Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I00990g34333818030.0
Scas_699.413183286304e-80
KLLA0E21901g3573346118e-77
YOR037W (CYC2)3663516014e-75
Kwal_55.215613493045734e-71
ACR090C3662965641e-69
YIL043C (CBR1)322216974e-04
CAGL0B02519g312180957e-04
ACR054C306230930.001
KLLA0D04488g296234900.003
KLLA0C16918g31089870.007
Sklu_2260.2350109870.008
Scas_704.43316172830.022
Kwal_47.18159287109820.030
YML125C31289820.032
CAGL0E06424g298229800.050
Scas_692.631472780.078
ADL087W287208770.096
Sklu_2184.231072770.11
CAGL0L00847g285170760.15
AFR439C31051760.16
KLLA0F27621g281107730.31
Kwal_33.1426030876730.33
YML087C312107710.57
Kwal_23.5471312233710.68
AFR075C74071691.5
Kwal_56.24115148541691.6
KLLA0E10791g85371645.4
Kwal_34.1630934469636.6
Kwal_33.1508947869637.3
Kwal_47.1766562569637.4
Kwal_27.1243864169638.2
YKL150W (MCR1)302233619.4
Kwal_36.1633860469629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I00990g
         (338 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...   699   0.0  
Scas_699.41                                                           247   4e-80
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...   239   8e-77
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...   236   4e-75
Kwal_55.21561                                                         225   4e-71
ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH] (519431..52...   221   1e-69
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...    42   4e-04
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...    41   7e-04
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...    40   0.001
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...    39   0.003
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...    38   0.007
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                            38   0.008
Scas_704.43                                                            37   0.022
Kwal_47.18159                                                          36   0.030
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...    36   0.032
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...    35   0.050
Scas_692.6                                                             35   0.078
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...    34   0.096
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement         34   0.11 
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...    34   0.15 
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...    34   0.16 
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...    33   0.31 
Kwal_33.14260                                                          33   0.33 
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...    32   0.57 
Kwal_23.5471                                                           32   0.68 
AFR075C [3267] [Homologous to ScYJL108C (PRM10) - SH; ScYJL107C ...    31   1.5  
Kwal_56.24115                                                          31   1.6  
KLLA0E10791g 951335..953896 weakly similar to sp|P48237 Saccharo...    29   5.4  
Kwal_34.16309                                                          29   6.6  
Kwal_33.15089                                                          29   7.3  
Kwal_47.17665                                                          29   7.4  
Kwal_27.12438                                                          29   8.2  
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...    28   9.4  
Kwal_36.16338                                                          28   9.7  

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/338 (100%), Positives = 338/338 (100%)

Query: 1   MLKGYQALCGRRTISSVSPIKRSFSKRSIIGYSIILSASAFVTWTYKDLIKQKYVETFTK 60
           MLKGYQALCGRRTISSVSPIKRSFSKRSIIGYSIILSASAFVTWTYKDLIKQKYVETFTK
Sbjct: 1   MLKGYQALCGRRTISSVSPIKRSFSKRSIIGYSIILSASAFVTWTYKDLIKQKYVETFTK 60

Query: 61  TKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMV 120
           TKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMV
Sbjct: 61  TKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMV 120

Query: 121 VRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRG 180
           VRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRG
Sbjct: 121 VRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRG 180

Query: 181 PFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPILNPYGQFNYNMT 240
           PFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPILNPYGQFNYNMT
Sbjct: 181 PFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPILNPYGQFNYNMT 240

Query: 241 LFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGDNIIDFKQLIPGPNTSNAGNLDT 300
           LFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGDNIIDFKQLIPGPNTSNAGNLDT
Sbjct: 241 LFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGDNIIDFKQLIPGPNTSNAGNLDT 300

Query: 301 SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN 338
           SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN
Sbjct: 301 SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN 338

>Scas_699.41
          Length = 318

 Score =  247 bits (630), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 144/328 (43%), Positives = 196/328 (59%), Gaps = 40/328 (12%)

Query: 26  KRSIIGYSI---ILSASAFVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDIDN 82
           K  I+ YSI   +    A + W      K   + T ++T ELSP  FT YKI+ R DID 
Sbjct: 11  KSRILRYSIPTLVTVTGAVIVW------KSLGIRTPSRT-ELSPTHFTPYKISYRQDIDA 63

Query: 83  CHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVRNYTPLPLQ-LKSNGNIVPL- 140
            HYL+ELTP   Q  N+W+++ RN++WS+E+KQPEIMVVRNYTP+PL  ++ + +++P+ 
Sbjct: 64  SHYLLELTPSNPQKTNIWEQIPRNVIWSVEIKQPEIMVVRNYTPVPLSFVQDHNDLIPMT 123

Query: 141 DLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANG 200
           D ND   + KL+FY+K Y+NGEVARW+  LPV ST+E+RGPFIDYKF+            
Sbjct: 124 DKND---TGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRGPFIDYKFQE----------- 169

Query: 201 STLINKTQLSNVPFFAGGTGIVTALQPILNPYGQ--FNYNMTLFHSCKSIQELGCLYHLV 258
               + T+  +V  F  G G+VTA Q +L+P  +  F  ++ LFHSC S+ ELG L  ++
Sbjct: 170 ---TDNTKF-DVSMFTAGAGVVTAFQLLLSPSSKNDFRGSVRLFHSCGSLNELGPLKKIM 225

Query: 259 NGLAQQN-KITYHLFETSKGDNI----IDFKQLIPGPNTSNAG--NL-DTSIVCGPEGYI 310
             L   N  I    FE+ KGD+I        QL P    S  G  NL   ++VCGPEG+I
Sbjct: 226 FSLQHDNGPIDMKFFESEKGDDIRTQLKSVSQLFPQFKPSQLGRSNLRQLALVCGPEGFI 285

Query: 311 TTVAGAKYDTSQGPIEGLLGEKGWDNSN 338
            TVAGA  D  QGP+ G+L + GW   N
Sbjct: 286 DTVAGASVDLEQGPVGGILKQNGWPREN 313

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score =  239 bits (611), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 199/334 (59%), Gaps = 33/334 (9%)

Query: 28  SIIGYSIILSASAFV---TWTYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDIDNCH 84
           S++   ++LS S  +   +W Y       Y E+  + +ELS + F++YKI++++ ID  H
Sbjct: 29  SLLKTVLLLSGSVAIGALSWNY-------YKESLYQ-RELSRDYFSKYKISKKYSIDQDH 80

Query: 85  YLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVRNYTPLPLQLKSNGNIVPLDLND 144
           YLIELTPLK Q VNLWKE+  + LWS+EVKQPEIMVVR+YTPLPL ++ NG +  L  ++
Sbjct: 81  YLIELTPLKAQKVNLWKEMNSSKLWSVEVKQPEIMVVRSYTPLPLTIEENGAVEVLR-DE 139

Query: 145 PVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRD-----AN 199
              S  L FYIK Y  GEVARWI  LP+G  LELRGPF++Y+F +   +  RD      N
Sbjct: 140 ENASGALTFYIKQYKQGEVARWINHLPLGHVLELRGPFVEYEFPDTADEITRDRSFLWGN 199

Query: 200 GSTLIN--KTQLSNVPFFAGGTGIVTALQPILNPYGQFNYNMTLFHSCKSIQELGCLYHL 257
              + +  K Q  ++ FF GGTGIV  LQ  L     F   +  +HSCKS+ ELG L  +
Sbjct: 200 EDCVKDNYKYQPFDILFFTGGTGIVPLLQMTLTE-SPFRGKIGAYHSCKSLTELGPLNSI 258

Query: 258 VNGLAQQNKITYHLFETSKGDNIID---FKQLIPGPNTSNAG----NLDT------SIVC 304
           +  L   ++I  H  E+++    +      + IP P          +LD+      S+VC
Sbjct: 259 LTKLQDNDRIELHTHESNRISIPLQSDPAMEGIPSPYPYGGNEPFTSLDSKVRPVLSLVC 318

Query: 305 GPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN 338
           GP G+I+TV+G KYD  QGPI+G+L  +GWDNSN
Sbjct: 319 GPGGFISTVSGPKYDLVQGPIKGILAARGWDNSN 352

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score =  236 bits (601), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 204/351 (58%), Gaps = 39/351 (11%)

Query: 18  SPIKRSFSKRSIIGYSIIL--SASAFVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKIT 75
           SP K SFSK   I   ++   + S+++T+ Y    + K+        ELSP+ F +YKI+
Sbjct: 20  SPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKH--------ELSPSYFVKYKIS 71

Query: 76  RRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVRNYTPLPLQLKSNG 135
            + DID+ H+L+E+TPL +Q VN+W  +    LWS+E+KQPE+MVVRNYTPLPL+     
Sbjct: 72  HKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVMVVRNYTPLPLKFNPAS 131

Query: 136 NIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKF-------- 187
             + +  +      KL FYIK Y NGEVARW+  LP G  +E+RGPFIDY+F        
Sbjct: 132 KEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRGPFIDYEFPHLPNELK 191

Query: 188 --RNDLSKHHRDANGSTLINKTQLSNVPF----FAGGTGIVTALQPILNPYGQFNYNMTL 241
             R+ L   +R+  G+ +   +Q    P+    F  GTGIVTALQ +L     F   + L
Sbjct: 192 RSRDCLYMDNRNERGNNVRENSQFIYQPYDIMMFTAGTGIVTALQLLLTE-SPFRGTIKL 250

Query: 242 FHSCKSIQELGCLYHLVNGLAQQNKITYHLFET---SKGDNI----------IDFKQLIP 288
           FH+ K+I++LG LY ++  L   N++   +FET   +K D +            +K L+P
Sbjct: 251 FHTDKNIKQLGPLYPILLRLQASNRVQLKIFETDRQTKQDVLKSIQKSITKPYPYKGLLP 310

Query: 289 GPNTSNAGNLDT-SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN 338
             N +N   +   ++VCGPE YI++++G KYD +QGP+ GLL ++GW++ N
Sbjct: 311 FSNVNNKNIMPVLALVCGPESYISSISGRKYDLNQGPVGGLLSKEGWNSDN 361

>Kwal_55.21561
          Length = 349

 Score =  225 bits (573), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 179/304 (58%), Gaps = 21/304 (6%)

Query: 54  YVETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEV 113
           Y + +    ELS   FT+Y+I+    ID+ H+++ELTP++ Q+ N+W  ++ + LWS++V
Sbjct: 43  YYKKYHSNVELSQEYFTQYRISYNQKIDSEHFILELTPIRPQSTNMWALMKSDKLWSVQV 102

Query: 114 KQPEIMVVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVG 173
           KQPEIMVVRNYTPLPLQ   +G    L   D  +  KL FY+K Y  GEVARW+  LP G
Sbjct: 103 KQPEIMVVRNYTPLPLQHVGSGEFKVLADGDNGQG-KLSFYLKKYQYGEVARWLSRLPEG 161

Query: 174 STLELRGPFIDYKF--RNDLSKHHRDANGSTLINKTQLSNVPF----FAGGTGIVTALQP 227
             LELRGP+IDY+F   ++  K  R        +  +L   PF    F  GTGI   +Q 
Sbjct: 162 HILELRGPYIDYEFPSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQL 221

Query: 228 ILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGD--------- 278
           +L  +  F   + LFHSC+   ELG L  +++ L + N++  + FE+SKG          
Sbjct: 222 LLTEF-PFRGRIHLFHSCRQKSELGPLGPILDVLRENNRVELNFFESSKGRDIRQISNEV 280

Query: 279 -NIIDF-KQLIPGPNTSNAGNLDT--SIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGW 334
            N+ID   Q +  P T   G +    S++CGP+ YITT++G KYD  QGPIEGLLG+KGW
Sbjct: 281 LNLIDSPSQYLKRPFTGFEGPIKPVLSLICGPDSYITTISGPKYDHFQGPIEGLLGQKGW 340

Query: 335 DNSN 338
            N N
Sbjct: 341 SNQN 344

>ACR090C [1137] [Homologous to ScYOR037W (CYC2) - SH]
           (519431..520531) [1101 bp, 366 aa]
          Length = 366

 Score =  221 bits (564), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 174/296 (58%), Gaps = 21/296 (7%)

Query: 63  ELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKELERNILWSIEVKQPEIMVVR 122
           ELS   FT+YKI+ R DID  HYL+ELTPLK+Q  N+W       LW++E+KQPEIMVVR
Sbjct: 67  ELSQEYFTKYKISYRKDIDIDHYLLELTPLKQQRNNIWALFGARNLWAVEIKQPEIMVVR 126

Query: 123 NYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPF 182
            YTPLPL    +G  +    +      KL+ YIK Y +GEVARW++ LP G  +E+RGP+
Sbjct: 127 QYTPLPLVADEDGEQLRALRDGDNGGGKLMLYIKEYGSGEVARWLRKLPKGHIVEVRGPY 186

Query: 183 IDYKFR--NDLSKHHRDANGSTLINKTQLS-----NVPFFAGGTGIVTALQPILNPYGQF 235
            +++F   +  +K  R+ +G         +     ++  FA GTGIVTALQ +L     F
Sbjct: 187 PEFEFPELDADTKRDREFSGRGRACVAAAARAGPFDIALFAAGTGIVTALQ-LLTTEDPF 245

Query: 236 NYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGDN----IIDFKQLIPG-- 289
              + LF+SCKS  +LG L  L+   AQ +++  H+FE+ KG++    +     L+ G  
Sbjct: 246 KGKIQLFYSCKSWGQLGPLGDLLRRCAQHDRVDLHVFESEKGESLRLGLSKISDLVSGPF 305

Query: 290 PNTSNA-------GNLDTSIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGWDNSN 338
           P + NA            S+VCGP+ YI  +AG ++  SQGP+ GLLG KGWDNSN
Sbjct: 306 PFSENAPFEQRPKAEPVLSLVCGPDDYIAFIAGPRHGLSQGPVTGLLGTKGWDNSN 361

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 82/216 (37%), Gaps = 54/216 (25%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           + R+YTP  L   + GN   L              +KSY  G V++ I  L +G +++++
Sbjct: 126 ITRSYTPTSLDGDTKGNFELL--------------VKSYPTGNVSKMIGELKIGDSIQIK 171

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI----LNPYGQF 235
           GP  +Y +  +   H                 +   AGGTGI    Q +    ++P+   
Sbjct: 172 GPRGNYHYERNCRSH-----------------LGMIAGGTGIAPMYQIMKAIAMDPHDTT 214

Query: 236 NYNMTL--FHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSKGD----------NIIDF 283
             ++     H  + I     L  LV     Q KI Y+L    + D          ++I  
Sbjct: 215 KVSLVFGNVHE-EDILLKKELEALVAMKPSQFKIVYYLDSPDREDWTGGVGYITKDVI-- 271

Query: 284 KQLIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD 319
           K+ +P     N   L    +CGP   + +V  +  D
Sbjct: 272 KEHLPAATMDNVQIL----ICGPPAMVASVRRSTVD 303

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 74/180 (41%), Gaps = 41/180 (22%)

Query: 50  IKQKYVETFTKTKELSPNDFTEYKITRRHDI--DNCHYLIEL-TPLKRQNVNLWKELERN 106
           I  ++   F + + L P+ +T  ++  +  I  +   Y  +L TPL+  ++     ++  
Sbjct: 53  IGARFFAAFKRRRSLYPDKWTSLELEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVR 112

Query: 107 ILWSIEVKQPEIMVVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARW 166
           +   I+ K+     VRNY P+  +                E   +   +KSY +G+V+++
Sbjct: 113 VF--IDGKEE----VRNYNPISTRF---------------EKGHIDLLVKSYKDGKVSKY 151

Query: 167 IKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQ 226
             S+  G T++ RGP                  GS +       N+    GG+GI  ALQ
Sbjct: 152 FASMKPGETVDFRGPV-----------------GSLVYKPNTYKNIGMVCGGSGITPALQ 194

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 89/230 (38%), Gaps = 54/230 (23%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           V+R YTP+               +D +        IK Y+ G+    +  L    T+E +
Sbjct: 108 VIRPYTPV---------------SDNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFK 152

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPIL----NPYGQF 235
           GP   +++  ++                   ++     GTGI    Q +     NP    
Sbjct: 153 GPIQKWRWDPNM-----------------FDSIVLMGAGTGITPLFQMMHHIAENPTD-- 193

Query: 236 NYNMTLFHSCKSIQELGC---LYHLVNGLAQQNKITYHL------FETSKGDNIIDF-KQ 285
           N  + L +  K+ Q++     L  L +    Q K+TY +      ++  KG    DF KQ
Sbjct: 194 NTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPEGDYKGEKGFITKDFLKQ 253

Query: 286 LIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYDTS-QGPIEGLLGEKGW 334
            +P P     G+     VCGP  ++   +G K   S QG + G+L E G+
Sbjct: 254 NLPTP-----GSNSHIFVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGY 298

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 88/234 (37%), Gaps = 54/234 (23%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           V+R YTP+               +D     K+   +K Y NG+    +  L    T+  +
Sbjct: 98  VIRPYTPV---------------SDNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFK 142

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPIL----NPYGQF 235
           GP   ++++ +                    ++     GTGI    Q +     NP  + 
Sbjct: 143 GPITKWEWKPN-----------------SYDSITLLGAGTGINPLYQLVHHIAENP--ED 183

Query: 236 NYNMTLFHSCKSIQEL---GCLYHLVNGLAQQNKITYHL------FETSKGDNIIDF-KQ 285
           N  + L++  K+ +++     L +L      Q KITY +      FE   G    D+   
Sbjct: 184 NTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVKITYFVDKAEGNFEGETGFITKDYLSH 243

Query: 286 LIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD-TSQGPIEGLLGEKGWDNSN 338
             P P+  N        VCGP  ++   +G K     QG + G+L E G+  SN
Sbjct: 244 QAPKPSEKNQ-----VFVCGPPPFMKAYSGPKVSPQDQGELTGILAELGYSKSN 292

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 18/89 (20%)

Query: 142 LNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGS 201
           +++  E+      +KSY +G+V+++  SL  G T++ +GP   + +  + SKH       
Sbjct: 125 ISNKFETGHFDIMVKSYADGQVSKYFASLRPGQTVDFKGPVGRFAYEANSSKH------- 177

Query: 202 TLINKTQLSNVPFFAGGTGIVTALQPILN 230
                     +   AGG+G+   LQ +LN
Sbjct: 178 ----------IGMIAGGSGLTPMLQ-VLN 195

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 31/109 (28%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           +VR+YTP  L   + G+   L              IKSY  G +++ I  L +G  +++R
Sbjct: 91  IVRSYTPTSLDSDATGHFELL--------------IKSYEKGNISKMIGELKIGDRIKVR 136

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI 228
           GP   Y +  +++                 S++   AGGTGI    Q I
Sbjct: 137 GPKGFYTYTANMN-----------------SSLAMVAGGTGIAPMYQII 168

>Scas_704.43
          Length = 316

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 72/172 (41%), Gaps = 52/172 (30%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           ++R+YTP  L  ++ G            S +LL  +KSY NG ++++I +L +G  + + 
Sbjct: 120 IMRSYTPTSLDSETKG------------SFELL--VKSYPNGNISKFIGNLNIGDEINVC 165

Query: 180 GPFIDYKF----RNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI----LNP 231
           GP  +Y +    RN L                        AGGTGI    Q +    LNP
Sbjct: 166 GPAGNYHYEPNCRNKLG---------------------MIAGGTGIAPMFQIMKAIYLNP 204

Query: 232 YGQFNYNMTLFHSCKSIQELGCLY-----HLVNGLAQQNKITYHLFETSKGD 278
             +    +TL +   ++QE   L       +V     Q K+ Y L +T + D
Sbjct: 205 --KDTTEVTLLYG--NVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDD 252

>Kwal_47.18159
          Length = 287

 Score = 36.2 bits (82), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 31/109 (28%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           ++R+YTP  L             +D V   +LL  IKSY  G V++ I  L +G  +++R
Sbjct: 92  IMRSYTPTSLD------------SDSVGFFELL--IKSYEQGNVSKMIGELQIGDKIKVR 137

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI 228
           GP   Y +  +++                 S +   AGGTGI    Q I
Sbjct: 138 GPKGFYTYTPNMN-----------------SEIGMIAGGTGIAPMYQII 169

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score = 36.2 bits (82), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 18/89 (20%)

Query: 142 LNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGS 201
           ++  +ES  L   +K+Y +G+V+++   L  G T++ +GP     +  + SKH       
Sbjct: 127 ISSKLESGYLDLVVKAYVDGKVSKYFAGLNSGDTVDFKGPIGTLNYEPNSSKH------- 179

Query: 202 TLINKTQLSNVPFFAGGTGIVTALQPILN 230
                     +   AGG+GI   LQ ILN
Sbjct: 180 ----------LGIVAGGSGITPVLQ-ILN 197

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 85/229 (37%), Gaps = 51/229 (22%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           V+R YTP+               +D  E   + F IK Y  G++   +  L    TL  +
Sbjct: 99  VIRPYTPV---------------SDLSEKGYIEFVIKHYEGGKMTDHLFQLKPKDTLAFQ 143

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI--LNPYGQFNY 237
           GP   ++++ +                     +    GGTGI    Q +  +    +   
Sbjct: 144 GPIPKWQWKPN-----------------SFDTITLLGGGTGITPLYQLVHHITQNKEDKT 186

Query: 238 NMTLFHSCKSIQEL---GCLYHLVNGLAQQNKITYHL-------FETSKGDNIIDF-KQL 286
            + LF+  K+  ++     L  L     +Q  I Y +       F+ +KG    DF  + 
Sbjct: 187 KINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITKDFLAKN 246

Query: 287 IPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD-TSQGPIEGLLGEKGW 334
            PGP            VCGP  ++ +++G K     QG + G L + G+
Sbjct: 247 APGPKEKTQ-----VFVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGY 290

>Scas_692.6
          Length = 314

 Score = 34.7 bits (78), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 17/72 (23%)

Query: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPF 214
           IKSY +G+V+++   L  G T+E +GP         + + H   N S  +          
Sbjct: 142 IKSYADGKVSKYFAGLKPGDTVEFKGP---------IGELHYAPNSSKALG--------I 184

Query: 215 FAGGTGIVTALQ 226
            AGG+GI   LQ
Sbjct: 185 VAGGSGITPVLQ 196

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score = 34.3 bits (77), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 81/208 (38%), Gaps = 50/208 (24%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           ++R+YTP  L   + G    L              +KSY  G +++ +  L +G  +++R
Sbjct: 91  MLRSYTPTSLDSDATGYFELL--------------VKSYEKGNISKMLAELAIGDRIKVR 136

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPIL----NPYGQF 235
           GP   Y +  ++ K                  +   AGGTGI    Q I     NP  + 
Sbjct: 137 GPKGFYHYEPNMYKE-----------------IGMIAGGTGISPMYQIIRAIFSNPRDKT 179

Query: 236 NYNMTLFHSCK-SIQELGCLYHLVNGLAQQNKITYHLFETSKGDN-------IID--FKQ 285
              +   +  K  I     L  +V     Q KI Y L + ++G+        I +   ++
Sbjct: 180 RVCLVYGNQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMRE 239

Query: 286 LIPGPNTSNAGNLDTSIVCGPEGYITTV 313
            +P P++S        ++CGP   +++ 
Sbjct: 240 HLPAPSSSA-----QLLLCGPPPMVSSA 262

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 17/72 (23%)

Query: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPF 214
           +KSY +G+V+++  SL  G  +E +GP   + +  + SK                  +  
Sbjct: 138 VKSYTDGKVSKYFASLKPGQLVEFQGPVGRFNYATNSSK-----------------AIGM 180

Query: 215 FAGGTGIVTALQ 226
            AGG+GI   LQ
Sbjct: 181 IAGGSGITPMLQ 192

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 31/170 (18%)

Query: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPF 214
           +KSY  G +++ I  + +G  + + GP   Y++  ++ KH                 +  
Sbjct: 111 VKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKH-----------------LAM 153

Query: 215 FAGGTGIVTALQ--------PILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNK 266
            AGGTGI    Q        P         Y   L       QEL     LV     Q K
Sbjct: 154 VAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELD---DLVKQRPDQFK 210

Query: 267 ITYHLFETSKGD--NIIDFKQLIPGPNTSNAGNLDTS-IVCGPEGYITTV 313
           ITY L +  + D    + +  L     +  +   D   +VCGP G +++V
Sbjct: 211 ITYLLDKPERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSV 260

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLIN 205
           +KSY +G+V++W   L  G T+E +GP   + +  +  K      G + I 
Sbjct: 138 VKSYVDGKVSKWFAGLQPGQTVEFKGPVGRFSYVTNAYKKIGMVTGGSAIT 188

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 31/107 (28%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           ++R+YTP  L             +D V   +LL  IKSY  G +++    L +G  +++R
Sbjct: 87  ILRSYTPTSLD------------SDAVGHFELL--IKSYEKGNISKHFAQLNIGDKIKVR 132

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQ 226
           GP   Y ++ ++++                  +   AGGTGI    Q
Sbjct: 133 GPKGFYHYQPNMNEE-----------------IGMIAGGTGIAPMYQ 162

>Kwal_33.14260
          Length = 308

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 37/76 (48%), Gaps = 18/76 (23%)

Query: 155 IKSYNNGEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPF 214
           +KSY +G+V+++   L  GS ++ +GP   + +               ++N  +   +  
Sbjct: 136 VKSYADGQVSKYFAGLKAGSAVDFKGPVGRFNY---------------VVNSYK--QIGM 178

Query: 215 FAGGTGIVTALQPILN 230
            AGG+GI   LQ ILN
Sbjct: 179 IAGGSGITPMLQ-ILN 193

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 42/107 (39%), Gaps = 32/107 (29%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           +VR YTP+               N P     L   +K+Y +G V+++   L +   +E +
Sbjct: 120 LVRYYTPV---------------NVPNTEGHLELVVKTYKHGVVSKYFDKLKIRQYVEFK 164

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQ 226
           GP  + ++  D +                 + +   AGG+GI   LQ
Sbjct: 165 GPLGELEYDQDTA-----------------TELGIIAGGSGITPVLQ 194

>Kwal_23.5471
          Length = 312

 Score = 32.0 bits (71), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 89/233 (38%), Gaps = 60/233 (25%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           V+R YTP+   + + G+I               F IK Y  G++   +       T+  +
Sbjct: 114 VIRPYTPVS-DVSTKGHIE--------------FVIKHYKGGKMTEMLFDKKPSDTVAFK 158

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPILNPYGQFNYNM 239
           GP I ++++ +                    ++     G+GI T L  +L+   Q   + 
Sbjct: 159 GPIIKWEWKPN-----------------SFDSITLIGAGSGI-TPLYQLLHHISQNPEDK 200

Query: 240 TLFHSC------------KSIQELGCLYHLVNGLAQQNKITYHLF-ETSKG--DNIIDF- 283
           T  H              K ++E+   Y      A Q KI  H F + ++G  D  I F 
Sbjct: 201 TKIHLLYGNKTPNDILLKKELEEVQAKY------ADQVKI--HFFVDKAEGPFDGEIGFI 252

Query: 284 -KQLIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD-TSQGPIEGLLGEKGW 334
            K+ +   N   A   +   VCGP  ++   +G K     QG + G+L + G+
Sbjct: 253 TKEFLEK-NVPKASEKNQVFVCGPPPFMQAYSGPKVSPKDQGELTGILKDLGF 304

>AFR075C [3267] [Homologous to ScYJL108C (PRM10) - SH; ScYJL107C -
           SH] (561522..563744) [2223 bp, 740 aa]
          Length = 740

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 30/71 (42%), Gaps = 10/71 (14%)

Query: 1   MLKGYQALCGRRTISSVSPIKRSFSKRSIIGYSIILS-----ASAFVTWTYKDLIKQKYV 55
           +L GY  LCG   + S S +  S      I YS+ L       +A   W Y+D   +   
Sbjct: 512 ILPGYIILCGSLELQSRSLVAGSVRMFYAIIYSLFLGFGITLGAALFGWIYRDATNETVC 571

Query: 56  ETFTKTKELSP 66
           E     KELSP
Sbjct: 572 E-----KELSP 577

>Kwal_56.24115
          Length = 1485

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 41  FVTWTYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDID 81
           F T   ++LI +K V  F K KE  P DF     +  H++D
Sbjct: 894 FATPASRELISKKLVVPFEKEKEHIPKDFLHTIASEEHEVD 934

>KLLA0E10791g 951335..953896 weakly similar to sp|P48237
           Saccharomyces cerevisiae YGR150c singleton, hypothetical
           start
          Length = 853

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 12/71 (16%)

Query: 3   KGYQALCGR------RTISSVSPIKRSFSKRSIIGYSIILSASAFVTWTYKDLIKQKYVE 56
           +G   +CG+      R  +++S  K+SF     +  + I +AS  ++W Y D     +++
Sbjct: 246 QGKLEVCGKLRELTERMDATLS--KKSFQPTQYMLNACIFAASKAMSWEYMDF----FLK 299

Query: 57  TFTKTKELSPN 67
            FT T ++ PN
Sbjct: 300 KFTSTYDMQPN 310

>Kwal_34.16309
          Length = 344

 Score = 28.9 bits (63), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 16/69 (23%)

Query: 55  VETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLW---KELERNILWSI 111
           ++ +T + ++SP +          DI++    IE TP + +  N+    +++ERN+   I
Sbjct: 105 IQDYTSSSDMSPGES---------DIES----IEDTPEEHEPANITLHTQDMERNLTEQI 151

Query: 112 EVKQPEIMV 120
           E +QP I+V
Sbjct: 152 EPQQPHIIV 160

>Kwal_33.15089
          Length = 478

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 16/69 (23%)

Query: 55  VETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLW---KELERNILWSI 111
           ++ +T + ++SP +          DI++    IE TP + +  N+    +++ERN+   I
Sbjct: 403 IQDYTSSSDMSPGES---------DIES----IEDTPEEHEPANITLHTQDMERNLTEQI 449

Query: 112 EVKQPEIMV 120
           E +QP I+V
Sbjct: 450 EPQQPHIIV 458

>Kwal_47.17665
          Length = 625

 Score = 28.9 bits (63), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 16/69 (23%)

Query: 55  VETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLW---KELERNILWSI 111
           ++ +T + ++SP +          DI++    IE TP + +  N+    +++ERN+   I
Sbjct: 305 IQDYTSSSDMSPGES---------DIES----IEDTPEEHEPANITLHTQDMERNLTEQI 351

Query: 112 EVKQPEIMV 120
           E +QP I+V
Sbjct: 352 EPQQPHIIV 360

>Kwal_27.12438
          Length = 641

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 16/69 (23%)

Query: 55  VETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLW---KELERNILWSI 111
           ++ +T + ++SP +          DI++    IE TP + +  N+    +++ERN+   I
Sbjct: 564 IQDYTSSSDMSPGE---------SDIES----IEDTPEEHEPANITLHTQDMERNLTEQI 610

Query: 112 EVKQPEIMV 120
           E +QP I+V
Sbjct: 611 EPQQPHIIV 619

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 48/233 (20%), Positives = 87/233 (37%), Gaps = 58/233 (24%)

Query: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179
           VVR YTP+               +D  +       +K Y  G++   +  L    T+  +
Sbjct: 102 VVRPYTPV---------------SDLSQKGHFQLVVKHYEGGKMTSHLFGLKPNDTVSFK 146

Query: 180 GPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGI----VTALQPILNPYGQF 235
           GP + +K++ +                 Q  ++     GTGI      A   + NP  + 
Sbjct: 147 GPIMKWKWQPN-----------------QFKSITLLGAGTGINPLYQLAHHIVENPNDKT 189

Query: 236 NYNMTLFHSCKSIQELGCLYHLVNGLAQQN----KITYHLFETSKGDNII--------DF 283
             N  L +  K+ Q++  L   ++ L ++      +TY + +     +          DF
Sbjct: 190 KVN--LLYGNKTPQDI-LLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFISKDF 246

Query: 284 -KQLIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYD-TSQGPIEGLLGEKGW 334
            ++ +PGP  S         VCGP  ++   +G K     QG + G+L   G+
Sbjct: 247 IQEHVPGPKESTH-----LFVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGY 294

>Kwal_36.16338
          Length = 604

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 16/69 (23%)

Query: 55  VETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLW---KELERNILWSI 111
           ++ +T + ++SP +          DI++    IE TP + +  N+    +++ERN+   I
Sbjct: 403 IQDYTSSSDMSPGES---------DIES----IEDTPEEHEPANITLHTQDMERNLTEQI 449

Query: 112 EVKQPEIMV 120
           E +QP I+V
Sbjct: 450 EPQQPHIIV 458

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,053,076
Number of extensions: 556735
Number of successful extensions: 1517
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1519
Number of HSP's successfully gapped: 42
Length of query: 338
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 236
Effective length of database: 13,065,073
Effective search space: 3083357228
Effective search space used: 3083357228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)