Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10362g1491477591e-105
YDL110C1501493366e-41
Sklu_1742.31541533202e-38
Scas_613.23*1371132705e-31
Kwal_23.34581531522654e-30
KLLA0E09229g1601592325e-25
AGR378C1171201922e-19
KLLA0C17380g1119110710.18
Scas_666.1027554660.52
Scas_705.5458254641.4
KLLA0D15180g237959622.4
Scas_594.7170397622.6
Sklu_2381.257685613.3
Scas_660.1921984603.3
CAGL0L08932g31259594.3
Scas_305.137758595.2
Scas_710.48116029595.3
Scas_510.3111340595.9
YOL017W (ESC8)71437586.8
Kwal_56.23134106643587.9
AFR211C41931588.0
Kwal_55.19808825113588.1
KLLA0C03608g22562579.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10362g
         (147 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces...   296   e-105
YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein ...   134   6e-41
Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement        127   2e-38
Scas_613.23*                                                          108   5e-31
Kwal_23.3458                                                          106   4e-30
KLLA0E09229g complement(827035..827517) similar to sgd|S0002268 ...    94   5e-25
AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)...    79   2e-19
KLLA0C17380g 1524716..1528075 weakly similar to sp|P23201 Saccha...    32   0.18 
Scas_666.10                                                            30   0.52 
Scas_705.54                                                            29   1.4  
KLLA0D15180g 1284273..1291412 weakly similar to sgd|S0006321 Sac...    28   2.4  
Scas_594.7                                                             28   2.6  
Sklu_2381.2 YPR072W, Contig c2381 3614-5344                            28   3.3  
Scas_660.19                                                            28   3.3  
CAGL0L08932g complement(974259..975197) highly similar to tr|Q12...    27   4.3  
Scas_305.1                                                             27   5.2  
Scas_710.48                                                            27   5.3  
Scas_510.3                                                             27   5.9  
YOL017W (ESC8) [4799] chr15 (292529..294673) Protein possibly in...    27   6.8  
Kwal_56.23134                                                          27   7.9  
AFR211C [3403] [Homologous to ScYLR027C (AAT2) - SH] (812677..81...    27   8.0  
Kwal_55.19808                                                          27   8.1  
KLLA0C03608g 330900..331577 similar to sgd|S0002894 Saccharomyce...    27   9.5  

>CAGL0H10362g 1009858..1010307 similar to tr|Q12513 Saccharomyces
           cerevisiae YDL110c, start by similarity
          Length = 149

 Score =  296 bits (759), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA
Sbjct: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60

Query: 61  VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNP 120
           VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNP
Sbjct: 61  VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNP 120

Query: 121 EGSLAERKLSAIDMDNTNVDVAAPNSI 147
           EGSLAERKLSAIDMDNTNVDVAAPNSI
Sbjct: 121 EGSLAERKLSAIDMDNTNVDVAAPNSI 147

>YDL110C (YDL110C) [759] chr4 complement(264512..264964) Protein of
           unknown function [453 bp, 150 aa]
          Length = 150

 Score =  134 bits (336), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 97/149 (65%), Gaps = 3/149 (2%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGH- 59
           M SA G++RP+ +  FK AI  M D EL ++K E+ENSI HL RSN RL +YI KL+G  
Sbjct: 1   MCSAGGIRRPIQIEEFKTAISGMSDMELAQIKTEIENSINHLQRSNARLGKYIAKLEGAD 60

Query: 60  -AVELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKS 118
             +E +D +++ EN+ S D+ L+++S+RENE+VL+N  ER++AL  E  YRK  H   K 
Sbjct: 61  DRLEADDSDDL-ENIDSGDLALYKDSVRENEIVLNNYNERVDALEQETVYRKTGHGKSKH 119

Query: 119 NPEGSLAERKLSAIDMDNTNVDVAAPNSI 147
             E      K   +DMDN+NVDV  PNSI
Sbjct: 120 EVEAKDNTNKGPDVDMDNSNVDVVTPNSI 148

>Sklu_1742.3 YDL110C, Contig c1742 2887-3351 reverse complement
          Length = 154

 Score =  127 bits (320), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 99/153 (64%), Gaps = 7/153 (4%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           M++A  ++RP+ +A FK AIRD+  D+L +++QE++NSI+HL RSN RL +YI ++QG  
Sbjct: 1   MSTAGSIRRPIQIAEFKTAIRDLPQDQLSKIRQELQNSIKHLDRSNARLTKYIARIQGKK 60

Query: 61  ----VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDG 116
               VELE GE  ++ + ++D++L+Q+S+RENE+VL N   RL+AL  E AYR +     
Sbjct: 61  PESNVELE-GESDEDTIDANDLQLYQDSLRENEIVLRNHYARLDALDQEEAYRTSGSTSA 119

Query: 117 KSN--PEGSLAERKLSAIDMDNTNVDVAAPNSI 147
             N    G      +S ID DNT  D  APNS+
Sbjct: 120 SENKASRGPAVAAAISGIDTDNTQGDANAPNSV 152

>Scas_613.23*
          Length = 137

 Score =  108 bits (270), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 78/113 (69%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           M+S   MKRP+ +  FK AI+DM ++EL  ++ ++ENS+ HL RSN++L +YI KL+G  
Sbjct: 1   MSSPGAMKRPIQIEEFKTAIKDMSEEELKNIRYQIENSVSHLERSNKKLEKYIAKLEGLE 60

Query: 61  VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQH 113
            E  D  E  EN+ + D++LF++S+REN++VL N  +RL+AL  E  YR + H
Sbjct: 61  QEYADDSEEVENIEAGDLQLFRDSVRENQIVLKNYNKRLDALDQENIYRTSGH 113

>Kwal_23.3458
          Length = 153

 Score =  106 bits (265), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 96/152 (63%), Gaps = 6/152 (3%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           M+ A+  +RPV++  FK  I+D+ D +L +++ E+ENS++HL RSN RL +YI K++G  
Sbjct: 1   MSDATSRRRPVEITEFKAVIKDLPDGQLNKIRSELENSMKHLDRSNLRLKKYIAKIEGKR 60

Query: 61  VELEDG---EEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRK--AQHPD 115
               DG   EE+D+ + ++D++LFQ+S RENE+VL N  ERLEAL  E +YR   A+   
Sbjct: 61  ESTPDGVDEEELDK-VDANDLQLFQDSYRENEIVLRNHYERLEALDLEASYRDRGARSGT 119

Query: 116 GKSNPEGSLAERKLSAIDMDNTNVDVAAPNSI 147
             S  +        ++ D DNTN D  APNS+
Sbjct: 120 TASTSDQHDTTATTTSFDTDNTNGDTNAPNSV 151

>KLLA0E09229g complement(827035..827517) similar to sgd|S0002268
           Saccharomyces cerevisiae YDL110c hypothetical protein,
           start by similarity
          Length = 160

 Score = 94.0 bits (232), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 91/159 (57%), Gaps = 13/159 (8%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           M  +SG++RP+ +  F IAIR+  + EL  +++E+ N+++HL RSN RL  Y+ KL+G  
Sbjct: 1   MAHSSGIRRPIQIQEFVIAIRESSEHELQEIRKEINNAVKHLQRSNRRLEAYVAKLKGEE 60

Query: 61  V----ELE-DGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPD 115
           V    EL+ +G   D+++   D+++FQ+S+ EN  VLDN  ERL+AL  E  +R +    
Sbjct: 61  VLNRQELDAEGNFSDDDIDEKDLQVFQDSLAENGKVLDNYNERLQALDLEEQHRASTVSS 120

Query: 116 GKSNPEGSLAERKLSA-------IDMDNTNVDVAAPNSI 147
           G      +  +R L +       +D DNT  D    NSI
Sbjct: 121 GDIQSASTKLKRSLQSQGRRTVGVDSDNT-ADATGSNSI 158

>AGR378C [4689] [Homologous to ScYDL110C - SH] (1426104..1426457)
           [354 bp, 117 aa]
          Length = 117

 Score = 78.6 bits (192), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 69/120 (57%), Gaps = 15/120 (12%)

Query: 1   MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHA 60
           M  +   +RPV +A FK A+R++   EL   +Q +E   R L R++ERL R++++L    
Sbjct: 1   MAGSEVARRPVQIAEFKTAVRELSQQELAAARQALEARARQLARTSERLARHVQEL---- 56

Query: 61  VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEA--LHDEL-AYRKAQHPDGK 117
            E ++GE         ++ LF+ S+RENE+VL N RERLEA  L +E   Y  A   DG+
Sbjct: 57  -EQQEGE-------GGNLALFRTSLRENEVVLGNCRERLEAVGLEEEFRGYAGATAADGR 108

>KLLA0C17380g 1524716..1528075 weakly similar to sp|P23201
           Saccharomyces cerevisiae YLL021w SPA2 involved in cell
           polarity, start by similarity
          Length = 1119

 Score = 32.0 bits (71), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query: 28  LGRVKQEVENSIRHLTRSNERLHRYIKKLQGHAVELEDGEEMDENLGSDDIELFQESIRE 87
           L R K E+ N +  L  +N+RL   +++L+ +A +    + +D N        FQ+ + E
Sbjct: 349 LEREKSELLNQLDELKTNNQRLTEEVQQLKQNADQSSTTKALDSN--------FQKGMSE 400

Query: 88  -----NELVLDNSRERLEALHDELAYRKAQHP----DGKSNPEGSLAERK 128
                N+L ++N   + E L  +L  +  Q P    DGKS  + +  + K
Sbjct: 401 MTTQLNQLSIENEELKQEKLELQLQLKNIQSPVKSIDGKSGKDAAYWKSK 450

>Scas_666.10
          Length = 275

 Score = 30.0 bits (66), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 20  IRDMGDDELGRVKQEVENSIRHLTRSNERLHRYIKKLQGHAVELEDGEEMDENL 73
           +RD  DD+ G + +    S+    RS++  H++   + G+A  L +GEEM+ N 
Sbjct: 187 VRDPIDDK-GTIIRSGSCSMDRYERSHDDKHKWKMTMNGNASYLTNGEEMNWNF 239

>Scas_705.54
          Length = 582

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 6/54 (11%)

Query: 49  LHRYIKKLQGHAVELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEAL 102
           L R IKKLQ H       E++   L  DD +  Q+++ EN  +++N  ER +++
Sbjct: 49  LKREIKKLQKH------REQIKTWLSKDDTKDRQQALMENRRLIENGMERFKSI 96

>KLLA0D15180g 1284273..1291412 weakly similar to sgd|S0006321
            Saccharomyces cerevisiae YPR117w, start by similarity
          Length = 2379

 Score = 28.5 bits (62), Expect = 2.4,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 33   QEVENSIRHLTRSNERLHRYIKKLQGHAVELEDGEEMDENLGSDDIELFQESIRENELV 91
            QE ENS+ HL RS   +H+ +K       +LE  E  +    + DIE    S+ E+E V
Sbjct: 1543 QEQENSLHHLKRSLHLIHQMLK-------DLEISENANMQDPNTDIE---SSLAESEFV 1591

>Scas_594.7
          Length = 1703

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 11/97 (11%)

Query: 7    MKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTRSNERLHR------YIKKLQGHA 60
            +K PV   N +  I D   ++L  V ++      HL  +N R++       Y   ++   
Sbjct: 1611 IKYPVAYENIQRHIDDKAYNKLFEVLEDF-----HLVFANARIYNTEDSLVYQDAIELEG 1665

Query: 61   VELEDGEEMDENLGSDDIELFQESIRENELVLDNSRE 97
            V +E  +E+ +++   D  LF E      LVL+N  E
Sbjct: 1666 VIIEKYKELSKDINPIDFSLFDELYATQPLVLNNISE 1702

>Sklu_2381.2 YPR072W, Contig c2381 3614-5344
          Length = 576

 Score = 28.1 bits (61), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 49  LHRYIKKLQGHAVELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDELAY 108
           L R IKKLQ H       E++   L  +D++  Q  + EN  +++N  ER +++ ++L  
Sbjct: 49  LKREIKKLQKHR------EQIKTWLSKEDVKDKQHVLMENRRLIENGMERFKSV-EKLMK 101

Query: 109 RKAQHPDGKSNPEGSLAERKLSAID 133
            K    +  +NP+     R+LS  D
Sbjct: 102 TKQFSTEALTNPDMIKDPRELSKRD 126

>Scas_660.19
          Length = 219

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 12/84 (14%)

Query: 31  VKQEVENSIRHLTRSNERLHRYIKKLQGHAVELEDGEEM---DENLGSDDIEL------- 80
           V QE E +++ L    + +   IKK +  AV    G+ +   D+ L  DD+EL       
Sbjct: 66  VIQERETAVQELKNELKSIKDQIKK-KSEAVNTTTGDGLNGVDDFLNEDDVELDGGKANP 124

Query: 81  FQES-IRENELVLDNSRERLEALH 103
           FQ+  +RE ++ LDN  E ++ LH
Sbjct: 125 FQDQMLREQDVHLDNIHETMQNLH 148

>CAGL0L08932g complement(974259..975197) highly similar to tr|Q12230
           Saccharomyces cerevisiae YPL004c or sp|P53252
           Saccharomyces cerevisiae YGR086c, start by similarity
          Length = 312

 Score = 27.3 bits (59), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 63  LEDGEEMDENL-GSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNP 120
            E GE  D+ +   D   +  +SIR  E  +  SR+R E + DE+A+ K + P     P
Sbjct: 109 FELGELQDQFIDKYDQYRVTMKSIRNIEASVQPSRDRKEKITDEIAHLKYKDPSSTKIP 167

>Scas_305.1
          Length = 377

 Score = 27.3 bits (59), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 64  EDGEEMDENL-GSDDIELFQESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNP 120
           E GE  D+ +   D   +  +SIR  E  +  SR+R E + DE+A+ K + P+    P
Sbjct: 169 ELGELQDQFIDKYDQYRVTLKSIRNIEASVQPSRDRKEKITDEIAHLKYKEPNSTKIP 226

>Scas_710.48
          Length = 1160

 Score = 27.3 bits (59), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 64  EDGEEMDENLGSDDIELFQESIRENELVL 92
           EDGE  ++N G  + +   ESI +NE+VL
Sbjct: 731 EDGEPFEDNFGKLERKRLMESISDNEVVL 759

>Scas_510.3
          Length = 1113

 Score = 27.3 bits (59), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 2/40 (5%)

Query: 99  LEALHDELAYRKAQHPDGKSNPEGSLAERKLSA--IDMDN 136
           ++ +   L+YRK++    K  PE +LA  K++A  ID+D+
Sbjct: 280 VQFITSALSYRKSKVSQSKLGPEITLAALKIAAEEIDVDD 319

>YOL017W (ESC8) [4799] chr15 (292529..294673) Protein possibly
           involved in telomeric silencing, interacts with Sir2p
           [2145 bp, 714 aa]
          Length = 714

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 62  ELEDGEEMDENLGSDDIELFQESIRENELVLDNSRER 98
           EL +G + D +   DDIE+F E +R+   + DNSRE+
Sbjct: 671 ELHNGAK-DCDRNCDDIEIFSEPVRQ---LQDNSREK 703

>Kwal_56.23134
          Length = 1066

 Score = 26.9 bits (58), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 64  EDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEALHDEL 106
           EDGE  ++N G  D +    S+ +NELVL  ++++ E   +E+
Sbjct: 648 EDGEPFEDNFGIIDRKSKIGSLFDNELVLCKAKDQAECEKNEV 690

>AFR211C [3403] [Homologous to ScYLR027C (AAT2) - SH]
           (812677..813936) [1260 bp, 419 aa]
          Length = 419

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 20/31 (64%)

Query: 13  VANFKIAIRDMGDDELGRVKQEVENSIRHLT 43
           V++ +I+I  + D  +G V   ++N++RH +
Sbjct: 385 VSSGRISIAGLNDSNVGHVANAIDNAVRHFS 415

>Kwal_55.19808
          Length = 825

 Score = 26.9 bits (58), Expect = 8.1,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 27  ELGRVKQEVENSIRHLTRSNERLHRYIKKLQG-HAVELEDGEEMDENLGSDDIELFQESI 85
           EL  +  +V +     T  NER  R  ++L+  + ++     +M    GS   EL Q   
Sbjct: 596 ELANLSNQVGSLTNQATLVNERKARAQQELKRINDLKSSIETKMVSLRGSYQSELKQ--T 653

Query: 86  RENELVLDNSRERLEALHDELAYRKAQHPDGKSNPEGSLAERKLSAIDMDNTN 138
            E E +L  SR+++E L  ELA  +A +       +GSLAE +    + + TN
Sbjct: 654 EEIEALLSQSRQQVEELKRELAIAEANY----HAVQGSLAETQHQLEESEQTN 702

>KLLA0C03608g 330900..331577 similar to sgd|S0002894 Saccharomyces
           cerevisiae YDR486c, hypothetical start
          Length = 225

 Score = 26.6 bits (57), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 11/62 (17%)

Query: 82  QESIRENELVLDNSRERLEALHDELAYRKAQHPDGKSNPEGSLAERKLSAIDMDNTNVDV 141
           Q+ +R+  L L N R++LEA+ D+L        D +S    S+++ +++  ++ NT V V
Sbjct: 65  QKPLRQRALKLLNKRKQLEAMRDQL--------DSQS---WSMSQVQMTTDNLKNTMVTV 113

Query: 142 AA 143
            A
Sbjct: 114 NA 115

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.130    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,044,170
Number of extensions: 220274
Number of successful extensions: 1102
Number of sequences better than 10.0: 162
Number of HSP's gapped: 1084
Number of HSP's successfully gapped: 171
Length of query: 147
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 55
Effective length of database: 13,411,253
Effective search space: 737618915
Effective search space used: 737618915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 56 (26.2 bits)