Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I00968g99798251200.0
YOR038C (HIR2)87543413911e-178
Sklu_1979.384743913861e-177
Scas_699.4288544213461e-171
Kwal_55.2156687346013251e-168
ACR088W85044013201e-168
KLLA0E21945g84744911411e-141
Scas_702.168162401652e-11
YBL008W (HIR1)8404161643e-11
AGR168W8252531582e-10
KLLA0A04928g8612391582e-10
CAGL0E02805g8404031563e-10
Kwal_47.17465800851536e-10
KLLA0E11143g493111890.019
Kwal_27.10385536132860.050
Scas_512.3534135810.20
Sklu_2349.6830107770.60
KLLA0C02849g44099750.80
ADR242C52156750.82
YML102W (CAC2)46885750.95
YMR164C (MSS11)75856722.6
KLLA0D01155g33556703.3
Scas_622.1358095703.6
AFL014C55769694.3
Scas_465.4100283695.3
YPR034W (ARP7)47797686.3
KLLA0C16643g30277676.3
Sklu_2140.5112955687.0
Kwal_56.2459629477668.4
AGL172W89862678.7
CAGL0M05291g41978669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I00968g
         (982 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces cer...  1976   0.0  
YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone t...   540   e-178
Sklu_1979.3 YOR038C, Contig c1979 4836-7379                           538   e-177
Scas_699.42                                                           523   e-171
Kwal_55.21566                                                         514   e-168
ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH] complement(...   513   e-168
KLLA0E21945g complement(1948687..1951230) similar to sp|P32480 S...   444   e-141
Scas_702.16                                                            68   2e-11
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    68   3e-11
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    65   2e-10
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    65   2e-10
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    65   3e-10
Kwal_47.17465                                                          64   6e-10
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    39   0.019
Kwal_27.10385                                                          38   0.050
Scas_512.3                                                             36   0.20 
Sklu_2349.6 YNL212W, Contig c2349 9360-11852 reverse complement        34   0.60 
KLLA0C02849g 255963..257285 some similarities with sp|P53851 Sac...    33   0.80 
ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH] (1126443..1...    33   0.82 
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    33   0.95 
YMR164C (MSS11) [4119] chr13 complement(587273..589549) Transcri...    32   2.6  
KLLA0D01155g complement(104847..105854) similar to sgd|S0005533 ...    32   3.3  
Scas_622.13                                                            32   3.6  
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    31   4.3  
Scas_465.4                                                             31   5.3  
YPR034W (ARP7) [5468] chr16 (639520..640953) Component of SWI-SN...    31   6.3  
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    30   6.3  
Sklu_2140.5 YER176W, Contig c2140 6521-9910                            31   7.0  
Kwal_56.24596                                                          30   8.4  
AGL172W [4140] [Homologous to ScYLR138W (NHA1) - SH] complement(...    30   8.7  
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    30   9.2  

>CAGL0I00968g 78375..81368 similar to sp|P32480 Saccharomyces
           cerevisiae YOR038c HIR2 histone transcription regulator,
           hypothetical start
          Length = 997

 Score = 1976 bits (5120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 971/982 (98%), Positives = 971/982 (98%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY
Sbjct: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60

Query: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVSQS 120
           SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVSQS
Sbjct: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVSQS 120

Query: 121 IITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSGAGT 180
           IITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSGAGT
Sbjct: 121 IITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSGAGT 180

Query: 181 FTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKGSSG 240
           FTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKGSSG
Sbjct: 181 FTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKGSSG 240

Query: 241 AAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVATST 300
           AAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVATST
Sbjct: 241 AAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVATST 300

Query: 301 NTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLG 360
           NTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLG
Sbjct: 301 NTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLG 360

Query: 361 KTVPMEEIENIRQSNIIKEPLPIAYVITASDGLGDISTSKNQGLGVAADNSSNILSTDTN 420
           KTVPMEEIENIRQSNIIKEPLPIAYVITASDGLGDISTSKNQGLGVAADNSSNILSTDTN
Sbjct: 361 KTVPMEEIENIRQSNIIKEPLPIAYVITASDGLGDISTSKNQGLGVAADNSSNILSTDTN 420

Query: 421 TNEKNLSTVNTTEPQTNSQSSSYNNKPESKLDSSKSEITSADSSDEKAKNLEARPIEAKS 480
           TNEKNLSTVNTTEPQTNSQSSSYNNKPESKLDSSKSEITSADSSDEKAKNLEARPIEAKS
Sbjct: 421 TNEKNLSTVNTTEPQTNSQSSSYNNKPESKLDSSKSEITSADSSDEKAKNLEARPIEAKS 480

Query: 481 KKILNGKNLESKSSSVTTSDNIQKKVEDSKSNVSVTATEXXXXXXXXXXXSENGESKVNK 540
           KKILNGKNLESKSSSVTTSDNIQKKVEDSKSNVSVTATE           SENGESKVNK
Sbjct: 481 KKILNGKNLESKSSSVTTSDNIQKKVEDSKSNVSVTATEKKTKPDKKSIKSENGESKVNK 540

Query: 541 AQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKPKEDALGNAVTKRAKKDLEPVDFL 600
           AQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKPKEDALGNAVTKRAKKDLEPVDFL
Sbjct: 541 AQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKPKEDALGNAVTKRAKKDLEPVDFL 600

Query: 601 DTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVT 660
           DTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVT
Sbjct: 601 DTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVT 660

Query: 661 PERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACG 720
           PERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACG
Sbjct: 661 PERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACG 720

Query: 721 KYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGF 780
           KYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGF
Sbjct: 721 KYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGF 780

Query: 781 PIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEI 840
           PIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEI
Sbjct: 781 PIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEI 840

Query: 841 SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLR 900
           SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLR
Sbjct: 841 SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLR 900

Query: 901 LEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTA 960
           LEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTA
Sbjct: 901 LEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTA 960

Query: 961 CADLRSVQRVTIDYADMLGYLP 982
           CADLRSVQRVTIDYADMLGYLP
Sbjct: 961 CADLRSVQRVTIDYADMLGYLP 982

>YOR038C (HIR2) [4850] chr15 complement(402760..405387) Histone
           transcription regulator, required for periodic
           repression of three of the four histone gene loci and
           for autogenous repression of HTA1-HTB1 locus by H2A and
           H2B [2628 bp, 875 aa]
          Length = 875

 Score =  540 bits (1391), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 253/434 (58%), Positives = 325/434 (74%), Gaps = 14/434 (3%)

Query: 556 KSTTPDFKNPSYQVPKDLKRKPKEDALGNAV--TKRAKKDLEPVDFLDTGLLLPNVAFSR 613
           +ST+ +F  PSY VP+DLKRKPKE    N    +K+ KK+L+P+DFLDTGLLLPN +FSR
Sbjct: 435 QSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDFLDTGLLLPNTSFSR 494

Query: 614 VRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKF 673
           +RL+TP IR     +  N+  ++L+++NGSGNEQ+PTIVKL  K +  ++ LFQDFIPK 
Sbjct: 495 IRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVLDQDQVLFQDFIPKL 554

Query: 674 VSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELY 733
           +++ T+GD FW+  SEDG++YI++D GRK++ PL +GV ISFLEACG YLLC++SIGELY
Sbjct: 555 ITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEACGTYLLCLTSIGELY 614

Query: 734 CWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMY 793
           CWNI   KL FP  TI+PLL+PS+RYSDDILTRAENIT+CS+T  G P+ TLSNGDGY++
Sbjct: 615 CWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKGVPLVTLSNGDGYLF 674

Query: 794 DKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEISK---------AS 844
           DKNMETWLLVSDGWWAYGSQYWD+TN + L    +   +   S + I++          S
Sbjct: 675 DKNMETWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESNINEIVSDIKNDNQS 734

Query: 845 IVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQ 904
           I+  LE KTN+EL RKGRIKNL+RFARTILMKEGFEN+EEIVTLSHLENK+L+++RLEE 
Sbjct: 735 IINFLECKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSHLENKILISIRLEEP 794

Query: 905 HEFKKLIKLYAVKLGELGYVDRLRDLFAWIISD---SNDNGDLIPGINRKELVKTLLTAC 961
            EF KL+ +Y ++L ELGY+DRL D+F W+  D   S           ++ L+K +L AC
Sbjct: 795 EEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADKDFKRNLLKKILIAC 854

Query: 962 ADLRSVQRVTIDYA 975
            D+R VQRVT  YA
Sbjct: 855 GDIRQVQRVTTRYA 868

 Score =  383 bits (984), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 272/388 (70%), Gaps = 13/388 (3%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           MRLLKYPL+  +  V +L  +   Y+++ GS G +  W QQQL+DTAFDR  ++ LKP+ 
Sbjct: 1   MRLLKYPLDIHNEQVNALAAL-GPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEV 59

Query: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLE---NKLIYTTV 117
           SF  + +D   ++ F  GD + LY+G+EH ++ YSGWL    +   ++E   +KL++   
Sbjct: 60  SFQVD-QDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECK 118

Query: 118 SQSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSG 177
           S S ITDVK+D  L ILFVL     KI LF  ++ +K  ++ I +DK SKP+TG++DP+G
Sbjct: 119 SPSTITDVKYDINLGILFVLLSNENKILLFRHKTFDK--LSEITIDKASKPITGIIDPTG 176

Query: 178 AGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKG 237
             TFTV+TSDRSI+VY IN+TG +K + KL+QHV +YPLHY+I+M PQAD LP+INS+KG
Sbjct: 177 Q-TFTVMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKG 235

Query: 238 SSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVA 297
               A S  T LL+RN NYKV  TLV  +S+  +VLV+SP  YEK NLK+GT +RYNL+A
Sbjct: 236 VPNNATS-CTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIA 294

Query: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357
           TS +TDG+I++WNTKR KPLF  L +S +AINDM WS +G TLFA+SND  LYTFAF + 
Sbjct: 295 TSGSTDGTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEK 354

Query: 358 DLGKTVPMEEIENIRQSN----IIKEPL 381
           DLG  +P  EI+++++ N     ++EPL
Sbjct: 355 DLGVALPQTEIKSLQEVNKKLPKLEEPL 382

>Sklu_1979.3 YOR038C, Contig c1979 4836-7379
          Length = 847

 Score =  538 bits (1386), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/439 (54%), Positives = 342/439 (77%), Gaps = 15/439 (3%)

Query: 556 KSTTPDFKNPSYQVPKDLKRKPK-EDALGNAVTKRAKKDLEPVDFLDTGLLLPNVAFSRV 614
           +ST+ +F  PSY VPKDLKRKPK E+ + N   K+ KKD++P+DFLDT +L+PN++FS++
Sbjct: 407 QSTSMEFNPPSYSVPKDLKRKPKDEETMVNG--KKQKKDVDPMDFLDTNILMPNISFSKL 464

Query: 615 RLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFV 674
           RL+TP IR++   +  ++  ++ +++NG+GNEQKPT + LL K    +R +FQDFIPKFV
Sbjct: 465 RLATPKIRVSFQYSPVHNKNLIFDVKNGTGNEQKPTSISLLLKEPEQDRMIFQDFIPKFV 524

Query: 675 SLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYC 734
           +L+++G+ FWAC +EDGTLY+++D G++++PP+ +GVP SFLEACGKYLLCV+S+G+LYC
Sbjct: 525 TLSSAGESFWACCTEDGTLYVYSDTGKRLLPPMIMGVPCSFLEACGKYLLCVTSMGQLYC 584

Query: 735 WNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYD 794
           W+I   +L+FPV T++PLL+P +RYSDDILTRAENITMC++T NG P+ TLSNGDGYM+D
Sbjct: 585 WDIDCKRLKFPVNTVYPLLNPVLRYSDDILTRAENITMCTITKNGVPLLTLSNGDGYMFD 644

Query: 795 KNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQ------------SSTEISK 842
            +METWLL+SD WWAYGSQYWD TN + ++  + +   + +            S+   +K
Sbjct: 645 CDMETWLLISDSWWAYGSQYWDMTNTNGVVVTTGSDKDDKKNRYWNPEAENLVSNVRSNK 704

Query: 843 ASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLE 902
           +SIV  LE KTN+EL+RKGRI+NL++FA+TILMKEGFEN+E+IVTLSHLEN++LV+L+L 
Sbjct: 705 SSIVNYLESKTNDELSRKGRIRNLQKFAKTILMKEGFENLEDIVTLSHLENRVLVSLKLG 764

Query: 903 EQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTACA 962
           E  EF +L+ +Y ++LGE+GY +RL D+  W+ ++ N   + I G  R+EL+K +L ACA
Sbjct: 765 EDQEFTRLLIVYCIRLGEMGYKNRLNDVLQWLYNNGNYKMEKIAGTTREELLKQILVACA 824

Query: 963 DLRSVQRVTIDYADMLGYL 981
           D+R VQRVT+ YA +LG +
Sbjct: 825 DIRQVQRVTVSYATVLGLI 843

 Score =  253 bits (646), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/385 (39%), Positives = 226/385 (58%), Gaps = 24/385 (6%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           M+LLKYP +   GN+ +   I    V V   R  + VW  +QLLDTA  + +   L   +
Sbjct: 1   MKLLKYPKQLHDGNLGACAAIHDRLVTVGSER--VSVWDTKQLLDTAMGKSSANELSELF 58

Query: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVSQS 120
           S      +++   VFA   +  L++GT+H+++    WL+  E     +    IY     S
Sbjct: 59  SSKGNFNNEKLCYVFATDKK--LFVGTDHALFYADSWLETREK----MVFHSIYRVEPPS 112

Query: 121 IITDVKWDSLLDILFVLTDRPCKIH---LFDTRSANKKEITSIALDKNSKPLTGVVDPSG 177
            ITD+K+D L +ILF+L     K +   L++ R+  +  +  I L   +KP+TG++DP G
Sbjct: 113 TITDIKYDPLNNILFILVSLTSKKNVAILYEGRTCTR--LAEILLP--TKPMTGIIDPMG 168

Query: 178 AGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKG 237
              FT++ + RSI +Y  N  G YK V +L Q+V + P+HY +TM P AD +PIINSL+ 
Sbjct: 169 Q-IFTIVGAARSISIYQYNSKGSYKLVHQLPQYVQIDPVHYTVTMSPPADTIPIINSLRN 227

Query: 238 SSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVA 297
           S+      + VLL+RN  +KV +TLV    S  K+L  SP +YEK N K GT +RYNL+A
Sbjct: 228 ST-----PSVVLLDRNNEFKVSTTLV-GYDSKCKILKFSPNLYEKTN-KTGT-TRYNLLA 279

Query: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357
           +S N +GS+ +WNTKR +PLF    I+ + IND++W+ +G+ LFAVS+D  +Y FAF + 
Sbjct: 280 SSGNENGSVAVWNTKRARPLFNAAGIAKTFINDLVWNDDGMGLFAVSDDGYMYVFAFQEK 339

Query: 358 DLGKTVPMEEIENIRQSNIIKEPLP 382
           +LG+ +P EE   ++ S    EPLP
Sbjct: 340 ELGQVLPQEETVKLQASIKKLEPLP 364

>Scas_699.42
          Length = 885

 Score =  523 bits (1346), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 250/442 (56%), Positives = 331/442 (74%), Gaps = 20/442 (4%)

Query: 556 KSTTPDFKNPSYQVPKDLKRK---------PKEDALGNAVTKRAKKDLEPVDFLDTGLLL 606
           +ST  +F  PSY VPKDLKRK         P       + TK+ K+DLEP+ FLDTGLLL
Sbjct: 443 QSTNMEFNPPSYNVPKDLKRKKPKVKESSTPLNGEQNPSPTKKLKRDLEPISFLDTGLLL 502

Query: 607 PNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTV------T 660
           PNV+FSR+RL+TP IR+    T  +D  + + I+NGSG+EQ P+IV L  K +      T
Sbjct: 503 PNVSFSRMRLATPKIRLQFTYTPFSDPNLYMTIKNGSGSEQTPSIVSLYQKPLQIRQKDT 562

Query: 661 PERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACG 720
             + +FQDFIPK+V    +G+ FW C + DGTLY + D GR+++PP+T+GVPI+FL+AC 
Sbjct: 563 QPKLIFQDFIPKYVCQCIAGESFWCCCTSDGTLYTYTDSGRRLLPPMTLGVPITFLQACK 622

Query: 721 KYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGF 780
           +YLLCV+S+GELYCW+++  KL FP+TT++PLL PSIRYSDD+LTR ENITMC+VT+ G 
Sbjct: 623 QYLLCVTSLGELYCWDLSMKKLLFPMTTVYPLLKPSIRYSDDVLTRVENITMCTVTSKGV 682

Query: 781 PIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEI 840
           P+ATLSNGDGY++DK+ME+WLLVSDGWWAYGSQYWDS NN +   DS+T   E   + E 
Sbjct: 683 PLATLSNGDGYIFDKDMESWLLVSDGWWAYGSQYWDSLNN-DYKNDSNT--LEELKNAE- 738

Query: 841 SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLR 900
           +K S++ ++E+KTN EL RKGRIK+L+RFA+T+LMKEGFEN+EEIVTLSHLEN++LV+L+
Sbjct: 739 NKKSLINMMERKTNEELDRKGRIKHLQRFAKTLLMKEGFENMEEIVTLSHLENRILVSLK 798

Query: 901 LEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSN-DNGDLIPGINRKELVKTLLT 959
           LEE +EFK LI  Y+ +LGELGY++RL D+  WI +D      DL+ G +R+ ++K +L 
Sbjct: 799 LEEFNEFKDLIIAYSSRLGELGYIERLNDMLQWIYNDGKMGKSDLLLGQSRELILKDILI 858

Query: 960 ACADLRSVQRVTIDYADMLGYL 981
           ACAD+R VQRVT  YA  +G L
Sbjct: 859 ACADMRHVQRVTKAYASAIGML 880

 Score =  299 bits (765), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 170/387 (43%), Positives = 242/387 (62%), Gaps = 12/387 (3%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           MRLLKYPL+    +V +LV I +  ++V  + G + VW QQ L++TAF++  +  L+  +
Sbjct: 1   MRLLKYPLDLKDQSVKALVAIGSHLIIV-SNVGHVHVWSQQSLVNTAFNKIPIRDLRESH 59

Query: 61  SFTFE-LKDDEDELVFAM-GDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVS 118
           SF  +      D  VFA+ G  D L L TE+ +     WL  +   +   E        S
Sbjct: 60  SFQIDSFNPKLDRNVFAVEGTNDLLILATENRILISRNWL--IRDKNKKFECVFQCHMGS 117

Query: 119 QSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDK--NSKPLTGVVDPS 176
            ++ITD+K D L  I+ V    P +I LF+  +     +         N +P+T ++DP 
Sbjct: 118 DNVITDMKIDQLNKIVLVSMVSPDQILLFNLETLKLINVIDQEFKPSLNRRPITLIIDPC 177

Query: 177 GAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLK 236
           G   FTVL SDRS++VY IN +G++K +    Q+V V+PLHYKITMPPQ D LP+INS+K
Sbjct: 178 GT-RFTVLCSDRSMLVYQINESGNFKLLNTFPQYVQVHPLHYKITMPPQGDTLPLINSIK 236

Query: 237 GSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLV 296
           GS+ +   T TVLL+ N+NYK+ ST+V  +SSNTKVL +SP +YEK N K+GT   YNL+
Sbjct: 237 GST-SKDITTTVLLDANDNYKIKSTIVSPSSSNTKVLKYSPTIYEKTNQKKGTKVSYNLL 295

Query: 297 ATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQ 356
           ATS   DG+I++WNTKR KPLF  ++ S   IND++WS +GLTLFA+S+D+VLYTFAF  
Sbjct: 296 ATSGTEDGTILMWNTKRMKPLFNAMSTSSMPINDIVWSQDGLTLFAISDDSVLYTFAFQD 355

Query: 357 DDLGKTVPMEEIENIRQSNIIKEPLPI 383
           +DLG  + +E++  +R  N   + LPI
Sbjct: 356 NDLGDQLSIEQVTLLRDQN---KKLPI 379

>Kwal_55.21566
          Length = 873

 Score =  514 bits (1325), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/460 (51%), Positives = 334/460 (72%), Gaps = 21/460 (4%)

Query: 536 SKVNKAQNTISPKESNTTDNKSTTPDFKNPSYQVPKDLKRKPKEDALGNAVTKRAKKDLE 595
           +KVN  +N ++P     T  +S + +F  PSY VPKDLKR+PK D L     K+ K DLE
Sbjct: 417 TKVN-GKNKVAP-----TTIRSLSMEFIAPSYSVPKDLKRRPK-DPLQATTNKKQKHDLE 469

Query: 596 PVDFLDTGLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLL 655
           P+DFLDT LL+P V+FS+VRL+ P +R++     S    + ++++NGSGNEQ PT++ L 
Sbjct: 470 PMDFLDTSLLMPTVSFSKVRLAAPKVRLSFTYYPSTSDSLAISVKNGSGNEQTPTVITLK 529

Query: 656 DKTVTPERTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISF 715
            K    E+T+F+DF+PK +++ TSGD+FW+C S+DGT+Y+++D GRK++PP+ +GVP SF
Sbjct: 530 LKESGQEKTIFEDFLPKLITICTSGDNFWSCCSDDGTVYVYSDSGRKLLPPMIMGVPCSF 589

Query: 716 LEACGKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSV 775
           LEACG +LLCV+SIG++YCWN+ +S+L FP T+++PLLSP++R+SDD+LTRAENITMC++
Sbjct: 590 LEACGNFLLCVTSIGQVYCWNVDASRLLFPPTSLYPLLSPNLRFSDDVLTRAENITMCTL 649

Query: 776 TNNGFPIATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYWD-----------STNNSNLI 824
           T +G PI TLSNGDGYMYDK ME W+L++D WWAYGSQYWD           S  N    
Sbjct: 650 TASGVPIVTLSNGDGYMYDKVMEVWMLINDSWWAYGSQYWDTTKTTTNGTYASEPNDKHD 709

Query: 825 PDSSTKPTEGQSSTEI---SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFEN 881
             +    +E +  TE    +K+SI+  LE +TN+EL RKGR++NL++FA+TILMKEG+EN
Sbjct: 710 KKNQNWNSEAKGLTESLKENKSSILNYLESRTNDELNRKGRVRNLQKFAKTILMKEGYEN 769

Query: 882 IEEIVTLSHLENKLLVTLRLEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDN 941
           +EE+VTLSHLENKLLV+LRL E  EF KL+ +Y ++L E+GY +RL D+  W+  D N  
Sbjct: 770 LEEVVTLSHLENKLLVSLRLHEYEEFTKLLTIYCIRLSEMGYKNRLDDVLQWLYDDGNYK 829

Query: 942 GDLIPGINRKELVKTLLTACADLRSVQRVTIDYADMLGYL 981
              + G+  +EL++ +L ACAD+R VQRVT  YA  +G +
Sbjct: 830 AKSVAGVKAEELLRKILVACADIRHVQRVTTSYATAIGLI 869

 Score =  214 bits (545), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/388 (36%), Positives = 213/388 (54%), Gaps = 26/388 (6%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           M+LLKYP    SG +     I     +V   +  + VW   QL+  A    + + ++ K 
Sbjct: 25  MKLLKYPRALHSGKIVGCACIGDN--LVTAGQDSVCVWSCSQLVGAAMGNISAKEVREK- 81

Query: 61  SFTFELKDDE---DELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTV 117
              FE+K  E   + L   +G   CLY+GT+ +V  Y+  L  LE G  T   + +Y   
Sbjct: 82  ---FEIKVLEARLEPLRLVVGSDACLYVGTDRTVL-YADSL--LEKGEKT-SFQTLYHVE 134

Query: 118 SQSIITDVKWDSLLDILFVLTDRPCK---IHLFDTRSANKKEITSIALDKNSKPLTGVVD 174
           + + +TDVK+D     +FVL ++  +   + L D  +    ++  I+L   SKP+TGVVD
Sbjct: 135 APACVTDVKFDFQTGTIFVLVNQGNEGNYVALLDA-AGGGAQVGQISLGA-SKPITGVVD 192

Query: 175 PSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINS 234
           P+G   FTV+ +DR++ V+     G +K + +L+ ++ V PL Y I+M PQAD LP++NS
Sbjct: 193 PAGQ-IFTVICADRNVSVFQYGAGGSHKLLHRLNHYLQVDPLRYSISMSPQADTLPLLNS 251

Query: 235 LKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYN 294
           + GS+      A +LL+R   +K+ +TLV       ++   SP +YEK   K GT   YN
Sbjct: 252 MSGST-----PAILLLDRKSGFKLRATLV-GHFDKCQICQFSPSLYEKVQ-KSGTKVTYN 304

Query: 295 LVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAF 354
           L ATS    GS++IWNTKR KPL       DS + D+ WS +G TLFAV+N+ +L+ FAF
Sbjct: 305 LAATSGFDTGSVVIWNTKRLKPLLNTKCTEDSFVTDLQWSDDGSTLFAVTNNGLLFIFAF 364

Query: 355 LQDDLGKTVPMEEIENIRQSNIIKEPLP 382
             ++LGKT+P   ++ +R       PLP
Sbjct: 365 RDEELGKTLPKSHVDKLRSDCATLSPLP 392

>ACR088W [1135] [Homologous to ScYOR038C (HIR2) - SH]
           complement(515561..518113) [2553 bp, 850 aa]
          Length = 850

 Score =  513 bits (1320), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 236/440 (53%), Positives = 319/440 (72%), Gaps = 15/440 (3%)

Query: 557 STTPDFKNPSYQVPKDLKRKPKEDALGNAV-TKRAKKDLEPVDFLDTGLLLPNVAFSRVR 615
           ST+ +F  PSY VPKDLKR+PK++       TKR K+D+EP+DFLDT LL+PN++FS+ R
Sbjct: 407 STSMEFNEPSYTVPKDLKRRPKQETQRTGPPTKRPKRDVEPMDFLDTNLLIPNISFSKAR 466

Query: 616 LSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVS 675
           L+TP +RMN    ++    +++ ++NG+G+EQKPT + L  K    +  LFQDF P+FV+
Sbjct: 467 LATPKVRMNFQYCNTLQQNLVMEVKNGTGSEQKPTSITLTLKDKEKDMVLFQDFTPRFVT 526

Query: 676 LATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCW 735
           + T G  FWAC +E+G +Y++++ G+K++PP+ +GVP+SFLE CG YLLCV+S+G+L+CW
Sbjct: 527 ICTCGHSFWACCTEEGIVYVYSNTGKKLLPPMIMGVPVSFLEGCGDYLLCVTSMGQLFCW 586

Query: 736 NIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDK 795
           N+   KL+FPV TI+PLL+PSIRYSDD+LTRAENITMC+ T NG P+ TLSNGDGYM+D 
Sbjct: 587 NVKEGKLKFPVNTIYPLLNPSIRYSDDVLTRAENITMCTTTENGIPLVTLSNGDGYMFDP 646

Query: 796 NMETWLLVSDGWWAYGSQYWDSTNNS---------NLIPDSSTKPTEGQSSTEI-----S 841
           +ME WLL++D WWAYGSQYWD TN S         N   D   K     +   I     +
Sbjct: 647 DMEIWLLINDSWWAYGSQYWDFTNTSHAGSSAAAGNDKEDKKNKYWNADAEYLIEEVKKN 706

Query: 842 KASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRL 901
           K S+V  LE KTN+E+TRKG I+NL+RFA+TILMKEGFEN+E+IVTLSHLEN+LLV L+L
Sbjct: 707 KKSVVNYLESKTNDEMTRKGLIRNLQRFAKTILMKEGFENLEDIVTLSHLENRLLVALKL 766

Query: 902 EEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTAC 961
            E +EF KL+K+Y + L E+G+ +RL D+ +W+ +D       I    R+EL+K +L AC
Sbjct: 767 NETNEFTKLLKVYCISLAEMGFKNRLDDVLSWLYNDGEYKVGTIANEKREELLKQILVAC 826

Query: 962 ADLRSVQRVTIDYADMLGYL 981
           AD+R VQRVT  YA  LG L
Sbjct: 827 ADIRQVQRVTTSYASALGLL 846

 Score =  191 bits (486), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 202/387 (52%), Gaps = 30/387 (7%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           M+LLKYP +   G +  L       ++V   R  I  +   +L   A     +  +  + 
Sbjct: 1   MKLLKYPRQLHDGQL--LAGCVVGGLLVVVGRDRISAYDCGKLQAAARGELAVREVSAEV 58

Query: 61  SFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSG-WLKALESGHTTLENKLIYTTVSQ 119
               E+   ED L +  G    L +  +  +++    W  A   G  T      + TV+Q
Sbjct: 59  ELQVEV--GEDALRYVAGGEGELVVAGDRQIWAAGADWRSA---GRGTR-----FLTVAQ 108

Query: 120 ----SIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDP 175
               + +TDVK D    ++FV      ++ L+ T +  +  + ++A    +KP+T VVDP
Sbjct: 109 LAGGACVTDVKADGA-GLVFVSVSGKDEVWLYATGAWERVGVVTLA----AKPVTLVVDP 163

Query: 176 SGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSL 235
            G    TV+  +RS+ VY  NR G  +  ++L Q+V   PL Y ITM PQ D LP++NS+
Sbjct: 164 LGE-LLTVVLQNRSVAVYQYNRQGAVRMHQQLPQYVQTNPLRYSITMSPQGDLLPLVNSI 222

Query: 236 KGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNL 295
           K      G  +  LL+R   + V STLV       K+L  SP++YEK N K    ++YNL
Sbjct: 223 KN-----GLPSAQLLDRTAGFSVQSTLV-GYVDKCKILRFSPRLYEKPN-KDKPPTQYNL 275

Query: 296 VATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFL 355
           +A+S N DGS+++WNTKR KPL     ++D+ IND+ WS +G  LFA+SND  L+ FAF 
Sbjct: 276 LASSGNEDGSVIVWNTKRTKPLLNAAKVTDTFINDVQWSRDGTGLFAISNDGYLFIFAFH 335

Query: 356 QDDLGKTVPMEEIENIRQSNIIKEPLP 382
           + +LG+ +   E+E +RQS    EPLP
Sbjct: 336 EVELGRLLDDAELEKLRQSVPRLEPLP 362

>KLLA0E21945g complement(1948687..1951230) similar to sp|P32480
           Saccharomyces cerevisiae YOR038c HIR2 histone
           transcription regulator, start by similarity
          Length = 847

 Score =  444 bits (1141), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/449 (47%), Positives = 307/449 (68%), Gaps = 16/449 (3%)

Query: 547 PKESNTTDNKSTTPDFKNPSYQVPKDLKRKP-KEDAL---GNAVTKRAKKDLEPVDFLDT 602
           PK +  T   ST  +F  PSY VPKDLKRKP  ED L        K+AKK+L+ +DFLDT
Sbjct: 397 PKAAEITTISSTNMEFIQPSYMVPKDLKRKPVTEDPLLAQNKPANKKAKKELDQIDFLDT 456

Query: 603 GLLLPNVAFSRVRLSTPLIRMNIDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPE 662
            L LP+V+FS+VRL+ P IR +   +S  +   +L+I+NG GN+QKPT + L  K     
Sbjct: 457 NLFLPSVSFSKVRLAHPKIRASFQYSSQGN--FVLDIKNGLGNDQKPTSITLTRKDNESS 514

Query: 663 RTLFQDFIPKFVSLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKY 722
           + LFQ F+PKFV+L ++G  FWA S++ G +Y+ +  G+ + PP+ +GVP+SFLE  G Y
Sbjct: 515 KQLFQTFLPKFVTLCSAGSSFWAWSTDTGMIYVTSISGQMLFPPMLLGVPVSFLEGSGDY 574

Query: 723 LLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPI 782
           LLC++SIG++YCWN+ + K+ FP+  ++ LL+P +RYSDD+L+RAENITMC+VT+ G PI
Sbjct: 575 LLCITSIGQMYCWNVNTGKIAFPINDVYSLLNPMLRYSDDVLSRAENITMCAVTSQGIPI 634

Query: 783 ATLSNGDGYMYDKNMETWLLVSDGWWAYGSQYW--------DSTNNSNLIPDSSTKPTEG 834
            TLSNGDGYM+D  ME W+L++D WW YGSQYW        D T+N +   D        
Sbjct: 635 VTLSNGDGYMFDSAMEAWMLINDSWWPYGSQYWNFMSSAGVDLTSNDDEKKDKYWNAEAD 694

Query: 835 QSSTEI--SKASIVTLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLE 892
             + E+  +K SI+  LE KTN+ELTRKGR+K+L+RFA+ +LMKEGFEN+EE++TL+HLE
Sbjct: 695 ILAKEVKNNKNSIINYLETKTNDELTRKGRMKHLQRFAKVLLMKEGFENLEEMITLAHLE 754

Query: 893 NKLLVTLRLEEQHEFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKE 952
           NK+LV+ RL+E  E  +L+K+Y +++ E+GY DR     +W+   +N     +    R+ 
Sbjct: 755 NKILVSFRLKEVEEAIRLLKIYCIRIAEMGYTDRFSQTLSWLYDPTNTKFSPLDIDRRRN 814

Query: 953 LVKTLLTACADLRSVQRVTIDYADMLGYL 981
           L+K ++ +CA++R VQRVT  YA+ LG +
Sbjct: 815 LIKDIIISCANIRQVQRVTTSYANELGVI 843

 Score =  169 bits (428), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 203/386 (52%), Gaps = 20/386 (5%)

Query: 1   MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCTLETLKPKY 60
           M+LLK P +   G +T     D +  ++ G    + +W  Q LL+ A  +  ++ +K   
Sbjct: 1   MKLLKLPSKLHDGQLTQCEVDDNKLYIIGGKY--LSIWDSQTLLNAATGKTDVKEVKELE 58

Query: 61  SFTFEL--KDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVS 118
             + +L   + ED     + D   L  G++H +      L   +  ++  +++ I     
Sbjct: 59  KMSLDLLESNQEDGRWLVVLDNQRLVYGSDHLL----ACLDLNKDSNSEYKSREIGIFKD 114

Query: 119 QSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSGA 178
              ITD+K+D +  +LFV   +   + + D+++   K  +SI L   SKP++ + DP G 
Sbjct: 115 NEAITDLKYDKVNGLLFVSLSKANSLQIMDSKTWELK--SSIEL--KSKPISIITDPLGQ 170

Query: 179 GTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHYKITMPPQADFLPIINSLKGS 238
              TV+  +RS+ +Y  +  G  K  + ++Q V   PL Y++TM PQ D +P+INSL  +
Sbjct: 171 -LLTVILQNRSVQIYQYDSHGTTKLHQSINQFVQTNPLPYRMTMSPQGDVIPMINSLHNN 229

Query: 239 SGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISR-YNLVA 297
              A     VLL+R + +K+  +LV    ++ K+L  SP++Y K        ++ +NL+A
Sbjct: 230 VPTA-----VLLDRIQKFKIKLSLV-GYVADCKILKFSPRIYSKTKSPTSNDTQTFNLLA 283

Query: 298 TSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQD 357
           +S N DG++++WNT R KPLF    + +S I D+ W ++GL LFA+S D  L  FAF ++
Sbjct: 284 SSGNEDGNVVVWNTNRIKPLFDASKVVNSYITDLEWDNSGLGLFAISQDGQLVIFAFQEN 343

Query: 358 DLGKTVPMEEIENIRQSNIIKEPLPI 383
           +LG  +P+E +    +   + +PLP 
Sbjct: 344 ELGDVMPVEAVTEAAKEIKLLDPLPF 369

>Scas_702.16
          Length = 816

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 108/240 (45%), Gaps = 33/240 (13%)

Query: 162 LDKNSKPLTGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPL----- 216
            D +   + GV+       F   + DR++ ++  ++ GD        +HV+  P      
Sbjct: 175 FDVHQSHVKGVIFDPANKYFATASDDRTMKIFRYHKIGD---ASFTIEHVVTEPFKGSPL 231

Query: 217 ---HYKITMPPQADFLPIINSLKGSSGAAGSTATVLLNR---NENYKVMSTLVPSASSNT 270
                +++  P    +   N+   ++G   S A  ++NR   + N  ++    P     T
Sbjct: 232 TTYFRRLSWSPDGQHIAAPNA---TNGPVSSVA--IINRGTWDSNISLIGHDAP-----T 281

Query: 271 KVLVHSPKMYE--------KANLKRGTISRYNLVATSTNTDGSIMIWNTKRGKPLFAPLN 322
           +V+  +P+++E        K     G       +  +   D ++++W+T R +P+F   +
Sbjct: 282 EVVRFNPRLFEVNDGMTPAKRKQDSGPNDSMESIIATAGQDKTVVVWSTTRARPIFIAFD 341

Query: 323 ISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEE-IENIRQSNIIKEPL 381
           I++ +I DM W+ +G  LF  S D+ +    F  ++LGK +P+E+ IE + +  + K+ L
Sbjct: 342 IANKSITDMQWTPDGTMLFLTSLDSSITILVFEDNELGKIIPLEKNIEQLHRYGVDKDSL 401

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 2/87 (2%)

Query: 669 FIPKFV--SLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCV 726
           F+P+ V  ++ +S    W  S+ +G+LYI    G+   P +++G  I  +    +YL+ +
Sbjct: 675 FLPEVVITAVGSSHCQCWCLSTAEGSLYIIGYNGQYRSPRISVGHKIIKMINRERYLIAL 734

Query: 727 SSIGELYCWNIASSKLEFPVTTIFPLL 753
           +  G  Y W+I   KL      I P+L
Sbjct: 735 TERGLFYIWDIEDLKLVSKNIPILPIL 761

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/416 (21%), Positives = 166/416 (39%), Gaps = 80/416 (19%)

Query: 19  VTIDAEYVVVCGSRGDIQVWHQQQLLDTAFDRCT-LETLKPKYSFTFELK---------- 67
           V+ D + +   G  G I++W    +L     RC  LE+L P+     +L+          
Sbjct: 25  VSHDGKRLATGGLDGKIRIWSIDSIL-----RCMELESLTPEIPLPQDLQMPLCSMSRHT 79

Query: 68  ---------DDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESGHTTLENKLIYTTVS 118
                     D   L     DR  L    +    S   +    E  H T+  +L+     
Sbjct: 80  GSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLV---AH 136

Query: 119 QSIITDVKWDSLLDILF-VLTDRPCKIHLFDTRSANKKEITSIALDKNSKPLTGVVDPSG 177
            + I D+ W     IL  V  DR   +    T    K+       D +   + GVV    
Sbjct: 137 DNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKR------FDVHQSLVKGVVFDPA 190

Query: 178 AGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLH--------YKITMPPQADFL 229
              F   + DR++ ++  ++TGD   +    +H++  P           + +  P    +
Sbjct: 191 NKYFATTSDDRTMKIFRYHKTGD---ISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHI 247

Query: 230 PIINSLKGSSGAAGSTATVLLNR---NENYKVMSTLVPSASSNTKVLVHSPKMYEK-ANL 285
            + N+   ++G   S A V  NR   + N  ++    P     T+V   +P+++E+ A +
Sbjct: 248 AVPNA---TNGPVSSMAIV--NRGTWDTNVSLIGHDAP-----TEVARFNPRLFERNAGV 297

Query: 286 KR---------------GTISRYNL----VATSTNTDGSIMIWNTKRGKPLFAPLNISDS 326
           K+                 +  ++     V  +   D S+ +W+T R +P+    +I++ 
Sbjct: 298 KQKKDDDPENALVGQNDDKVHHFDKNIDSVVATAGQDKSLAVWSTSRPRPILVAFDIANK 357

Query: 327 AINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEE-IENIRQSNIIKEPL 381
           +I DM W+ +G  LF  S D+ +  F F  ++LGK +P+E+ +E + +  + K+ L
Sbjct: 358 SITDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIPLEKNMEQLYRYGVDKDSL 413

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 77/184 (41%), Gaps = 18/184 (9%)

Query: 632 DSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTL--------FQDFIPKFVSLATSGDDF 683
           D   +L IRNG     +     LLD    P R L         + FIP+ +  A    D 
Sbjct: 660 DDIAVLEIRNGVERSIQFDSEALLD---NPTRILGYQGGKRTIETFIPEVIICAIGSKDC 716

Query: 684 --WACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSK 741
             W  +S +G++YI +  G++ IP + +G  +  +    KYLL ++  G  + W++   K
Sbjct: 717 KCWCLASANGSIYILSYNGQQRIPKICLGHKVIKMVTSSKYLLVLTERGLFFAWDLLDLK 776

Query: 742 LEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDG---YMYDKNME 798
           L      I P+L+    + + +  R   +  C   +       L  GD    Y + K++ 
Sbjct: 777 LVLRNVPILPILNGQPIHGNKV--RINKVIKCFRLDGSSCDLLLEVGDPKNVYKWTKDLG 834

Query: 799 TWLL 802
            W L
Sbjct: 835 CWSL 838

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/253 (19%), Positives = 105/253 (41%), Gaps = 43/253 (16%)

Query: 162 LDKNSKPLTGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLH---- 217
            D +   + GVV       F   + DR++ V+  ++  D   +    +H++  P      
Sbjct: 172 FDVHQSHVKGVVFDPANKYFATASDDRTVKVFRYHKGTD---LSFTIEHIITEPFQGSPL 228

Query: 218 ----YKITMPPQADFLPIINSLKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVL 273
                +++  P    + + N+  G        +TV +    N+    +LV      T+V 
Sbjct: 229 TTYFRRLSWSPDGQHIAVPNATNGP------VSTVAIISRGNWDTSVSLV-GHDQPTEVA 281

Query: 274 VHSPKMYEK-ANLKRGTI-----------------------SRYNLVATSTNTDGSIMIW 309
             +P+++E   N +RG                          R + V  +   D ++ +W
Sbjct: 282 CFNPRLFEHNDNHERGEEVDGASKDNSAASESSGKRRLKDDDRVDSVIATAGQDKTLAVW 341

Query: 310 NTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEE-I 368
           +T R +P+F   +++  ++ D+ W+ +G  LF  S D  +    F + +LGK +P+E+ +
Sbjct: 342 STSRARPIFVAYDLTSKSVTDIAWTCDGTALFLTSLDGRIIVITFEEGELGKAIPLEQNV 401

Query: 369 ENIRQSNIIKEPL 381
           E + +  + K+ L
Sbjct: 402 EQLHRYGVDKDSL 414

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 68/141 (48%), Gaps = 3/141 (2%)

Query: 662 ERTLFQDFIPKFV--SLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEAC 719
           ERTL + F+P+ V   + +     WA ++  G+LYI+ + G+ ++P ++IG  +  L A 
Sbjct: 674 ERTL-EAFLPEVVISCVGSKACQCWALATASGSLYIYGNHGQLLVPKISIGHKVIKLIAW 732

Query: 720 GKYLLCVSSIGELYCWNIASSKLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNG 779
             +++  +     + W+I + KL     ++ P+L       + +      +    + ++ 
Sbjct: 733 QHFVIAFTETCLFWIWDIRAMKLVEKEISVLPVLVQDQPQCNRVRISRRILDFRMLADSH 792

Query: 780 FPIATLSNGDGYMYDKNMETW 800
             +  +S+G  Y++ K +  W
Sbjct: 793 ELLVEMSDGASYVWKKALGCW 813

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/239 (20%), Positives = 103/239 (43%), Gaps = 29/239 (12%)

Query: 162 LDKNSKPLTGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLH---- 217
            D +   + GVV       F   + DR+I ++  ++TG   E     +HV+  P      
Sbjct: 172 FDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTG---ETSFSVEHVITEPFKGSPL 228

Query: 218 ----YKITMPPQADFLPIINSLKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVL 273
                +++  P    +   N++ G        +TV +     ++   +LV      T+V 
Sbjct: 229 TTYFRRLSWSPDGQHIAAPNAMNGP------VSTVAIIERGTWESPVSLV-GHDQPTEVA 281

Query: 274 VHSPKMYEKA----------NLKRGTISRYNLVATSTNTDGSIMIWNTKRGKPLFAPLNI 323
             +P+++++             K G     + +  S+  D ++ +W+T + +PL    +I
Sbjct: 282 SFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARPLIVAQDI 341

Query: 324 SDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEE-IENIRQSNIIKEPL 381
              +I DM W+ +G  LF  S D+ +    F  ++ G+ +P+E+ IE + +  + K+ L
Sbjct: 342 CGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAIPLEQNIEYLHRYGVDKDSL 400

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 40/91 (43%), Gaps = 2/91 (2%)

Query: 666 FQDFIPKFV--SLATSGDDFWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYL 723
           F+ F P  V   +       W  ++  G L+  + +G+   P ++IG  I  L     ++
Sbjct: 697 FELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRISIGHKIIKLCTSQSHV 756

Query: 724 LCVSSIGELYCWNIASSKLEFPVTTIFPLLS 754
           + ++    +Y W++ S  L      + PLL+
Sbjct: 757 IAITETALIYVWDLVSMSLTLKNIPLLPLLA 787

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 89/403 (22%), Positives = 160/403 (39%), Gaps = 57/403 (14%)

Query: 1   MRLLKYPL-----EGISGNVTSL-VTIDAEYVVVCGSRGDIQVWHQQQLLDTA-----FD 49
           MR++K+P      E     + ++ V+ D + V   G  G I++W    L+  A      D
Sbjct: 1   MRIVKFPWFSHHEESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDALVSAAAGESGVD 60

Query: 50  RCTLETLKPKYSFT-----FELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALESG 104
           R T   L      T      +   D + L     DR  L    +   +  S   +  E  
Sbjct: 61  RDTHRPLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEG-EKE 119

Query: 105 HTTLENKLIYTTVSQSIITDVKWDSLLDILF-VLTDRPCKIHLFDTRSANKKEITSIALD 163
           H T+  +L+      + I D+ W     IL  V  DR   +        N + +     D
Sbjct: 120 HWTVRKRLV---AHDNDIQDICWAPDSSILVTVGLDRSVIVW----NGLNFERLKR--FD 170

Query: 164 KNSKPLTGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPL------- 216
            +   + GV+       F   + DR++ V+  ++TG   EV    + V+V P        
Sbjct: 171 VHQSLVKGVIFDPANKYFATASDDRTMRVFRYHKTG---EVSFTIEQVIVEPFIASPLTT 227

Query: 217 -HYKITMPPQADFLPIINSLKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVH 275
              +++  P    + + N+  G       ++  ++NR      +S +   A   T+V   
Sbjct: 228 YFRRLSWSPDGQHIAVPNATNGPV-----SSVAIINRGTWDSSISLIGHDAP--TEVARF 280

Query: 276 SPKMYE----------KANLKRGTISRYNL--VATSTNTDGSIMIWNTKRGKPLFAPLNI 323
           +P++++          K  L + T +   L  +  +   D S+ +W T R +P+F   +I
Sbjct: 281 NPRLFKSDVEKKAKNAKDELSKDTKNNKKLESIIATAGQDKSLALWITSRPRPIFVAYDI 340

Query: 324 SDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPME 366
           +  +I DM W+ NG  LF  S D+ +    F  ++LG  +P+E
Sbjct: 341 AQKSITDMAWNPNGNILFVTSLDSSIVMLMFDANELGMPIPIE 383

>Kwal_47.17465
          Length = 800

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 296 VATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFL 355
           V  +   D ++++W+T + +P+F   +I+  +I DM+W+ NG  LF  S D  + TF F 
Sbjct: 290 VIATAGQDKTLVVWSTGKARPIFVAYDIASKSITDMVWNPNGDLLFLTSLDGSIITFHFG 349

Query: 356 QDDLGKTVPMEE-IENIRQSNIIKE 379
           + +LG+ +P+E  +E + +  + K+
Sbjct: 350 EKELGEAIPLERNVEQLHRYGVDKD 374

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 11/126 (8%)

Query: 684 WACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASSKLE 743
           W  ++ DG +YI+   G++ +P + +G  +  + A  KY++ ++  G LY WNI +    
Sbjct: 680 WVLATADGCIYIYTKYGQQKMPKIALGHKVVKMVAVDKYVVILTETGLLYAWNIEAEICI 739

Query: 744 FPVTTIFPLL------SPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNM 797
                I P+L      S  +R    ++     + +C +      I  ++  + Y +  N+
Sbjct: 740 HKKVPIMPILCNNSVDSNRVRIQKKVVRIG--LDLCKLD---LLITLINPREAYSWSSNL 794

Query: 798 ETWLLV 803
             W LV
Sbjct: 795 GCWTLV 800

>KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces
           cerevisiae YML102w CAC2 chromatin assembly complex,
           subunit p60, start by similarity
          Length = 493

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 250 LNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVATSTNTDGSIMIW 309
           L  N N  V S  +P       V+  +P MYE A+      + Y LV     T+  ++++
Sbjct: 304 LTSNSNKPVFS--LPFLQKPALVVKFNPIMYETAS--EWVKAPYTLVFAVATTN-EVLVY 358

Query: 310 NTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLG 360
           +T+   P+    N+  + I D+ WS +G  L   S D       F  +D G
Sbjct: 359 DTQNTSPIAIAGNLHYTPITDLAWSQDGTLLMISSTDGFCSYIHFTDNDFG 409

>Kwal_27.10385
          Length = 536

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 7/132 (5%)

Query: 250 LNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLKRGTIS-RYNLVATSTNTDGSIMI 308
           L +N N   M  ++P       V+  +P  Y+ A   +  I+  Y LV     +D  +++
Sbjct: 307 LEKNSNRPAM--VIPFLKKPCLVISFNPLYYKLATKTQPYINLPYKLVFAVATSD-EVLV 363

Query: 309 WNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEEI 368
           ++++   P+    N+  + I D+ WS +GL L   S D      +F +  LG  +  E +
Sbjct: 364 FDSETTSPICVIGNLHYTPITDLSWSQDGLMLMVSSTDGFCSYISFKEGTLGSQI-GESV 422

Query: 369 ENIRQSNIIKEP 380
             ++ +N +K P
Sbjct: 423 --VKTANDVKAP 432

>Scas_512.3
          Length = 534

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 7/135 (5%)

Query: 246 ATVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMY-----EKANLKRGTISRYNLVATST 300
           A +  N N N  VM  ++P       V+  +P  Y     E+   K+  +     +  + 
Sbjct: 315 AIIKQNSNNNRPVM--ILPFLKKPALVVSFNPNFYKLTHEEQEGTKKPYLKLPYRLIYAV 372

Query: 301 NTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAFLQDDLG 360
            T   ++I++T   KP+    N+  +A+ D+ WS +G  L   S D         ++  G
Sbjct: 373 ATSNEVLIYDTVNVKPISIIGNLHYTALTDLSWSQDGNMLMVSSTDGFCSYITIEENLFG 432

Query: 361 KTVPMEEIENIRQSN 375
           + + +EE E    +N
Sbjct: 433 EKLTIEEREQYINAN 447

>Sklu_2349.6 YNL212W, Contig c2349 9360-11852 reverse complement
          Length = 830

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 20/107 (18%)

Query: 634 KILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQD---FIPK--FVSLATSGDDFWACSS 688
           KI L I + S       + K+  +   P++ ++++   ++ K  F SLAT+ + + A  S
Sbjct: 572 KIFLGISDNS-------VFKIDPRLAGPDKIVWEEHKEYVKKYGFCSLATTENGYIAVGS 624

Query: 689 EDGTLYIFNDVGRK--IIPPLTIGVPISF--LEACGKYLL--CVSSI 729
           E G + +++ +G K  ++PPL  G PI    L   G++LL  C +S+
Sbjct: 625 ERGGIRLYDRLGIKATLLPPL--GEPIKHMCLSRNGRWLLATCHNSL 669

>KLLA0C02849g 255963..257285 some similarities with sp|P53851
           Saccharomyces cerevisiae YNL253w singleton, hypothetical
           start
          Length = 440

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 292 RYNLVATSTNTDGSIMIWNTKRGKPL---FAPLNISDSAINDMIWSSNGLTLFAVSNDNV 348
           +Y +VAT TN    I I+N + G      F+P   SD AI+ + WS++   +        
Sbjct: 169 KYLVVATKTN---EIYIYNAESGYESCISFSPDEKSDDAIHSLCWSNDSKQIIVAYKSGF 225

Query: 349 LYTFAFLQDDLGKTVPMEEIENIRQSNIIKEPLPIAYVI 387
           +  F+ LQDD  K +     +    +++I +PL  A ++
Sbjct: 226 IKLFS-LQDDGLKFLCERRNDMKTITSLIMDPLGRALLV 263

>ADR242C [1983] [Homologous to ScYMR131C (RRB1) - SH]
           (1126443..1128008) [1566 bp, 521 aa]
          Length = 521

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 294 NLVATSTNTDGSIMIWN--TKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDN 347
           N V  +   DG + IW+  +K+ KP  + + +SD+ +N M W+     L A  +DN
Sbjct: 345 NTVFATCGVDGHVRIWDIRSKKHKPALS-VKVSDTDVNVMSWNQKISYLLATGDDN 399

>YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly
           complex subunit 1, involved in nucleosome assembly
           linked with DNA replication, has WD (WD-40) repeats
           [1407 bp, 468 aa]
          Length = 468

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 263 VPSASSNTKVLVHSPKMYEKANLKRGTISRYNLVATSTNTDGSIMIWNTKRGKPLFAPLN 322
           +PS      +   SP  YE    K      Y LV     T+  +++++T   +PL    N
Sbjct: 313 IPSLKKPALMAAFSPVFYETCQ-KSVLKLPYKLVFAIATTN-EVLVYDTDVLEPLCVVGN 370

Query: 323 ISDSAINDMIWSSNGLTLFAVSNDN 347
           I  S I D+ WS +G TL   S D 
Sbjct: 371 IHYSPITDLAWSEDGSTLLISSTDG 395

>YMR164C (MSS11) [4119] chr13 complement(587273..589549)
           Transcriptional activator involved in regulation of
           starch metabolism and invasive growth [2277 bp, 758 aa]
          Length = 758

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 776 TNNGFPIATLS---NGDGYMYDKNMETWLLVSDGWWAYGSQYWDSTNNSNLIPDSS 828
           T N FP++  S   NGDG  ++ N  T   VS+ + +  S  +D  N++N  PD++
Sbjct: 191 TQNSFPVSEESFRPNGDGSNFNLNDPTNRNVSERFLSRTSGVYDKQNSANFAPDTA 246

>KLLA0D01155g complement(104847..105854) similar to sgd|S0005533
           Saccharomyces cerevisiae YOR007c SGT2, start by
           similarity
          Length = 335

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 445 NKPESKLDSSKSEITSADSSDEKAKNLEARPIEAKSKKILNGKNLESKSSSVTTSD 500
           NKPE  LD+ K  +   D   EKA ++  R  E   KK+    NLE  S+S ++ D
Sbjct: 177 NKPEEALDAYKKVL---DIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSED 229

>Scas_622.13
          Length = 580

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 847 TLLEKKTNNELTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLV-TLRLEEQH 905
           T+L+K     L+ K   K  +RF+ ++L+  G  N E+++   +L+  LL+  +R+  + 
Sbjct: 423 TILKKCAKECLSFKTIYKMDKRFSNSLLLSFGVVNFEDLIKKGYLKQALLLWIVRISNKD 482

Query: 906 EFKKLIKLYAVKLGELGYVDRLRDLFAWIISDSND 940
           E+K   K        LG  +  +D+ + I+ +  D
Sbjct: 483 EYKDDNKFLNSSFHFLGIAECFQDVSSSIVIEKKD 517

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 295 LVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWSSNGLTLFAVSNDNVLYTFAF 354
           L   S   D ++MIW+T++ +PL+   N  ++A+  + W  + + L A    ++     F
Sbjct: 360 LQLASGGNDNTVMIWDTRQDEPLWVKRN-HNAAVKAITWHPDVVNLLATGGGSLDRHIHF 418

Query: 355 LQDDLGKTV 363
                G  +
Sbjct: 419 WNTTTGARI 427

>Scas_465.4
          Length = 1002

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 681 DDFWAC-SSEDGTLYI--FNDVGRKIIPPLTIGVPISFLEAC----GKYLLCVSSIGELY 733
           D F  C +SED T+ +  FN+   K+    T    +S L+ C    GKY++  S+  EL+
Sbjct: 666 DGFIFCTASEDTTIKVCHFNESTGKVTNHWTERKHVSGLQRCKFINGKYMISSSAREELF 725

Query: 734 CWNIASSKLEFPVTTIFPLLSPS 756
            W I       P  TI   L  S
Sbjct: 726 LWEINDDYKLHPFITIRQTLPAS 748

>YPR034W (ARP7) [5468] chr16 (639520..640953) Component of SWI-SNF
           global transcription activator complex and RSC chromatin
           remodeling complex; acts to assist gene-specific
           activators through chromatin remodeling [1434 bp, 477
           aa]
          Length = 477

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 354 FLQDDLGKTVPMEEIENIRQSNIIKEPLPIAYVITASDGLGDISTSKNQGLGVAADNSSN 413
           FL   L KT+ ++  E  + +  + +P  I+   +  DGLG +     +  G     S N
Sbjct: 290 FLFKPLNKTLTLDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGA----SIN 345

Query: 414 ILSTDTNTNEKNLST--VNTTEPQTNSQSSSYNNKPE 448
            +  +T+TN   L T  +NT     NS +SS N  PE
Sbjct: 346 SMKANTSTNPNGLGTSHINTNVGDNNSTASSSNISPE 382

>KLLA0C16643g complement(1457590..1458498) highly similar to
           sp|Q04491 Saccharomyces cerevisiae YLR208w SEC13 protein
           transport protein, start by similarity
          Length = 302

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 292 RYNLVATSTNTDGSIMIWNTKRGK-PLFAPLNISDSAINDMIWSSN--GLTLFAVSNDNV 348
           ++ ++  S + DG ++IW    G+    A   +  +++N + W+ +  G  L A S+D  
Sbjct: 65  KFGVILASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASSDGK 124

Query: 349 LYTFAFLQDDLGKTVPM 365
           +    F ++  G T P+
Sbjct: 125 VSVVEFKEN--GTTSPI 139

>Sklu_2140.5 YER176W, Contig c2140 6521-9910
          Length = 1129

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 456 SEITSADSSDEKAKNLEARPIEAKSKKILNGKNLESKSSSVTTSDNIQKKVEDSK 510
           SE    ++ + +AKN + +P        LNGKN  S S S  + D+IQ ++E+ +
Sbjct: 426 SETNGRNAKESEAKNGKGKP--------LNGKNTTSGSESTVSPDSIQGEIEEGE 472

>Kwal_56.24596
          Length = 294

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 292 RYNLVATSTNTDGSIMIWNTKRGK-PLFAPLNISDSAINDMIWSSN--GLTLFAVSNDNV 348
           ++ ++  S + DG ++IW  + G+    A   +  +++N + W+ +  G  L A S+D  
Sbjct: 65  KFGVILASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASSDGK 124

Query: 349 LYTFAFLQDDLGKTVPM 365
           +    F ++  G T P+
Sbjct: 125 VSVVEFKEN--GTTSPI 139

>AGL172W [4140] [Homologous to ScYLR138W (NHA1) - SH]
           complement(374069..374092,374248..376920) [2697 bp, 898
           aa]
          Length = 898

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 420 NTNEKNLSTVNTTEPQTNSQSSSYNNKPESKLDSSKSEITSADSSDEK--AKNLEARPIE 477
           NT+++N        P+T ++SSS   K  S +   +S+ +S  S DE   + +L  RPI+
Sbjct: 746 NTHKENGRPRTKPRPRTKTRSSSVVTKALSVVGLGRSKNSSPSSEDEAEPSDDLNQRPIQ 805

Query: 478 AK 479
           A+
Sbjct: 806 AR 807

>CAGL0M05291g complement(566250..567509) similar to sp|P13712
           Saccharomyces cerevisiae YBR195c MSI1, hypothetical
           start
          Length = 419

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 1/78 (1%)

Query: 85  LGTEHSVYSYSGW-LKALESGHTTLENKLIYTTVSQSIITDVKWDSLLDILFVLTDRPCK 143
           LG  +S    + W +K     +  +    +  T   +   D+ W  + D +F+      K
Sbjct: 210 LGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGESNK 269

Query: 144 IHLFDTRSANKKEITSIA 161
           + LFD R   +KE+ SI+
Sbjct: 270 LGLFDMRLNGEKEVNSIS 287

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,042,570
Number of extensions: 1542827
Number of successful extensions: 9087
Number of sequences better than 10.0: 536
Number of HSP's gapped: 8527
Number of HSP's successfully gapped: 808
Length of query: 982
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 871
Effective length of database: 12,753,511
Effective search space: 11108308081
Effective search space used: 11108308081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)