Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I00946g25925513740.0
YOR039W (CKB2)25824410861e-151
Sklu_1979.227325410801e-150
ACR087C25725510631e-148
Scas_699.4325623410451e-145
KLLA0E21967g26025110331e-143
Kwal_55.2157024122310121e-140
KLLA0A04818g2772204491e-54
Scas_638.72702654211e-50
CAGL0A00275g2662324192e-50
Kwal_47.174492502134156e-50
Sklu_1768.43292634191e-49
YGL019W (CKB1)2782324072e-48
AGR163W2752363985e-47
Scas_651.2928778634.0
AEL146C30937626.1
CAGL0A00473g786110626.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I00946g
         (255 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   533   0.0  
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   422   e-151
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        420   e-150
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   414   e-148
Scas_699.43                                                           407   e-145
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   402   e-143
Kwal_55.21570                                                         394   e-140
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   177   1e-54
Scas_638.7                                                            166   1e-50
CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   166   2e-50
Kwal_47.17449                                                         164   6e-50
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        166   1e-49
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   161   2e-48
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   157   5e-47
Scas_651.29                                                            29   4.0  
AEL146C [2360] [Homologous to ScYJL185C - SH] (355761..356690) [...    28   6.1  
CAGL0A00473g complement(51137..53497) similar to sp|P25339 Sacch...    28   6.9  

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/255 (100%), Positives = 255/255 (100%)

Query: 1   MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYI 60
           MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYI
Sbjct: 1   MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYI 60

Query: 61  TDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYII 120
           TDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYII
Sbjct: 61  TDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYII 120

Query: 121 TVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSS 180
           TVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSS
Sbjct: 121 TVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSS 180

Query: 181 RHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKL 240
           RHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKL
Sbjct: 181 RHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKL 240

Query: 241 VKRLQAKEVDLSKSG 255
           VKRLQAKEVDLSKSG
Sbjct: 241 VKRLQAKEVDLSKSG 255

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  422 bits (1086), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 226/244 (92%)

Query: 12  MSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQK 71
           ++   SRVE DD +MDD +DSSEY  MWIDLFLGRKGHEYFCDVDPEYITDRFNL+NLQK
Sbjct: 11  VTREGSRVEQDDVLMDDDSDSSEYVDMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQK 70

Query: 72  TVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSK 131
           TVSKFS VVQYIVD+LDDSI+ENM+ ARLEQLE+D+RK YGLIHARYIIT+KGLQKM +K
Sbjct: 71  TVSKFSYVVQYIVDDLDDSILENMTHARLEQLESDSRKLYGLIHARYIITIKGLQKMYAK 130

Query: 132 YKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFG 191
           YK+ADFGRC RVYCN Q LLPVGLHD+PGID VKLYCPSCEDLY PKSSRHSSIDGAYFG
Sbjct: 131 YKEADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFG 190

Query: 192 TSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVDL 251
           TSFPGMFLQAFPDMVPKHPT RYVPKIFGFELHKQAQLTRWQELQRLKLV++L++K+VDL
Sbjct: 191 TSFPGMFLQAFPDMVPKHPTKRYVPKIFGFELHKQAQLTRWQELQRLKLVEKLESKDVDL 250

Query: 252 SKSG 255
           +KSG
Sbjct: 251 TKSG 254

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  420 bits (1080), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 219/254 (86%), Gaps = 4/254 (1%)

Query: 3   ERDIQMAD-RMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYIT 61
           E D++M D       +RV   DE   D TDSSEY + WIDLFLGRKGHEYFCDVD +YIT
Sbjct: 19  EEDVEMVDVEHQGQGTRV---DEANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYIT 75

Query: 62  DRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIIT 121
           DRFNLINLQKTVS+F+QV+QYIVDELDD+ +E MS++RLEQLE+DARK YGLIHARYIIT
Sbjct: 76  DRFNLINLQKTVSRFTQVIQYIVDELDDTALEQMSRSRLEQLESDARKLYGLIHARYIIT 135

Query: 122 VKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSR 181
           VKGLQKML KY+DADFGRC RVYCNFQ LLPVGLHDVPGID VKLYCPSCEDLY PKSSR
Sbjct: 136 VKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSR 195

Query: 182 HSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLV 241
           HSSIDGAYFGTSFPGMFLQAFP+MVPKHP  RYVP+IFGFELHKQAQL RWQELQRLKL 
Sbjct: 196 HSSIDGAYFGTSFPGMFLQAFPEMVPKHPVKRYVPRIFGFELHKQAQLARWQELQRLKLE 255

Query: 242 KRLQAKEVDLSKSG 255
            +L  + V+LSK+G
Sbjct: 256 SQLDKEGVELSKNG 269

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  414 bits (1063), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 192/255 (75%), Positives = 222/255 (87%), Gaps = 2/255 (0%)

Query: 1   MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYI 60
           M+ER  ++ +  +  T+ VE+ D V  ++T SS+Y ++WIDLFLG+KGHEYFCDVD EYI
Sbjct: 1   MSER--RLEEHGTAETADVEMADAVETNSTGSSDYVELWIDLFLGKKGHEYFCDVDTEYI 58

Query: 61  TDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYII 120
           TDRFNLINLQKTVSKF+QV+QY+VDELDD+ +E MS+ +L QLE DARK YGLIHARYII
Sbjct: 59  TDRFNLINLQKTVSKFTQVIQYMVDELDDTTLEAMSRTKLTQLEADARKLYGLIHARYII 118

Query: 121 TVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSS 180
           T+KGLQKML KY+DADF RC RV+CNFQPLLPVGLHDVPGID VKLYCPSCEDLY PKSS
Sbjct: 119 TIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIPKSS 178

Query: 181 RHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKL 240
           RHSSIDGAYFGTSFPGMFLQAFP++VPKHPT RYVPK+FGF+LHKQAQL RWQELQRLKL
Sbjct: 179 RHSSIDGAYFGTSFPGMFLQAFPEVVPKHPTKRYVPKVFGFDLHKQAQLARWQELQRLKL 238

Query: 241 VKRLQAKEVDLSKSG 255
            + L  K VDL+K+G
Sbjct: 239 ERELIKKGVDLTKNG 253

>Scas_699.43
          Length = 256

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 212/234 (90%)

Query: 22  DDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQ 81
           +D+ M + TDSSEY   WIDLFLG+KGHEYFCD+DP+YITDRFNLINLQKTVSKFSQVVQ
Sbjct: 19  EDDSMGEVTDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQ 78

Query: 82  YIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCS 141
           YIVDELD+SI+E MS ARLEQLENDARKFYGLIHARYIITVKGLQKML K+KDADFGRC 
Sbjct: 79  YIVDELDESILETMSNARLEQLENDARKFYGLIHARYIITVKGLQKMLDKFKDADFGRCP 138

Query: 142 RVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQA 201
           RVYCN+QPLLPVGLHD PG+D VKLYC SCEDLY PKS RHS IDGA+FGTSFPGMFLQA
Sbjct: 139 RVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDGAFFGTSFPGMFLQA 198

Query: 202 FPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVDLSKSG 255
           FP+MVPKHPT +YVPKIFGFELHKQAQL RWQE QRLKL K+L+  +VDL+K+G
Sbjct: 199 FPEMVPKHPTKKYVPKIFGFELHKQAQLARWQEFQRLKLEKKLKTLDVDLTKNG 252

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  402 bits (1033), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 187/251 (74%), Positives = 210/251 (83%), Gaps = 9/251 (3%)

Query: 5   DIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRF 64
           D+ MAD +  N           DD +DS EY + WIDLFLG+KGHEYFCD+D EYITDRF
Sbjct: 15  DVVMADALVVNDQ---------DDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRF 65

Query: 65  NLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKG 124
           NLINLQKTVSKF+ VVQY+VD+L++ I+E+MS ARLEQLE D RK YGLIHARYIIT KG
Sbjct: 66  NLINLQKTVSKFTTVVQYMVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKG 125

Query: 125 LQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSS 184
           LQKML KYK ADFGRC R +CN QPLLPVGLHD+PGID VKLYCPSCEDLYNPKSSRHS+
Sbjct: 126 LQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSA 185

Query: 185 IDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRL 244
           IDGAYFGTSFPGMFLQ FP+M PKHPT RYVPK+FGF+LHKQAQLTRWQELQRLKL K L
Sbjct: 186 IDGAYFGTSFPGMFLQGFPEMCPKHPTKRYVPKVFGFDLHKQAQLTRWQELQRLKLEKLL 245

Query: 245 QAKEVDLSKSG 255
             K ++L++SG
Sbjct: 246 ITKGINLNESG 256

>Kwal_55.21570
          Length = 241

 Score =  394 bits (1012), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 179/223 (80%), Positives = 200/223 (89%)

Query: 28  DATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVDEL 87
           + +DSSEYA+ WIDLFLGRKGHEYFCD+D EYITDRFNLINLQK+V+KF+QV+QY+VDEL
Sbjct: 15  EGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQVIQYMVDEL 74

Query: 88  DDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNF 147
           DD I+E MS  RLEQLE+DARK YGLIHARY+IT+KGLQKML KYK+ADFGRC RVYCNF
Sbjct: 75  DDGILEQMSSTRLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVYCNF 134

Query: 148 QPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVP 207
           QPLLPVGLHDVPG D VKLYC  CEDLY PKSSRHS+IDGAYFGTSFPGMFLQAFP+MVP
Sbjct: 135 QPLLPVGLHDVPGKDCVKLYCACCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPEMVP 194

Query: 208 KHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRLQAKEVD 250
           KHP  RYVPKIFGFELHKQAQ+ RWQELQR+KL   L+ + +D
Sbjct: 195 KHPVKRYVPKIFGFELHKQAQVARWQELQRMKLEISLREQGID 237

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  177 bits (449), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/220 (43%), Positives = 130/220 (59%), Gaps = 17/220 (7%)

Query: 24  EVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYI 83
           E  +D++DS  Y + WI  F  R GHEYFC V  ++I D FNL  L + V+ + + +  I
Sbjct: 5   EPSNDSSDSGNYEE-WIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDTI 63

Query: 84  VD---------ELDD----SIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLS 130
           +D         E +D    S  +N +      +E+ A + YGLIHAR+I+T  GLQ M  
Sbjct: 64  LDLESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQLYGLIHARFILTKAGLQAMAE 123

Query: 131 KYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYF 190
           K+   +FG C R +C    LLP GL D  G  +V+LYCPSC+DLY P+SSRH S++GAY+
Sbjct: 124 KFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSSRHLSLEGAYW 183

Query: 191 GTSFPGMFLQAF---PDMVPKHPTARYVPKIFGFELHKQA 227
           GTSFPG+FL+ F    D V K     Y  KIFGF + K+A
Sbjct: 184 GTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEA 223

>Scas_638.7
          Length = 270

 Score =  166 bits (421), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 97/265 (36%), Positives = 140/265 (52%), Gaps = 36/265 (13%)

Query: 8   MADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLI 67
           M+ +     S  EL DE      DS  Y + WI  F  R GHEYFC+V  E+I D FNL 
Sbjct: 1   MSQQFVEVPSHGELSDE------DSGNYEE-WIPSFCARFGHEYFCEVPTEFIEDDFNLT 53

Query: 68  NLQKTVSKFSQVVQYIVD---------------------ELDDSIVENMSKARLEQLEND 106
           +L + V  + + +  I+D                     + D+ + +         +E+ 
Sbjct: 54  SLSQEVPHYRKALDLILDLEAISEEEEEEDEDMVGANNGQTDELVKKKAQAVNRSIIEHA 113

Query: 107 ARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKL 166
           A + YGLIHARYI+T  GLQ M  K+   +FG C R +C    LLP GL D  G  +V+L
Sbjct: 114 AEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRL 173

Query: 167 YCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAF---PDMVPKHPTARYVPKIFGFEL 223
           YCPSC+DLY P+SSR   ++GA++GTSFPG+FL+ F    D V +     Y  K+FGF++
Sbjct: 174 YCPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKI 233

Query: 224 HKQAQLTRWQELQRLKLVKRLQAKE 248
           + +A        QR+K +++  + E
Sbjct: 234 NDRAVSG-----QRMKWLRQYPSNE 253

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  166 bits (419), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/232 (40%), Positives = 132/232 (56%), Gaps = 29/232 (12%)

Query: 24  EVMDDAT---DSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVV 80
           E M+D +   DS  Y + WI  F  R GHEYFC V  ++I D FN+ +L + V  + + +
Sbjct: 3   EYMEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKAL 61

Query: 81  QYIVDELDDSIVENM--------------------SKARLEQ--LENDARKFYGLIHARY 118
             I+D    S  E+M                    SKA + +  + + A + YGLIHARY
Sbjct: 62  DLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHARY 121

Query: 119 IITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPK 178
           I+T  GLQ M  K+   DFG C R +C+   LLP GL D  G  +V+LYCPSC+DLY P+
Sbjct: 122 ILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQ 181

Query: 179 SSRHSSIDGAYFGTSFPGMFLQAFPDM---VPKHPTARYVPKIFGFELHKQA 227
           SSRH  ++GAY+GTSFPG+FL+ F ++   V +     Y  K+FGF ++ QA
Sbjct: 182 SSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233

>Kwal_47.17449
          Length = 250

 Score =  164 bits (415), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 21  LDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVV 80
           + D     ++D S     WI  F  R GHEYFC V  E+I D FN+  L + V  + + +
Sbjct: 5   VGDNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHYRKAL 64

Query: 81  QYIVD---ELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADF 137
             ++D     D+   ++        +E+ A + YGL+HARYI+T  GLQ M  K+   +F
Sbjct: 65  DLVLDLEAMSDEEGQDSEEPVSRSIVEHAAEQLYGLVHARYILTKPGLQAMAEKFDHKEF 124

Query: 138 GRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGM 197
           G C R YC    +LP GL D  G  +V+LYCPSC+DLY P+SSRH  ++GA++GTSFPG+
Sbjct: 125 GTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDLYLPQSSRHLCLEGAFWGTSFPGV 184

Query: 198 FLQAF---PDMVPKHPTARYVPKIFGFELHKQA 227
           FL+ F    D V +     Y  ++FGF +  +A
Sbjct: 185 FLKHFKELEDYVDRKSKDTYELRVFGFRIASEA 217

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  166 bits (419), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 148/263 (56%), Gaps = 26/263 (9%)

Query: 4   RDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDR 63
           + ++  +RMS       ++D+   +++DS  Y + WI  F  R GHEYFC V  E+I D 
Sbjct: 62  KRVEQINRMSQEF----IEDQSSSNSSDSGTYDE-WIPSFCSRFGHEYFCQVPTEFIEDD 116

Query: 64  FNLINLQKTVSKFSQVVQYIVD-----------ELDDSIVENMSKARLEQ--LENDARKF 110
           FN+  L + +  + + +  I+D           + D +  E+ S   + +  +E+ A + 
Sbjct: 117 FNMTGLSQEIPHYRKALDLILDLEAMSDEDDEDDNDGAAEEDGSGEPVNRSIMEHAAEQL 176

Query: 111 YGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPS 170
           YGLIHARYI+T  GLQ M  K+   +FG C R YC    +LP GL D  G  +V+LYCPS
Sbjct: 177 YGLIHARYILTKPGLQSMAEKFDHKEFGTCPRYYCGGMQMLPCGLSDTLGKQTVRLYCPS 236

Query: 171 CEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFP---DMVPKHPTARYVPKIFGFELHKQA 227
           C+DLY P+SSRH  +DGA++GTSFPG+FL+ F    D V +     Y  K+FGF+++ +A
Sbjct: 237 CQDLYLPQSSRHLCMDGAFWGTSFPGVFLKHFKELEDYVERKSKDVYELKVFGFKINGEA 296

Query: 228 QLTRWQELQRLKLVKRLQAKEVD 250
                    R+K +++  A E +
Sbjct: 297 VSG-----PRMKWLRQYPATEAE 314

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  161 bits (407), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 126/232 (54%), Gaps = 33/232 (14%)

Query: 28  DATDSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVD-- 85
           D  DS  Y + WI  F  R GHEYFC V  E+I D FN+ +L + V  + + +  I+D  
Sbjct: 16  DDEDSGAYDE-WIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLE 74

Query: 86  --------------------ELDDSIVENMSKARLEQ-------LENDARKFYGLIHARY 118
                               E+  +   +  K R +        +E+ A + YGLIHAR+
Sbjct: 75  AMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARF 134

Query: 119 IITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPK 178
           I+T  GLQ M  K+   +FG C R YCN   LLP GL D  G  +V+LYCPSC+DLY P+
Sbjct: 135 ILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQ 194

Query: 179 SSRHSSIDGAYFGTSFPGMFLQAFPDM---VPKHPTARYVPKIFGFELHKQA 227
           SSR   ++GA++GTSFPG+FL+ F ++   V +     Y  K+FGF ++ +A
Sbjct: 195 SSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  157 bits (398), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 126/236 (53%), Gaps = 34/236 (14%)

Query: 26  MDDATDSSEYAQM--WIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYI 83
           M+D +D SE +    WI  F  R GHE+FC V  E+I D FNL  L   V  + + +  I
Sbjct: 4   MEDVSDVSESSNYDEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDLI 63

Query: 84  VD-----ELDDSIV-------------ENMSKARLEQ-----------LENDARKFYGLI 114
           +D     E D+  V              N +  R              +++ A + YGLI
Sbjct: 64  LDLESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGLI 123

Query: 115 HARYIITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDL 174
           HARYI+T +GLQ M  K+   +FG C R YC    LLP GL D  G ++V+LYC SC+DL
Sbjct: 124 HARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQDL 183

Query: 175 YNPKSSRHSSIDGAYFGTSFPGMFLQAF---PDMVPKHPTARYVPKIFGFELHKQA 227
           Y P SSRH  ++GA++GTSFPG+FL+ F    D V +     Y  +IFGF + K++
Sbjct: 184 YLPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKES 239

>Scas_651.29
          Length = 287

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 14/78 (17%)

Query: 73  VSKFSQVVQYIVDELDDSIV---------ENMSKARLE-----QLENDARKFYGLIHARY 118
           V  FS+ + Y V+E+DD++V          N   ARLE     +LE D        + + 
Sbjct: 103 VINFSKKLAYSVEEVDDTLVLSLKSTKWGSNTLDARLEFSCDDKLETDELSKTTWQNNQI 162

Query: 119 IITVKGLQKMLSKYKDAD 136
           ++++KG    L   KD D
Sbjct: 163 LLSIKGPSGCLKNGKDKD 180

>AEL146C [2360] [Homologous to ScYJL185C - SH] (355761..356690) [930
           bp, 309 aa]
          Length = 309

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 208 KHPTARYVPKIFGFELHKQAQLTRWQELQRLKLVKRL 244
           + P  R +P++  +E  K AQLT  +  Q  K VK L
Sbjct: 173 RPPAVRPLPRVSSYESRKLAQLTPAELAQLTKFVKEL 209

>CAGL0A00473g complement(51137..53497) similar to sp|P25339
           Saccharomyces cerevisiae YGL014w, hypothetical start
          Length = 786

 Score = 28.5 bits (62), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/110 (20%), Positives = 52/110 (47%), Gaps = 15/110 (13%)

Query: 31  DSSEYAQMWIDLFLGRK----GHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVDE 86
           D+S+YA   +D F+G        ++ C     ++  + +++  + + + F +  +Y V+ 
Sbjct: 452 DNSQYADATLDQFIGNIYSLCKDQHGC----RFLQKQLDVLGKKASDAIFEETKEYTVEL 507

Query: 87  LDDSIVENMSKARLEQLENDARKFYGLIHARYIITV-------KGLQKML 129
           + DS    + +  LE++ +D R     I A  ++ +       + LQK++
Sbjct: 508 MTDSFGNYLIQKLLERVTDDQRVELAKIAAPKMVEISKDPHGTRALQKLI 557

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,590,168
Number of extensions: 378234
Number of successful extensions: 1107
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1100
Number of HSP's successfully gapped: 25
Length of query: 255
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 156
Effective length of database: 13,168,927
Effective search space: 2054352612
Effective search space used: 2054352612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)