNILVKLLNLKDIRSQMAVTGIFANI 275

>Scas_717.6*
          Length = 1400

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 52/113 (46%), Gaps = 17/113 (15%)

Query: 597  NGEEICKSISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQS 656
            +G +  +   + P YW  ++ ++  + +  +R T  ++S  + +    A  F  FS  ++
Sbjct: 1037 SGVDFVQFAWSQPSYWQQLIVILRRQYICTKRDTNYVLSKFLLN--AGAGLFIGFSFWKT 1094

Query: 657  LRNFNTLVQLIELDDIASQRAIAALFANIVISVPFISE----ELYEKDVLISR 705
             +N + L           Q AI   F N+ +S P I++     L+ KDV ++R
Sbjct: 1095 KKNISGL-----------QNAIFLSFMNMCLSSPLINQIQDKALHSKDVYVAR 1136

>KLLA0E05225g 467253..472520 similar to sp|P25386 Saccharomyces
           cerevisiae YDL058w USO1 intracellular protein transport
           protein, start by similarity
          Length = 1755

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 19/99 (19%)

Query: 605 ISNTPKYWNSIVNLMLNENLLIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLV 664
           I+N  KY  S      N+ L  +   L  + NL++ PL V  +F  F N Q ++N NT++
Sbjct: 255 INNILKYNTS------NQTLFFETGNLHHLINLLNEPLSVEEEF--FWNEQRMKNINTVL 306

Query: 665 QLIELDDIASQRAIAALFANIVISVPFISEELYEKDVLI 703
            +I L  +    ++ +   NI          LYE  VL+
Sbjct: 307 DIIRL-TVEDGNSVTSAHQNI----------LYESQVLM 334

>Kwal_56.23885
          Length = 1674

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 1/95 (1%)

Query: 300 WSFLKLKHIDINKLASILVDNFLDSAVLESEDTETRDSNQTLVYTIEGLAYLTLKVPIKR 359
           W    + H   N+L  IL +N L   VL  +  E  D   T VY  + L  + L+V    
Sbjct: 769 WVLAAIDHGWANRLFHILCENILTCEVLHKDSLEELDDIDTFVYHCQNLINV-LRVEHPT 827

Query: 360 MLRIHEVFRNEIIKLAKKESGTNPNYFGILIIIAN 394
           +L      +  +  L K   G    Y  + I IA+
Sbjct: 828 VLHSFNTEKTSVQPLYKWLDGDTSTYKNLAITIAS 862

>KLLA0D13596g complement(1172223..1173701) similar to sp|P39937
           Saccharomyces cerevisiae YER007w PAC2 involved in the
           stabilization of microtubles singleton, start by
           similarity
          Length = 492

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 13/91 (14%)

Query: 244 EDSDKNFRSKLLKLLSIACIDET-----VRVHISEKYIETLETSMQFSEYKVLAALVLIK 298
           ED+ K F S + +L S+ C+D T     +R + +E Y  +L  S Q + Y   +A+    
Sbjct: 336 EDTQKGFYSIIARLKSLKCVDGTRISEDIR-NEAELYFISLVLSSQIN-YDTQSAM---- 389

Query: 299 TWSFLKLKH-IDINKLASILVDNFLDSAVLE 328
            W+ L LKH I+     ++   NFL   ++E
Sbjct: 390 -WNHLTLKHSINTESRTTVQQTNFLSKELIE 419

>YLR127C (APC2) [3537] chr12 complement(395759..398320) Component of
           the anaphase-promoting complex, required for Clb2p
           degradation and for the metaphase-anaphase transition
           [2562 bp, 853 aa]
          Length = 853

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 56/117 (47%), Gaps = 17/117 (14%)

Query: 202 GDEPLCLIVEILTELY----PSLTGLCSEVLLTRGAGKMLKERATS---EDSDKNFRSKL 254
            DEP+CL +E L+E      P LT L  +  + +G   +LKE  T    E S+ +F  + 
Sbjct: 694 NDEPICLSLEQLSESLNIAPPRLTHLL-DFWIQKGV--LLKENGTYSVIEHSEMDF-DQA 749

Query: 255 LKLLSIACIDETVRVH----ISEKYIETLETSMQFSEYKV--LAALVLIKTWSFLKL 305
            K   +   +    +H    I  KY  TL+ S+ F E  +  L A+ L K  SFLK+
Sbjct: 750 QKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKI 806

>KLLA0D18051g complement(1523490..1524401) similar to sgd|S0002582
           Saccharomyces cerevisiae YDR175c RSM24 component of the
           mitochondrial ribosomal small subunit, start by
           similarity
          Length = 303

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 29/129 (22%)

Query: 62  QDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFFDSEETMVLLDELRTRIHYG 121
           ++H  S+K +  +  S++G      E   L  + +L    +DS       D LR      
Sbjct: 177 EEHPNSRKVVLSVKTSDLG-----LEQRELHKLRLLAKTRYDS-----TTDTLRMSSDRY 226

Query: 122 EDP--NIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCREPDVSPMMLLIFTQL----- 174
           E+P  N KYL SI+L+LL +   + +DF+    D+ L  R         +I  QL     
Sbjct: 227 EEPAQNAKYLNSILLELLKEAKDLKDDFA----DVPLDKRH--------IIARQLRKKKR 274

Query: 175 NYRYPDEFK 183
            Y +P+E+K
Sbjct: 275 GYEFPEEWK 283

>KLLA0E18920g complement(1672341..1674074) similar to sp|P38932
           Saccharomyces cerevisiae YGL095c VPS45 vacuolar protein
           sorting-associated protein, start by similarity
          Length = 577

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 15/120 (12%)

Query: 385 YFGILIIIANLTALPN---DKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVP------ 435
           Y GI   + +L+ +PN   D       +      + +MY N G   +K+K+ V       
Sbjct: 253 YIGIKRNLVDLSNVPNIDPDLKQVVLSSKQDKFFKETMYMNFGDLADKVKNYVTQYKNKT 312

Query: 436 ------DSEEEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISS 489
                 ++ E++KEF EKF   K L  ++      +S   +Q  ++ ++ ++ +++N+SS
Sbjct: 313 NITKQINTIEDIKEFIEKFPEFKKLSGNISKHMAIVSELDRQLQLKNIWEVSELEQNLSS 372

>Sklu_1528.1 YGL095C, Contig c1528 469-2205
          Length = 578

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 15/119 (12%)

Query: 385 YFGILIIIANLTALPN---DKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSE--- 438
           Y GI   I NL+ +P+   D       +        +MY N G   +K+K  V + +   
Sbjct: 252 YIGIKRNIVNLSQVPDLDSDLQKVVLSSKQDPFFHDTMYLNFGDLGDKVKAYVSNYKSKT 311

Query: 439 ---------EEVKEFQEKFILKKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENIS 488
                    E++K+F EKF   K L  ++      +S   +Q  ++ +++++ V++N+S
Sbjct: 312 KSNAQLSTIEDIKQFIEKFPEFKKLSGNVSKHMAIVSELDRQLQLKRIWDVSEVEQNVS 370

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,754,659
Number of extensions: 1119765
Number of successful extensions: 4405
Number of sequences better than 10.0: 57
Number of HSP's gapped: 4540
Number of HSP's successfully gapped: 58
Length of query: 771
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 662
Effective length of database: 12,822,747
Effective search space: 8488658514
Effective search space used: 8488658514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)