Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I01012g28226613880.0
YOR036W (PEP12)2882526597e-86
Sklu_1710.22792666188e-80
Scas_699.403112696201e-79
Kwal_55.215572712555822e-74
KLLA0E21857g2752535581e-70
ACR092C2742514805e-59
Scas_607.24172611552e-11
KLLA0A10681g364721524e-11
AFL232W3012141504e-11
Sklu_2256.23771681515e-11
YOL018C (TLG2)397691481e-10
KLLA0C13233g262861414e-10
CAGL0G04807g2451211362e-09
Kwal_26.8414260811345e-09
CAGL0G08932g367691321e-08
Kwal_34.16287362691312e-08
Sklu_2407.11276811203e-07
Scas_697.44281891169e-07
AFR210C3292471161e-06
YOR106W (VAM3)283701114e-06
AEL026C349691044e-05
Sklu_2338.53072451027e-05
CAGL0D01914g335102930.001
Scas_721.10637759920.001
YLR026C (SED5)34059920.001
Kwal_26.753230359900.002
KLLA0F17798g31762850.008
Scas_720.3231069820.021
YMR183C (SSO2)29575800.036
Scas_333.329869760.11
CAGL0E06160g28274740.17
Kwal_56.2425928869720.36
CAGL0L00561g26492662.0
YGR134W (CAF130)1122132662.2
KLLA0F05291g42590652.7
KLLA0C15961g28669643.5
AFL139W29769634.2
AEL289W24771624.9
KLLA0E03443g23149625.6
YDR468C (TLG1)22463608.3
Sklu_2436.1621147608.3
YIL110W377168609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I01012g
         (278 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I01012g complement(82834..83682) similar to sp|P32854 Sacch...   539   0.0  
YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog (...   258   7e-86
Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement         242   8e-80
Scas_699.40                                                           243   1e-79
Kwal_55.21557                                                         228   2e-74
KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces...   219   1e-70
ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH] (521646..5...   189   5e-59
Scas_607.2                                                             64   2e-11
KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces c...    63   4e-11
AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH] complement(...    62   4e-11
Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement         63   5e-11
YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin ...    62   1e-10
KLLA0C13233g complement(1129020..1129808) weakly similar to sp|Q...    59   4e-10
CAGL0G04807g complement(458085..458822) similar to sp|Q12241 Sac...    57   2e-09
Kwal_26.8414                                                           56   5e-09
CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces c...    55   1e-08
Kwal_34.16287                                                          55   2e-08
Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement      51   3e-07
Scas_697.44                                                            49   9e-07
AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH] (811271..81...    49   1e-06
YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog (t...    47   4e-06
AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH] (585366..58...    45   4e-05
Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement         44   7e-05
CAGL0D01914g 201005..202012 highly similar to sp|Q01590 Saccharo...    40   0.001
Scas_721.106                                                           40   0.001
YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin ...    40   0.001
Kwal_26.7532                                                           39   0.002
KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces...    37   0.008
Scas_720.32                                                            36   0.021
YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin ...    35   0.036
Scas_333.3                                                             34   0.11 
CAGL0E06160g complement(619255..620103) highly similar to sp|P32...    33   0.17 
Kwal_56.24259                                                          32   0.36 
CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces cer...    30   2.0  
YGR134W (CAF130) [2091] chr7 (757773..761141) Component of Ccr4p...    30   2.2  
KLLA0F05291g 522324..523601 weakly similar to sgd|S0002348 Sacch...    30   2.7  
KLLA0C15961g 1387763..1388623 gi|15824638|gb|AAL09428.1 Kluyvero...    29   3.5  
AFL139W [3056] [Homologous to ScYMR183C (SSO2) - SH; ScYPL232W (...    29   4.2  
AEL289W [2216] [Homologous to ScYKR006C (MRPL13) - SH] complemen...    28   4.9  
KLLA0E03443g 320167..320862 similar to sgd|S0002876 Saccharomyce...    28   5.6  
YDR468C (TLG1) [1285] chr4 complement(1398014..1398688) Syntaxin...    28   8.3  
Sklu_2436.16 YDR468C, Contig c2436 36704-37339 reverse complement      28   8.3  
YIL110W (YIL110W) [2566] chr9 (156042..157175) Protein of unknow...    28   9.9  

>CAGL0I01012g complement(82834..83682) similar to sp|P32854
           Saccharomyces cerevisiae YOR036w PEP12 syntaxin, start
           by similarity
          Length = 282

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MDSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNA 60
           MDSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNA
Sbjct: 1   MDSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNA 60

Query: 61  NVVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQE 120
           NVVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQE
Sbjct: 61  NVVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQE 120

Query: 121 SQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREP 180
           SQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREP
Sbjct: 121 SQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREP 180

Query: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240
           INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE
Sbjct: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240

Query: 241 NTAGASQELNKANRMQKRSSRYCLYF 266
           NTAGASQELNKANRMQKRSSRYCLYF
Sbjct: 241 NTAGASQELNKANRMQKRSSRYCLYF 266

>YOR036W (PEP12) [4848] chr15 (400347..401213) Syntaxin homolog
           (t-SNARE) involved in Golgi to vacuole transport [867
           bp, 288 aa]
          Length = 288

 Score =  258 bits (659), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 135/252 (53%), Positives = 186/252 (73%), Gaps = 6/252 (2%)

Query: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72
           F D P F+ LK+++++ELFE+NG++STL+QFT +L  F+D  D  V+A VV+ INK+++ 
Sbjct: 20  FSDSPEFQTLKEEVAAELFEINGQISTLQQFTATLKSFIDRGD--VSAKVVERINKRSVA 77

Query: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132
            IE +  L+K VN  VK++D IE++ LDK QIIAR+KL+RD  +S QE Q  Q+QF++++
Sbjct: 78  KIEEIGGLIKKVNTSVKKMDAIEEASLDKTQIIAREKLVRDVSYSFQEFQGIQRQFTQVM 137

Query: 133 KSINAEARGKL--NEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQQ 190
           K +N  A+  L  +E  N  ALL  DEE  Q ++ +T       VIER+PINNEEFAYQQ
Sbjct: 138 KQVNERAKESLEASEMANDAALL--DEEQRQNSSKSTRIPGSQIVIERDPINNEEFAYQQ 195

Query: 191 RLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELN 250
            LI++RD+EI+NIERGITELN +FKDLG+V+  QG++VDNIEANIY+  +NT  AS EL 
Sbjct: 196 NLIEQRDQEISNIERGITELNEVFKDLGSVVQQQGVLVDNIEANIYTTSDNTQLASDELR 255

Query: 251 KANRMQKRSSRY 262
           KA R QKR+SR+
Sbjct: 256 KAMRYQKRTSRW 267

>Sklu_1710.2 YOR036W, Contig c1710 773-1612 reverse complement
          Length = 279

 Score =  242 bits (618), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 132/266 (49%), Positives = 183/266 (68%), Gaps = 10/266 (3%)

Query: 2   DSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNAN 61
           DS+EE E    F D P FE+   +IS++LFE+NG +STL+QF ++L    +     VN  
Sbjct: 6   DSFEENER---FVDSPEFEQFSYEISAKLFEMNGLLSTLQQFVKTLQNKYEQGS--VNTK 60

Query: 62  VVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQES 121
            V+NINKKA++    ++ L K++NE V ++D IE++ LD+ Q+I+R+KL RD ++S+Q  
Sbjct: 61  AVENINKKAVSYTNNISALTKSINELVHKVDAIEETSLDRSQLISREKLTRDVKYSVQVF 120

Query: 122 QTAQQQFSKIIKSINAEARGKL-NEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREP 180
           QT Q +F+K  K IN +A+  L  EEQ    +L+E+ E              + VIEREP
Sbjct: 121 QTVQSEFAKTTKLINNKAKSALVKEEQGLDEVLREELEDQHQQQQQQK----SVVIEREP 176

Query: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240
           INNEEFAYQQ LI+ERDEEI+NIERGI+ELNGIF+DLGA++  QG +VDNIE NIYS   
Sbjct: 177 INNEEFAYQQNLIRERDEEISNIERGISELNGIFQDLGAIVQQQGHLVDNIETNIYSVRN 236

Query: 241 NTAGASQELNKANRMQKRSSRYCLYF 266
           +T  A++ELNKA + Q+RSS++CLY 
Sbjct: 237 STQSAARELNKAMKSQRRSSKWCLYM 262

>Scas_699.40
          Length = 311

 Score =  243 bits (620), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 135/269 (50%), Positives = 184/269 (68%), Gaps = 26/269 (9%)

Query: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72
           F+D P F+ LK+ I ++LFE+NG++ TL+QFT SL   L    I     VV+N+ K+A T
Sbjct: 37  FKDSPEFQSLKESIQAQLFEINGQIGTLQQFTSSLQNSLQTGQI--RTKVVENVIKRAST 94

Query: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132
           NI  VN L+K  N+ V+ ID+++ +ELDK QII R+KL+RD R+SI E Q  Q+++++++
Sbjct: 95  NIHNVNSLMKQCNDVVQRIDSLDPNELDKVQIIQREKLVRDVRYSINEFQETQKEYTQLV 154

Query: 133 KSINAEARGKLNEEQNWTALLQEDEESHQTNNDN---------------TAQRQVNFVIE 177
           KSIN         ++N +ALLQ+    + T++D+                 Q+Q +  I 
Sbjct: 155 KSIN---------DKNKSALLQDQSVKNYTDDDSNKAALSQEQDRQEQLQQQQQQHVEII 205

Query: 178 REPINNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYS 237
           REPINNEEFAYQQ LIQERD EITNIE+GITELN IFKDLGAV+  QG+MVDNIEAN+YS
Sbjct: 206 REPINNEEFAYQQNLIQERDREITNIEQGITELNEIFKDLGAVVQQQGLMVDNIEANLYS 265

Query: 238 AVENTAGASQELNKANRMQKRSSRYCLYF 266
             +NT  AS+ELN+A R QK S+++CLY 
Sbjct: 266 VHDNTQMASKELNRARRSQKVSTKWCLYL 294

>Kwal_55.21557
          Length = 271

 Score =  228 bits (582), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 122/255 (47%), Positives = 174/255 (68%), Gaps = 13/255 (5%)

Query: 10  SPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKK 69
           +P F D P+FEE  DKI + LFE+NG +STL+QF ++L +  + S  +  + ++ N++KK
Sbjct: 11  APHFSDNPQFEEWVDKIMNNLFEMNGHLSTLQQFIKTLQK--NQSQGNTRSKMIANLDKK 68

Query: 70  ALTNIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFS 129
           ++ +I  + ELLK +N  V +I+ IE++ELD+ Q+I+RDKL RD ++S+QE Q AQ++F+
Sbjct: 69  SVYHINAITELLKVINSLVHKINEIEETELDRAQLISRDKLTRDVKYSVQEFQEAQKEFT 128

Query: 130 KIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQ 189
              K +NA+A+  L           EDEE+ + N  N+ + Q    IERE INNEEFAYQ
Sbjct: 129 STSKVMNAQAKQAL----------AEDEETREDNVINS-KSQEQITIEREAINNEEFAYQ 177

Query: 190 QRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQEL 249
           QRLIQERDEEI +IE GI ELN IF DLG ++  QG +VDNIE+NIY+   NT   ++EL
Sbjct: 178 QRLIQERDEEIAHIESGIEELNDIFHDLGTIVQQQGYLVDNIESNIYTVANNTQSGAREL 237

Query: 250 NKANRMQKRSSRYCL 264
            KA R Q+ SS +C+
Sbjct: 238 TKAMRSQRSSSIWCI 252

>KLLA0E21857g 1943933..1944760 similar to sp|P32854 Saccharomyces
           cerevisiae YOR036w PEP12 syntaxin (T-SNARE), vacuolar,
           hypothetical start
          Length = 275

 Score =  219 bits (558), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 172/253 (67%), Gaps = 14/253 (5%)

Query: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72
           +RD P FE+  D IS +LFE+NG +ST+  F  +L   + +     N  V+ NINKK + 
Sbjct: 11  YRDSPEFEDCCDAISQDLFELNGSLSTMNHFVTALETNVSHGK--SNTKVIDNINKKTVE 68

Query: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132
            I+   +L+ ++NE++ +++ +E+S LDKP +I R+KL RD++FS+QE +  QQ F ++ 
Sbjct: 69  LIDKSTKLVSSINENIHKVNELEESALDKPHLITREKLTRDAKFSVQEFKKYQQHFLEVT 128

Query: 133 KSINAEARGKL-NEEQN---WTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAY 188
           K IN  A+  L +EEQN      +L+E+E+ H         ++   VIEREPINNEEFAY
Sbjct: 129 KRINDMAKVALEDEEQNNSLMDTVLREEEDEHA--------KRTQVVIEREPINNEEFAY 180

Query: 189 QQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQE 248
           QQ LI+ERD+EI+NIE+GITELNGIFKDLG ++  QG +VD+IEAN+Y+  +NT  A+ E
Sbjct: 181 QQHLIRERDQEISNIEQGITELNGIFKDLGGLVQQQGQLVDSIEANLYNVEDNTRNAANE 240

Query: 249 LNKANRMQKRSSR 261
           L++A R  + SS+
Sbjct: 241 LSRAMRSGRSSSK 253

>ACR092C [1139] [Homologous to ScYOR036W (PEP12) - SH]
           (521646..522470) [825 bp, 274 aa]
          Length = 274

 Score =  189 bits (480), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 160/251 (63%), Gaps = 9/251 (3%)

Query: 13  FRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALT 72
           + D P+FEE    I S LFE+NG++ T + F + L     N     N  VV+NI+ +++ 
Sbjct: 14  YSDNPQFEEWGTDIVSNLFEMNGQLGTFQHFIKGLESNYRNGK--ANTMVVENISNRSME 71

Query: 73  NIEVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKII 132
            I  V+ L+K +N  V  I+ I  +ELD+ Q+  R+KL RD R S+QE Q  Q +F+ I 
Sbjct: 72  VIHKVSLLVKTLNGLVHSINAIPKNELDRTQLTTREKLNRDIRLSVQEFQRCQSEFAGIR 131

Query: 133 KSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQQRL 192
           K IN +A+  L       +  QE+        +  AQ+Q + VIEREPINNEEFAYQQ L
Sbjct: 132 KQINEQAKISL-------SEQQEEAAGAAALEEEAAQQQHHIVIEREPINNEEFAYQQEL 184

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           I++RDEEI NIERGI ELN +F+DLG+++  Q  +VD+IE NIY+AV +T  AS EL++A
Sbjct: 185 IRKRDEEIANIERGIVELNEVFQDLGSIVQQQSELVDHIENNIYTAVTSTNHASNELSRA 244

Query: 253 NRMQKRSSRYC 263
            R Q+RS+R+C
Sbjct: 245 LRYQRRSNRWC 255

>Scas_607.2
          Length = 417

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 121/261 (46%), Gaps = 28/261 (10%)

Query: 17  PRFEELKDKISSELFEVNGRVSTLRQFTE--SLSRFLDNSDIDVNANVVQNINKKALTNI 74
           P F E+   I   L EV   +  L +  +  SL  F D S    + +V+++++ K + N 
Sbjct: 65  PLFVEIARDIDEYLIEVASLMGKLTKLYKKNSLPGFEDKSR---DESVIEDLSYKVIQNF 121

Query: 75  EVVNELLKNVNEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQ-ES---QTAQQQFSK 130
           +    + K + E +     +E  +L+K ++I  D +++     IQ ES   +  Q  + K
Sbjct: 122 QKCYNITKKL-EKIFNTQMMEGKQLNKGELIILDNILKRYAQKIQGESNRFRVLQNSYLK 180

Query: 131 IIKSINAEARGKLNEEQNWTALLQEDEESHQTN----------NDNTAQRQVNFVIEREP 180
            +   + +      E      LL E E++ Q+N          +  T QRQ       E 
Sbjct: 181 FLNKDDLKPISAKPESDTSQMLLFEMEDNEQSNVEAQQDIDAYSRKTLQRQQELTTTNES 240

Query: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240
                    Q+ +Q+RDEEIT + +G+ E++ IF+++  +I  QG +VD I+ N+ +   
Sbjct: 241 --------SQQFLQQRDEEITQLAKGVLEVSTIFREMQGLIIDQGTVVDRIDYNLQNTTI 292

Query: 241 NTAGASQELNKANRMQKRSSR 261
               A++EL +A   QKR+ +
Sbjct: 293 QLKEANKELGQATVYQKRTQK 313

>KLLA0A10681g 928563..929657 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 364

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%)

Query: 190 QRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQEL 249
           Q+ +Q+RDEEIT + +G+ E++ IF+++ ++I  QG +VD I+ N+ + V     A +EL
Sbjct: 232 QQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYNLENTVIELKQAQKEL 291

Query: 250 NKANRMQKRSSR 261
           +KA   QKRS +
Sbjct: 292 DKATHYQKRSQK 303

>AFL232W [2963] [Homologous to ScYOR106W (VAM3) - SH]
           complement(5332..6237) [906 bp, 301 aa]
          Length = 301

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 97/214 (45%), Gaps = 24/214 (11%)

Query: 63  VQNINKKA-LTNIEVVNELLKNV--NEDVKEIDNIEDSELDKPQIIARDKLIRDSRFSIQ 119
           VQN+ KK  L      +  L+N   +ED+   + + D     P++  RDK + D  +   
Sbjct: 67  VQNLRKKVQLLGTARDDHTLRNSIESEDIPRCEQLRDRLQSNPRLTGRDKYVSDLHWLTV 126

Query: 120 ESQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNT------------ 167
           E    ++ + K  + + +  R K        A        H+    N+            
Sbjct: 127 ELLQLKRNYQK--RKLGSPLRSKSGAADGGAAAPPGHAPPHEEPGRNSYVSIQVRSDERT 184

Query: 168 ---AQRQVNFVIEREPINNEEFAYQQRLIQE-RDEEITNIERGITELNGIFKDLGAVITH 223
              AQ+Q+  + ++E +  EE  +   LIQE R +EI+NI   + ++N IFK LG ++  
Sbjct: 185 PLLAQQQI--LRQQEHVPQEELDFHS-LIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQE 241

Query: 224 QGMMVDNIEANIYSAVENTAGASQELNKANRMQK 257
           QG  VD I++NI     N  GA+Q L KA R Q+
Sbjct: 242 QGKQVDTIDSNINGLTSNLQGANQHLRKAERYQR 275

>Sklu_2256.2 YOL018C, Contig c2256 2912-4045 reverse complement
          Length = 377

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 89/168 (52%), Gaps = 10/168 (5%)

Query: 98  ELDKPQIIARDKLIRDSRFSIQES----QTAQQQFSKIIKSINAEARGKLNEEQNWTALL 153
           +L K +I+  D L ++    IQ S    +  Q  + + +   + +     + +Q+   LL
Sbjct: 152 QLTKGEIVILDNLQKNYATKIQTSSNKFRVLQNNYLRFLNKDDFKPLPTASSDQDTLLLL 211

Query: 154 QEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQQRLIQERDEEITNIERGITELNGI 213
           QE+E   Q   D+ +++ +    +R+   N +F      +Q+R+EEIT + RG+ E++ I
Sbjct: 212 QEEENDTQQEIDSYSRQTLQKQTQRQNSANTQF------LQQREEEITELARGVLEVSTI 265

Query: 214 FKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKANRMQKRSSR 261
           F+++  +I  QG +VD I+ N+ + V     A +EL++A   QKR+ +
Sbjct: 266 FREMQNLIIDQGTVVDRIDYNLENTVIELKQAQKELDRATHYQKRTQK 313

>YOL018C (TLG2) [4798] chr15 complement(290881..292074) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [1194 bp, 397 aa]
          Length = 397

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 46/69 (66%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           ++ERDEEIT + RG+ E++ IF+++  ++  QG +VD I+ N+ + V     A +ELNKA
Sbjct: 247 LRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKA 306

Query: 253 NRMQKRSSR 261
              QKR+ +
Sbjct: 307 THYQKRTQK 315

>KLLA0C13233g complement(1129020..1129808) weakly similar to
           sp|Q12241 Saccharomyces cerevisiae YOR106w VAM3 syntaxin
           (t-SNARE) singleton, start by similarity
          Length = 262

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 51/86 (59%), Gaps = 1/86 (1%)

Query: 177 EREPI-NNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANI 235
           ++EP+ N +E  +   +  ER ++I+ I   + E+N IFK LG+++  QG  VD I  N+
Sbjct: 155 QQEPLLNQDELDFHTIIQHERSQDISKIHSAVQEVNAIFKQLGSLVQEQGEQVDTIGENV 214

Query: 236 YSAVENTAGASQELNKANRMQKRSSR 261
                N   A++EL+KAN  Q++ +R
Sbjct: 215 TGLSNNLQKANKELHKANEYQRKKNR 240

>CAGL0G04807g complement(458085..458822) similar to sp|Q12241
           Saccharomyces cerevisiae YOR106w VAM3 syntaxin,
           hypothetical start
          Length = 245

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 66/121 (54%), Gaps = 2/121 (1%)

Query: 147 QNWTALLQEDEESHQTNNDNTAQRQVNFV--IEREPINNEEFAYQQRLIQERDEEITNIE 204
           +N  AL  E  E     + NT Q+ ++    +E+  IN++E  +   + ++R  +I+ I 
Sbjct: 108 ENQVALADETTERTPLLHTNTQQQHMHLQDQMEQGLINDDELDFHTIVQEDRSRQISRIH 167

Query: 205 RGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKANRMQKRSSRYCL 264
             + E+N IFK LG ++  QG  VD ++ NI +   N   A+++LN+A+  Q++ +R  L
Sbjct: 168 SSVQEVNAIFKQLGTLVREQGTQVDTVDENIANFDNNMHRANEQLNRADEHQRQRNRCGL 227

Query: 265 Y 265
            
Sbjct: 228 M 228

>Kwal_26.8414
          Length = 260

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 48/81 (59%)

Query: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240
           ++ +E  +   + QER EEI+ I   + E+N IF  LG ++  QG  VDNI+ NI     
Sbjct: 158 VSQDELNFHTLVQQERSEEISRIHSAVQEVNAIFHQLGTLVREQGDDVDNIDNNISGLAG 217

Query: 241 NTAGASQELNKANRMQKRSSR 261
           N   A+++L KA++ Q++ +R
Sbjct: 218 NLQRANEQLGKADQSQRKKNR 238

>CAGL0G08932g 855763..856866 similar to sp|Q08144 Saccharomyces
           cerevisiae YOL018c TLG2 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 367

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +  RDEEIT + +G+ E++ IF+++ ++I  QG ++D I+ N+ + V     A  ELNKA
Sbjct: 238 LHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRIDYNLENTVIELKSAQNELNKA 297

Query: 253 NRMQKRSSR 261
              QKR+ +
Sbjct: 298 TTYQKRTQK 306

>Kwal_34.16287
          Length = 362

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 46/69 (66%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q+R++EIT + RG+ E++ IF+++  ++  QG ++D I+ N+ + V    GA +EL++A
Sbjct: 230 LQQREQEITQLARGVLEVSSIFREMQDLVVDQGTIIDRIDYNLENTVLELKGAQRELDRA 289

Query: 253 NRMQKRSSR 261
              Q RS +
Sbjct: 290 TVYQTRSQK 298

>Sklu_2407.11 YOR106W, Contig c2407 19619-20449 reverse complement
          Length = 276

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%)

Query: 181 INNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVE 240
           ++ +E  +   + QER +EI+ I   + E+N IF  LG ++  QG  VD I+ NI     
Sbjct: 174 LSQDELDFHSIIQQERSQEISRIHSAVQEVNAIFHQLGTLVQEQGEQVDTIDNNISGLGN 233

Query: 241 NTAGASQELNKANRMQKRSSR 261
           N   A+ +L  A R Q++ +R
Sbjct: 234 NLQKANDQLANAERYQRKKNR 254

>Scas_697.44
          Length = 281

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 176 IEREPINNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANI 235
           I RE    ++  +Q  + QER ++I+ I   + E+N IF  LG+++  QG  VD I+ NI
Sbjct: 176 IRRE--TGDDVDFQTIIQQERSQQISRIHTAVKEVNAIFHQLGSLVQEQGEQVDTIDGNI 233

Query: 236 YSAVENTAGASQELNKANRMQKRSSRYCL 264
                N   A ++L +A+  Q++ +R  +
Sbjct: 234 SQLSGNMQKADEQLRRADENQRQRNRCGM 262

>AFR210C [3402] [Homologous to ScYLR026C (SED5) - SH]
           (811271..812260) [990 bp, 329 aa]
          Length = 329

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 110/247 (44%), Gaps = 26/247 (10%)

Query: 11  PMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQN-INKK 69
           PMF D P       +I+   + +  ++ ++ Q    LSR + N+   V     Q  ++ K
Sbjct: 73  PMFNDNPV------EIAQMTYLIKHKIYSVEQEMMELSRHMPNNGGGVADGGAQTRLHTK 126

Query: 70  ALTNIEVVNELLKNVNEDVKEI----DNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQ 125
            + N+  +N  +KN++ D K +      +E +  D+ + I+ D+    +  +    Q   
Sbjct: 127 NVVNL--LNTKMKNISGDFKSVLEARQKLELANRDRWEKISADR----NSAAAASLQDGL 180

Query: 126 QQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNND-NTAQRQVNFVIEREPINNE 184
                 + S +A A    N     ++LL ED+ S Q N   +    +   ++E +   N+
Sbjct: 181 PMGGMGVSSGSAAAYNSANPFM--SSLLAEDDASGQPNGQLSLPNEESVLLLEEQQTANQ 238

Query: 185 EFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAG 244
           ++      +QER   +  IE  I E+  +F+ L  ++  QG  +  I+AN+     N AG
Sbjct: 239 QY------LQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDINIAG 292

Query: 245 ASQELNK 251
           A +EL K
Sbjct: 293 AQRELLK 299

>YOR106W (VAM3) [4909] chr15 (519121..519972) Syntaxin homolog
           (t-SNARE), required for vacuolar assembly [852 bp, 283
           aa]
          Length = 283

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 41/70 (58%)

Query: 188 YQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQ 247
           +Q  + QER ++I  I   + E+N IF  LG+++  QG  V  I+ NI    +N   A++
Sbjct: 188 FQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANK 247

Query: 248 ELNKANRMQK 257
           +L +A++ Q+
Sbjct: 248 QLTRADQHQR 257

>AEL026C [2480] [Homologous to ScYOL018C (TLG2) - SH]
           (585366..586415) [1050 bp, 349 aa]
          Length = 349

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 45/69 (65%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +++RD EIT + +G+ +++ IF+++  +I  QG +VD I+ N+ +   +   A +EL++A
Sbjct: 236 LEDRDAEITQLAKGVLKVSTIFREMQTLILDQGTVVDRIDYNLENTNIDLKQAQRELDQA 295

Query: 253 NRMQKRSSR 261
              QKR+ +
Sbjct: 296 VGYQKRTQK 304

>Sklu_2338.5 YLR026C, Contig c2338 7666-8589 reverse complement
          Length = 307

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 103/245 (42%), Gaps = 38/245 (15%)

Query: 11  PMFRDCPRFEELKDKISSELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKA 70
           PMF D P       +I+   F +  ++ ++ Q    LS+ + NS    +A   QN  + +
Sbjct: 67  PMFNDNPV------EIAELSFVIKRKIYSIEQSLMELSK-MGNSSTQPSAQ--QNNTQHS 117

Query: 71  LTNIEVVNELLKNVNEDVKEI----DNIEDSELDKPQIIARDKLIRDSRFSIQESQTAQQ 126
              + ++N  +KN++ D K +      +E +  D+ + I+      D   S Q + T   
Sbjct: 118 KNVMTLLNTKMKNISGDFKTVLENRQKLELANKDRWEKISAQANEGDPTHSAQNAATYN- 176

Query: 127 QFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEF 186
                            N     ++L+ ED++  Q    +  Q     ++E +  NN   
Sbjct: 177 -----------------NSNPFMSSLVDEDQQPRQNGTLSLPQESSMLLLEEQAANNT-- 217

Query: 187 AYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGAS 246
                 +QER+  +  IE  I E+  +F+ L  ++  QG  +  I+AN+     N +GA 
Sbjct: 218 -----YLQERNRAVETIESTIQEVGNLFQQLAHMVQEQGETIQRIDANVEDIDLNISGAQ 272

Query: 247 QELNK 251
           +EL K
Sbjct: 273 RELIK 277

>CAGL0D01914g 201005..202012 highly similar to sp|Q01590
           Saccharomyces cerevisiae YLR026c SED5, start by
           similarity
          Length = 335

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 12/102 (11%)

Query: 156 DEESHQTNNDNT------AQRQVNFVIEREPINNEEFAYQQRLIQERDEEITNIERGITE 209
           DEESH   N  +      +  Q+  ++E   + N  +      +QER+  +  IE  I E
Sbjct: 210 DEESHANANKGSELALPQSDSQMLLMMEEGQMANNVY------LQERNRAVETIESTIQE 263

Query: 210 LNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNK 251
           +  +F+ L +++  QG ++  I+AN+     N  GA +EL K
Sbjct: 264 VGNLFQQLASMVQEQGEVIQRIDANVDEVDLNITGAQRELLK 305

>Scas_721.106
          Length = 377

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNK 251
           +QER+  +  IE  I E+  +F+ L +++  QG ++  I+AN+     N  GA +EL K
Sbjct: 289 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVEDVDLNITGAQRELLK 347

>YLR026C (SED5) [3444] chr12 complement(195451..196473) Syntaxin
           homolog (t-SNARE) required in ER to Golgi transport,
           found on Golgi membrane which receives transport
           vesicles [1023 bp, 340 aa]
          Length = 340

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNK 251
           +QER+  +  IE  I E+  +F+ L +++  QG ++  I+AN+     N +GA +EL K
Sbjct: 252 LQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLK 310

>Kwal_26.7532
          Length = 303

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNK 251
           +QER   +  IE  I E+  +F+ L  ++  QG ++  I+AN+     N +GA +EL K
Sbjct: 215 LQERSRAVETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVEDIDLNISGAQRELLK 273

>KLLA0F17798g 1629735..1630688 similar to sp|Q01590 Saccharomyces
           cerevisiae YLR026c SED5 syntaxin (T-SNARE) singleton,
           start by similarity
          Length = 317

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 190 QRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQEL 249
           QR +QER   I  IE  I E+  +F+ L  ++  QG  +  I+ N+     N  GA +EL
Sbjct: 226 QRYLQERSNAIETIESTIQEVGNLFQQLAHMVQEQGETIQRIDDNVGDIEMNIHGAQREL 285

Query: 250 NK 251
            K
Sbjct: 286 LK 287

>Scas_720.32
          Length = 310

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q+R +E+  +E+ + ELN +F D+  ++  Q   VD I+ N+  A ++        NKA
Sbjct: 212 VQQRHQELLQLEKSMAELNQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGYTNKA 271

Query: 253 NRMQKRSSR 261
               +R+ R
Sbjct: 272 VDSARRARR 280

>YMR183C (SSO2) [4138] chr13 complement(626920..627807) Syntaxin
           homolog (t-SNARE) involved in vesicle transport from
           Golgi to plasma membrane [888 bp, 295 aa]
          Length = 295

 Score = 35.4 bits (80), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSA---VENTAGASQEL 249
           +Q R +E+  +E+ + EL  +F D+  ++  Q   VD I+ N+  A   VE   G + + 
Sbjct: 197 VQARHQELLKLEKTMAELTQLFNDMEELVIEQQENVDVIDKNVEDAQQDVEQGVGHTNKA 256

Query: 250 NKANRMQKRSSRYCL 264
            K+ R  +++   CL
Sbjct: 257 VKSARKARKNKIRCL 271

>Scas_333.3
          Length = 298

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q R +E+  +E+ + EL  +F D+  ++  Q   +D I+ N+  A ++        NKA
Sbjct: 200 VQARHQELLQLEKSMAELTQLFNDMEQLVIEQQETIDVIDQNVEEAQQDVEQGIGHTNKA 259

Query: 253 NRMQKRSSR 261
               +R+ R
Sbjct: 260 VESARRARR 268

>CAGL0E06160g complement(619255..620103) highly similar to sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1 or sp|P39926
           Saccharomyces cerevisiae YMR183c SSO2, start by
           similarity
          Length = 282

 Score = 33.1 bits (74), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSA---VENTAGASQEL 249
           +Q R +E+  +E+ + EL  +F D+  ++  Q   ++ I+ ++  A   VE   G + + 
Sbjct: 185 VQARHQELMQLEKTMAELAQLFNDMEEMVVEQQENIEVIDKHVEEAQQDVEQGVGHTNKA 244

Query: 250 NKANRMQKRSSRYC 263
            K+ R  +R   +C
Sbjct: 245 VKSARAARRKKLWC 258

>Kwal_56.24259
          Length = 288

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 36/69 (52%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q R +E+  +E+ + EL  +F D+  ++  Q   ++ I+ N+  A ++        NKA
Sbjct: 192 VQARHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKNVEEAQQDVEQGVGHTNKA 251

Query: 253 NRMQKRSSR 261
            +  +R+ R
Sbjct: 252 VKSARRARR 260

>CAGL0L00561g 63339..64133 similar to sp|P39926 Saccharomyces
           cerevisiae YMR183c SSO2 syntaxin or sp|P32867
           Saccharomyces cerevisiae YPL232w SSO1, hypothetical
           start
          Length = 264

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 175 VIEREPINNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEAN 234
           + +R  ++NE+       ++ R +EI N+E+ + +L  +FK++  ++  Q   +D I+ N
Sbjct: 147 IFKRYLLSNEDAKMALNEVEHRMKEIKNLEKRMNDLAILFKEMEELVVQQEEPIDKIDTN 206

Query: 235 IYSAVENTAGASQELNKANRM--QKRSSRYCL 264
           +   V +         +A  +  QKR ++  L
Sbjct: 207 VEKVVVDLESGITHTEQAIHIAEQKRKNKKLL 238

>YGR134W (CAF130) [2091] chr7 (757773..761141) Component of
           Ccr4p-NOT complex [3369 bp, 1122 aa]
          Length = 1122

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 13/132 (9%)

Query: 97  SELDKPQIIARDKLIRDSRFSIQESQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQED 156
           S  DKP ++ R K+++D    I+      + F     S NAE R  L    N + L++ D
Sbjct: 197 STFDKPALVVR-KILKDYNRMIE-----CRNF-YFWYSFNAENRVNLTFSDNISLLMEND 249

Query: 157 EESHQTNNDNT---AQRQVNFVIEREPINNEEFAYQQRLIQERDEEITNI-ERGITELNG 212
           E +  +  D++    Q+Q    I    IN++E  Y   L Q+   EI N+ E  +     
Sbjct: 250 EGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHEL 309

Query: 213 IFK--DLGAVIT 222
           +FK  +L  V+T
Sbjct: 310 LFKILNLTTVLT 321

>KLLA0F05291g 522324..523601 weakly similar to sgd|S0002348
           Saccharomyces cerevisiae YDL189w, start by similarity
          Length = 425

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/90 (18%), Positives = 40/90 (44%), Gaps = 1/90 (1%)

Query: 139 ARGKLNEEQNWTALLQEDEESHQTNNDNTAQRQVNFVIEREPINNEEFAYQQRLIQERDE 198
           +R  LN  QN    +++ +  H     N+   + N  + R+P+ +  +     +   R +
Sbjct: 293 SRFNLNH-QNEMKYMKKTQYQHNNKRQNSHNNRYNKPLNRQPVMHPYYGVPPPMAPMRPD 351

Query: 199 EITNIERGITELNGIFKDLGAVITHQGMMV 228
            I    + +  +  ++  +GA +T+  MM+
Sbjct: 352 SIPFGYQMVAPMEYMYYPIGAPMTNNRMMI 381

>KLLA0C15961g 1387763..1388623 gi|15824638|gb|AAL09428.1
           Kluyveromyces lactis SSO1, start by similarity
          Length = 286

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 37/69 (53%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q+R +E+  +E+ + EL  +F D+  ++  Q   ++ I+  + +A ++        NKA
Sbjct: 190 VQQRHQELLKLEKTMAELTQLFNDMEQLVIEQQENIEVIDKQVENAQQDVEQGVGHTNKA 249

Query: 253 NRMQKRSSR 261
            +  +R+ +
Sbjct: 250 VKSARRARK 258

>AFL139W [3056] [Homologous to ScYMR183C (SSO2) - SH; ScYPL232W
           (SSO1) - SH] complement(169508..170401) [894 bp, 297 aa]
          Length = 297

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%)

Query: 193 IQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGASQELNKA 252
           +Q R +E+  +E+ + EL  +F D+  ++  Q   V+ I+  +  A ++        NKA
Sbjct: 201 VQARHQELLKLEKTMAELTQLFNDMEHLVIEQQEQVEFIDKQVEEAQQDVEQGVGHTNKA 260

Query: 253 NRMQKRSSR 261
            +  +R+ +
Sbjct: 261 VKSARRARK 269

>AEL289W [2216] [Homologous to ScYKR006C (MRPL13) - SH]
           complement(97077..97820) [744 bp, 247 aa]
          Length = 247

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 28  SELFEVNGRVSTLRQFTESLSRFLDNSDIDVNANVVQNINKKALTNIEVVNELLKNVNED 87
           ++ +E N     L++F E L   +D SD D+  NVV  + +  L  ++      K +N  
Sbjct: 173 AQWYERNVLTGKLQKFREELPNAIDLSDADLPVNVV--VREHVLPKVQ-----RKTLNAV 225

Query: 88  VKEIDNIEDSE 98
           ++E+  +E S+
Sbjct: 226 LREVSALETSK 236

>KLLA0E03443g 320167..320862 similar to sgd|S0002876 Saccharomyces
           cerevisiae YDR468c TLG1 member of the syntaxin family of
           t-SNAREs, start by similarity
          Length = 231

 Score = 28.5 bits (62), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 31/49 (63%)

Query: 187 AYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANI 235
           A Q++L++E+D ++  I + +  ++     +G  +T QGM+++ ++ N+
Sbjct: 136 AVQEQLLREQDNQLDMIHQTMQNIHLQASTMGQELTEQGMILEEMDGNV 184

>YDR468C (TLG1) [1285] chr4 complement(1398014..1398688) Syntaxin
           homolog (t-SNARE), involved in efficient endocytosis and
           in maintenance of resident proteins in the trans-Golgi
           network [675 bp, 224 aa]
          Length = 224

 Score = 27.7 bits (60), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/63 (20%), Positives = 35/63 (55%)

Query: 187 AYQQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANIYSAVENTAGAS 246
            +Q+++++E+D  +  I + +  L+   + +G  + +QG ++DN++  +   V   A   
Sbjct: 129 PFQEQMLREQDVHLDGIHKTMQNLHIQAQTMGDELENQGQLLDNMDEGMDGVVNKLARGR 188

Query: 247 QEL 249
           ++L
Sbjct: 189 RQL 191

>Sklu_2436.16 YDR468C, Contig c2436 36704-37339 reverse complement
          Length = 211

 Score = 27.7 bits (60), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 27/47 (57%)

Query: 189 QQRLIQERDEEITNIERGITELNGIFKDLGAVITHQGMMVDNIEANI 235
           QQ++IQE+D  +  I + +  L+     +G  +  QG+M+D ++  +
Sbjct: 118 QQQMIQEQDTHLDTIHQTMQSLHLQASTMGQELEDQGLMLDEMDQGM 164

>YIL110W (YIL110W) [2566] chr9 (156042..157175) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.4595p [1134 bp, 377 aa]
          Length = 377

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 72/168 (42%), Gaps = 32/168 (19%)

Query: 57  DVNANVVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELD-------KPQIIARDK 109
           D + ++ +NI +  L + E   +L+  ++E+V  I N  D+ ++         + + R  
Sbjct: 118 DTSEDLRKNIYEGGLKSWECSYDLVDLLSENVDRISNDIDAVVEIGCGTALPSEFLFRSA 177

Query: 110 LIRDSR-----FSIQESQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESHQTNN 164
           L+R+ R     F + +   +  +   I   +   A+  L +EQ W AL Q+DE       
Sbjct: 178 LLRNDRSKGLKFVLTDYNASVLRLVTIPNLVITWAKTVLTKEQ-WYAL-QKDE------- 228

Query: 165 DNTAQRQVNFVIEREPINNEEFAYQQRLIQERDEEITNIERGITELNG 212
                       E  PINNEE     +L+    +++ +    +T ++G
Sbjct: 229 -----------CEDIPINNEELLLTSKLLAAFYDDVQSRNISVTLISG 265

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.128    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,515,707
Number of extensions: 390084
Number of successful extensions: 2405
Number of sequences better than 10.0: 275
Number of HSP's gapped: 2356
Number of HSP's successfully gapped: 295
Length of query: 278
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 178
Effective length of database: 13,134,309
Effective search space: 2337907002
Effective search space used: 2337907002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)