Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0I00924g27427014700.0
YDR272W (GLO2)2742719841e-135
Scas_699.442822719611e-132
Sklu_1159.12822709481e-130
Kwal_55.215822842709361e-128
YOR040W (GLO4)2852719141e-124
KLLA0F16016g2832718921e-121
ACR084C2932718561e-115
KLLA0F02970g49456690.96
YLR049C42860681.2
Sklu_1773.323387661.7
CAGL0L02893g52681662.4
Scas_603.9168947644.6
ABL051W37962626.2
Scas_654.1*166852626.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0I00924g
         (270 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   570   0.0  
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   383   e-135
Scas_699.44                                                           374   e-132
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            369   e-130
Kwal_55.21582                                                         365   e-128
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   356   e-124
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   348   e-121
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   334   e-115
KLLA0F02970g complement(276288..277772) gi|461614|sp|P26375|BAF1...    31   0.96 
YLR049C (YLR049C) [3466] chr12 complement(243887..245173) Protei...    31   1.2  
Sklu_1773.3 YNR057C, Contig c1773 4329-5030                            30   1.7  
CAGL0L02893g 338323..339903 tr|Q8TFK7 Candida glabrata YOR205Cp,...    30   2.4  
Scas_603.9                                                             29   4.6  
ABL051W [541] [Homologous to ScYKL112W (ABF1) - SH] complement(3...    28   6.2  
Scas_654.1*                                                            28   6.7  

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/270 (100%), Positives = 270/270 (100%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120
           HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH
Sbjct: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120

Query: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS 180
           TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS
Sbjct: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS 180

Query: 181 TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM 240
           TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM
Sbjct: 181 TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM 240

Query: 241 KLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           KLDDPIVRAAVGDSENQWTSAAVMDKLRKM
Sbjct: 241 KLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/271 (65%), Positives = 211/271 (77%), Gaps = 2/271 (0%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           M VK IKMRW +GGVNY YL+S+     SWLIDPAEP EV PEL+E E+ SV A+VNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 61  HYDHAGGNTSLLKQFKE-TVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119
           HYDHA GN  +LK  KE      ++VIGGS++C  VT+IP + +KL +G+L++TCIRTPC
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120

Query: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179
           HT+DS+CYY++DP TDERCIFTGDTLFTAGCGRFFEGTGEEMD ALN  ILE VG+ NWS
Sbjct: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180

Query: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239
            T VYPGHEYT  NVKFVR KIYP    N   DELE+FC++HEVT G+FTL DE+ FNPF
Sbjct: 181 KTRVYPGHEYTSDNVKFVR-KIYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239

Query: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           M+L+DP V+ A GD+ N W  A +MDKLR M
Sbjct: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAM 270

>Scas_699.44
          Length = 282

 Score =  374 bits (961), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 170/271 (62%), Positives = 212/271 (78%), Gaps = 1/271 (0%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           M+VKPIKMRW TGGVNYSYL+S+QD+  SWLIDPAE  EV P L   ER ++ A+VNTHH
Sbjct: 8   MYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIVNTHH 67

Query: 61  HYDHAGGNTSLLKQFKETVGKPL-QVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119
           HYDH+ GN S++ + K+   + + ++I GS+    V+ IPTH QK ++GNL+V C+RTPC
Sbjct: 68  HYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCLRTPC 127

Query: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179
           HTQDS+CYY++D +T+E+C+FTGDTLFT GCGRFFEG G+EMD ALNK ILEGVG+ NW+
Sbjct: 128 HTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGEPNWN 187

Query: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239
            T VYPGHEYTK NVKF+R  +Y     N   D+LE+FC  HEVTTG+FTL DEL FNPF
Sbjct: 188 MTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKFNPF 247

Query: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           M+LDDPIVR AVGD+E +W  + VM+ LRKM
Sbjct: 248 MRLDDPIVRKAVGDAEEKWERSKVMETLRKM 278

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  369 bits (948), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 210/270 (77%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVK IKMRW TGGVNYSYL+S QD+T SWLIDPAEP EV P+L++ E  S+ A+VNTHH
Sbjct: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAVVNTHH 68

Query: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120
           HYDH+GGN  ++   K+     + VI GS      T +P   QK K+G+L+V CIRTPCH
Sbjct: 69  HYDHSGGNIPVIAALKKAGQNAVSVICGSHTSPGATEVPQDLQKYKLGDLEVLCIRTPCH 128

Query: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS 180
           TQDSVCY+++D +T ERCIFTGDTLFTAGCGRFFEGTGEEMD ALN+ +LE  G+ NWS+
Sbjct: 129 TQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGEENWST 188

Query: 181 TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM 240
           T VYPGHEYTKSNV+FVR+ IY T   N  FD+LE FC+++EVTTG FTL DEL FNPFM
Sbjct: 189 TKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELDFNPFM 248

Query: 241 KLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           +L+ P+VR +VGD++  W  A VMDKLR+M
Sbjct: 249 RLNCPMVRKSVGDAQGAWPKARVMDKLRQM 278

>Kwal_55.21582
          Length = 284

 Score =  365 bits (936), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 170/270 (62%), Positives = 201/270 (74%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVK IKMRW TGGVNY YL+S QD+T SWLIDPAEP EV   L   E  +V A+VNTHH
Sbjct: 11  MHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVVNTHH 70

Query: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120
           HYDH+GGN++++ + ++     L VI GS      T IP + Q+  +G+L + CIRTPCH
Sbjct: 71  HYDHSGGNSAIVGELRKMGVSHLDVICGSNTSPGATKIPKNLQEYSLGDLKIKCIRTPCH 130

Query: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWSS 180
           TQDSVCYY+ DP T E+CIFTGDTLFTAGCGRFFEGTGEEMD ALN+ IL+GVG+ NW  
Sbjct: 131 TQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGEPNWDI 190

Query: 181 TLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFM 240
           T VYPGHEYTKSNVKFVR  +Y T   NS  D LE  CN+H+VTTG FT+ DEL +NPFM
Sbjct: 191 TKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELAYNPFM 250

Query: 241 KLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           +LDDP VR A+ DS    + A VMD+LRKM
Sbjct: 251 RLDDPTVRDAIKDSNGSLSRAQVMDQLRKM 280

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  356 bits (914), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 204/271 (75%), Gaps = 1/271 (0%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVKPIKMRW TGGVNYSYL+S +D+  SWLIDPAEP EV P+LS  E++S+ A+VNTHH
Sbjct: 11  MHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVNTHH 70

Query: 61  HYDHAGGNTSLLKQF-KETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119
           HYDH+GGN +L     +E  G  +++IGGS+    VT +P + Q+  +GNL VTCIRTPC
Sbjct: 71  HYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPC 130

Query: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179
           HT+DS+CYYI+D ET E+CIFTGDTLF AGCGRFFEGTG +MD ALN+ +L  VG+ NW+
Sbjct: 131 HTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGETNWN 190

Query: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239
              +YPGHEYTK NV F+R+KIY     N  FD LE++C  +E TTG FTL DEL +NPF
Sbjct: 191 KVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGYNPF 250

Query: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           M+LDD  VR AVGD+   +  + VM +LRK+
Sbjct: 251 MRLDDRAVRLAVGDTAGTYPRSVVMQELRKL 281

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  348 bits (892), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 168/271 (61%), Positives = 192/271 (70%), Gaps = 1/271 (0%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVK IKMRW TGGVNYSYL+S QD+  SWLIDPAE  EV  +L   E +S+ ALVNTHH
Sbjct: 9   MHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSIEALVNTHH 68

Query: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPCH 120
           HYDHAGGN S L    E      +VI GS+       IP +  +  +GNL + CIRTPCH
Sbjct: 69  HYDHAGGNVSTLAALNEKGNNISRVIAGSQRSPIANDIPDNLHEYTLGNLKILCIRTPCH 128

Query: 121 TQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGK-NNWS 179
           TQDS CYY+RDPET E+ IFTGDTLFT GCGRFFEGT EEMD ALN  +L   G  +NW 
Sbjct: 129 TQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLGNTGDTSNWK 188

Query: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239
           +  VYPGHEYT  NV F+R+ IY   + N  F++LE F  EHEVTTG FT+ADEL FNPF
Sbjct: 189 NVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTIADELSFNPF 248

Query: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           M+LDDPIVR  VGDS+  WT A VMDKLR M
Sbjct: 249 MRLDDPIVRRQVGDSQGCWTRAQVMDKLRNM 279

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  334 bits (856), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 163/271 (60%), Positives = 193/271 (71%), Gaps = 4/271 (1%)

Query: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60
           MHVK IKMRW TGGVNYSYLVS QD+  SWLIDPAE  EV P LS  E++S+ A+VNTHH
Sbjct: 22  MHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIRAIVNTHH 81

Query: 61  HYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHSQKLKIGN-LDVTCIRTPC 119
           HYDHAGGN ++    K   G  + VI GS      T IP H QK  +G+ ++V CIRTPC
Sbjct: 82  HYDHAGGNLAIRAALKRE-GVAVPVIAGSTTSPVSTDIPEHLQKYTLGDSVEVLCIRTPC 140

Query: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179
           HTQDS+CY++RD +T ++ +FTGDTLFTAGCGRFFEGT EEMDAALN  +LE V   + +
Sbjct: 141 HTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLEHV--QDHA 198

Query: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239
           +T VYPGHEYTK NV F+RS IY +   N  FD LE F N + VTTG+FTL DE  +NPF
Sbjct: 199 ATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQDETEYNPF 258

Query: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKM 270
           M+LDDP +R  VGD    W  A VM KLR M
Sbjct: 259 MRLDDPTIRRRVGDLHRTWARADVMAKLRSM 289

>KLLA0F02970g complement(276288..277772)
           gi|461614|sp|P26375|BAF1_KLULA Kluyveromyces lactis
           Transcription factor BAF1 (ARS binding factor 1)
           (Protein ABF1) (Bidirectionally acting factor), start by
           similarity
          Length = 494

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 181 TLVYPGHEY-TKSNV---KFVRSKIYPTTNVNSRFDE-LERFCNEHEVTTGKFTLA 231
           T + P H +  +SN+   +FV SKI     V+ +FD  LE  CN+ + T  KF +A
Sbjct: 158 TKIEPYHNHPLESNLSLQRFVLSKIPKILQVDLKFDAILESLCNDDDNTVAKFRVA 213

>YLR049C (YLR049C) [3466] chr12 complement(243887..245173) Protein
           of unknown function [1287 bp, 428 aa]
          Length = 428

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 9/60 (15%)

Query: 207 VNSRFDELERFCNEHEVTTGKFT---------LADELLFNPFMKLDDPIVRAAVGDSENQ 257
           +NSRFD+ +   N + VT GKF          L D+L  N  M    P++R  + ++ N+
Sbjct: 291 LNSRFDDNKDNKNSYTVTEGKFYQDFPNLYYHLKDKLKLNVIMDFIKPVIRNFMTNALNK 350

>Sklu_1773.3 YNR057C, Contig c1773 4329-5030
          Length = 233

 Score = 30.0 bits (66), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 2/87 (2%)

Query: 124 SVCYYIRDPETDERCIFTGDTLFTAGCGRFFE--GTGEEMDAALNKYILEGVGKNNWSST 181
           S   ++   +TD    F    L  +    +++   TG E D    K +L+  GK++WS T
Sbjct: 15  SPIIFVTGTDTDVGKTFISSLLVHSWSANYWKPVQTGIESDQGDTKTVLQFSGKSSWSPT 74

Query: 182 LVYPGHEYTKSNVKFVRSKIYPTTNVN 208
           L  P +E  K    +   +  P  ++ 
Sbjct: 75  LFPPRYELLKPLSPYKAMEFEPQVDIK 101

>CAGL0L02893g 338323..339903 tr|Q8TFK7 Candida glabrata YOR205Cp,
           identified start
          Length = 526

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 32/81 (39%), Gaps = 10/81 (12%)

Query: 107 IGNLDVTCIRTPCH--TQDSV------CYYIRDPETDERCIFT-GDTLFTAGCGRFFEGT 157
           +  +DV CIR P     +DS        YYI++P      +    D          +E  
Sbjct: 443 LDGIDV-CIRKPLERVAEDSYDKSQEGKYYIKEPVVSHTYVVAHNDPNPLQTVKESYEKV 501

Query: 158 GEEMDAALNKYILEGVGKNNW 178
            E  D  LNKY LE  G N W
Sbjct: 502 KERTDEILNKYNLEKFGNNMW 522

>Scas_603.9
          Length = 1689

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 184  YPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTL 230
            Y  H+  K N  F+R+ I    NV   FDE+    +  E T+GK  L
Sbjct: 1249 YQLHKKGKQNESFIRTNI--NENVAEDFDEVSSVLDPLETTSGKMKL 1293

>ABL051W [541] [Homologous to ScYKL112W (ABF1) - SH]
           complement(302184..303323) [1140 bp, 379 aa]
          Length = 379

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 175 KNNWSSTLVYPGHEYT-KSNV---KFVRSKIYPTTNVNSRFDE-LERFCNEHEVTTGKFT 229
           K  ++ T + P H +  +SN+   KFV +KI      + +FD  LE  CNE + T  KF 
Sbjct: 129 KGPFTVTKIEPYHNHLLESNLSLFKFVLTKIPKILQNDLKFDSILETLCNEDDNTVAKFR 188

Query: 230 LA 231
           ++
Sbjct: 189 VS 190

>Scas_654.1*
          Length = 1668

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 15/52 (28%)

Query: 205 TNVNSRFDELERFCNEHEVTTGKFTLADELLFNPFMKLDDPIVRAAVGDSEN 256
           T V +  DE ERF +               L+NPF+++  P+ +A + D +N
Sbjct: 403 TLVRTHIDERERFFS---------------LYNPFLQISSPLTKARIYDQDN 439

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,821,360
Number of extensions: 438094
Number of successful extensions: 1100
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1093
Number of HSP's successfully gapped: 17
Length of query: 270
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 170
Effective length of database: 13,134,309
Effective search space: 2232832530
Effective search space used: 2232832530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)