Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10340g59258329050.0
Scas_613.146285949251e-117
Scas_669.146906228611e-107
Kwal_23.34646686298481e-105
ADL285C6445968131e-100
YDL109C6476408021e-98
YGL144C (ROG1)6855918033e-98
CAGL0E04950g6735867911e-96
KLLA0E14872g6775967474e-90
YDR444W6874054674e-50
KLLA0B01375g6404124331e-45
Kwal_47.184826234054055e-42
AER322C6363984055e-42
CAGL0M10043g6584083853e-39
Scas_717.506583973694e-37
Kwal_27.101022582091553e-11
AFR386C5041981569e-11
KLLA0F16709g5311991532e-10
CAGL0L10318g4571351504e-10
Sklu_2393.45462051488e-10
Kwal_55.217034412051399e-09
KLLA0F16423g4592091221e-06
ADR202C4431661202e-06
YOR059C4502211175e-06
Sklu_2232.44451301103e-05
Scas_698.394711291076e-05
Sklu_2382.6173042711.9
ACL053C118130702.4
KLLA0F05071g172042675.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10340g
         (583 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces...  1123   0.0  
Scas_613.14                                                           360   e-117
Scas_669.14                                                           336   e-107
Kwal_23.3464                                                          331   e-105
ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH] (2...   317   e-100
YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein ...   313   1e-98
YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of...   313   3e-98
CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces c...   309   1e-96
KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces...   292   4e-90
YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unkn...   184   4e-50
KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyce...   171   1e-45
Kwal_47.18482                                                         160   5e-42
AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)...   160   5e-42
CAGL0M10043g complement(999113..1001089) similar to tr|Q04093 Sa...   152   3e-39
Scas_717.50                                                           146   4e-37
Kwal_27.10102                                                          64   3e-11
AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp...    65   9e-11
KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF134...    64   2e-10
CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448 S...    62   4e-10
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                62   8e-10
Kwal_55.21703                                                          58   9e-09
KLLA0F16423g complement(1516717..1518096) similar to sgd|S000558...    52   1e-06
ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)...    51   2e-06
YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protei...    50   5e-06
Sklu_2232.4 YOR059C, Contig c2232 3289-4626                            47   3e-05
Scas_698.39                                                            46   6e-05
Sklu_2382.6 YDL140C, Contig c2382 11462-16654                          32   1.9  
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    32   2.4  
KLLA0F05071g complement(496371..501533) gi|4096110|gb|AAC99803.1...    30   5.8  

>CAGL0H10340g 1007564..1009342 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 592

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/583 (93%), Positives = 544/583 (93%)

Query: 1   MIHVRGALAIGETSRFLIEVNSNIDGPVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIP 60
           MIHVRGALAIGETSRFLIEVNSNIDGPVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIP
Sbjct: 1   MIHVRGALAIGETSRFLIEVNSNIDGPVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIP 60

Query: 61  ANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEVLFNQITKVDYELLI 120
           ANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEVLFNQITKVDYELLI
Sbjct: 61  ANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEVLFNQITKVDYELLI 120

Query: 121 SLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVT 180
           SLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVT
Sbjct: 121 SLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVT 180

Query: 181 HGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGIKNLGIRLANYIVKE 240
           HGMISNVSNDMMYIMEQ                GYTGNVCRTELGIKNLGIRLANYIVKE
Sbjct: 181 HGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGNVCRTELGIKNLGIRLANYIVKE 240

Query: 241 RYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSHIGN 300
           RYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSHIGN
Sbjct: 241 RYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSHIGN 300

Query: 301 YTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDG 360
           YTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDG
Sbjct: 301 YTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDG 360

Query: 361 IVPXXXXXXXXXXXXXXXXXXXXXXXETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIF 420
           IVP                       ETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIF
Sbjct: 361 IVPLASSALLYLDYSKILKDSKLLKKETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIF 420

Query: 421 RRVSLTNTVGNLVLPEPPKNITSDMKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDRHQ 480
           RRVSLTNTVGNLVLPEPPKNITSDMKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDRHQ
Sbjct: 421 RRVSLTNTVGNLVLPEPPKNITSDMKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDRHQ 480

Query: 481 LQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCD 540
           LQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCD
Sbjct: 481 LQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCD 540

Query: 541 VPEADIVSQPASRDEADMEPNKTYAWLLKEDKEKGGLIRRATN 583
           VPEADIVSQPASRDEADMEPNKTYAWLLKEDKEKGGLIRRATN
Sbjct: 541 VPEADIVSQPASRDEADMEPNKTYAWLLKEDKEKGGLIRRATN 583

>Scas_613.14
          Length = 628

 Score =  360 bits (925), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/594 (38%), Positives = 325/594 (54%), Gaps = 71/594 (11%)

Query: 27  PVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIPANQNEYV-----PQFKANIEPQGKFT 81
           P+ + ++N+ + + +A YL+GPF LYCD R     ++   V     PQF +N++P  KF 
Sbjct: 46  PLKLTIKNKVRKSFKAAYLMGPFTLYCDVRAQSYHHKQRIVSSKDVPQFISNLQPHSKFI 105

Query: 82  FQLKPEDARDVGGKRCWIIDVVSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIE 141
            +L      ++  K  WIIDV+S+ +F+  +   +EL +    NN+      +   E++ 
Sbjct: 106 AEL---SLHEIKKKYVWIIDVISQSIFSLNSVTSFELTLGTTTNNYNSGSSLE--VETLS 160

Query: 142 GDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXX 201
            DV+  +             A I   +   +  HLVI+THGM SNV+ DM Y+MEQ    
Sbjct: 161 TDVIWNE------------KATIPLLRESRKMIHLVILTHGMHSNVTADMSYLMEQIYNT 208

Query: 202 XXXXXXXXXXXXGYTGNVCRTELGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQ 261
                       GY GNVC+TE+GIK LG  LA YI+   Y+  + KISFIGHSLGGL+Q
Sbjct: 209 QSLYSNEKIVVKGYVGNVCKTEMGIKFLGEGLAKYIIDTLYSVEVAKISFIGHSLGGLIQ 268

Query: 262 TFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYH 321
           +FAI+ I +LH WFF+ VKPVNFI+LATPFLG+ +   +Y K LLS+G +G+TG DL   
Sbjct: 269 SFAISSIAVLHPWFFEKVKPVNFITLATPFLGIVTDNPSYVKMLLSAGIIGKTGVDLGLK 328

Query: 322 SHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXX 381
            H      +ILYLLSG+P  SI++KFERRTLYANA+NDGIVP                  
Sbjct: 329 EHYD----NILYLLSGEPIKSIMKKFERRTLYANAMNDGIVP-------LYTSCLLFLDY 377

Query: 382 XXXXXETDDI-RSIVMTWKEFQDS-EDFKVYKKVNPKSKIFR------------RVSLTN 427
                E D++ RSI +T    +   E  K+    +  SK+F+            + S+  
Sbjct: 378 ADVLSELDNLKRSIKITIDTPESGRESEKIINTSSSWSKVFKHRKEDKHSVKLPKTSIIE 437

Query: 428 TVGNLVLPEPP-----KNITSDMKVLIHDQVYQYNDIP--DSEYFPPDGIDEIMA--MDR 478
           ++ +++ P  P      N +S  KV+IHD+VY  +DI   +S ++     D +++    R
Sbjct: 438 SMASILQPPSPTDEYITNPSSRAKVIIHDKVYTEDDIERIESNFYKLKN-DRLLSRFYRR 496

Query: 479 H-------QLQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILN 531
           H       +L+  +A+RWH+G  WRKVIV L  +AHN+I VRRR+SN  GW VI H+I N
Sbjct: 497 HSTGKQNERLEVEIAKRWHSGTPWRKVIVALGSEAHNNIIVRRRFSNGYGWEVIDHLIEN 556

Query: 532 HFIKPQKCDVPEADIVSQPASRDEADMEPNKTYAWLLK-ED--KEKGGLIRRAT 582
           HF       V      ++  +  +A MEPNK ++W+ K ED     GGL+ R T
Sbjct: 557 HFNGSDSLLVHN----NEEQAVMKATMEPNKEFSWITKVEDPCSYSGGLLSRTT 606

>Scas_669.14
          Length = 690

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 219/622 (35%), Positives = 329/622 (52%), Gaps = 69/622 (11%)

Query: 5   RGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVLYCDS 55
           +  L   +  R++I        E+ S+I   P+++R++N    + RA YL+GPF+LYCD 
Sbjct: 9   KSTLGAAQQDRYIITYNLYDTEEIPSDIKLDPLYLRIKNIEPISYRAAYLMGPFILYCDV 68

Query: 56  R-PVIPANQNEYV----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEVLFNQ 110
           R      +Q  Y     PQF++N+ P     + L       +  +  WI+DVVS++LF  
Sbjct: 69  RLETYHHSQRIYSTCDQPQFESNLLPSQDAIWSLS---LHQIQKRYVWIVDVVSQILFTT 125

Query: 111 ITKVDYELLISLDINNFKKSKYQQDIYESIEGD-VVAKQYSNHDIQEFIEVGAKIKKSQT 169
            T + YE+     +   K+S +     E +  D +V  + +  D+ +   +  ++  S  
Sbjct: 126 NTDITYEI----SMGYTKESLHHSINNERLGSDRLVVTKLNTLDLWK---LPVQLAPSDR 178

Query: 170 KERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGIKNL 229
           + R +HLVI+THG+ SN++ DM YIMEQ                GY GN+C+TE G+K L
Sbjct: 179 RRRRKHLVILTHGLHSNLTVDMEYIMEQIYKSQDNYPNEQIVVDGYPGNICQTERGVKYL 238

Query: 230 GIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLAT 289
           G RLA YIV E Y+ +I KISFIGHSLGGLVQTFAIAYI + + WFF  V+P+NFI++A+
Sbjct: 239 GERLAKYIVNELYDASIVKISFIGHSLGGLVQTFAIAYINVKYPWFFQKVQPINFIAMAS 298

Query: 290 PFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFER 349
           P LG+ +    Y K LLS G +G+TG+DL     ++  +  +LYLL G+P  S+L KF+R
Sbjct: 299 PLLGIVTDNPAYVKLLLSFGVIGKTGQDLGLDRVSE-TDRPLLYLLPGEPTRSVLLKFKR 357

Query: 350 RTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXE--TDDIRSIVMTWKEFQDSEDF 407
           RTLYANAINDGIVP                       E    D +++ +       +++F
Sbjct: 358 RTLYANAINDGIVPLYTASLLFLDYDDILEQLHKNEDEELAKDEQNVTIPENTASFNKNF 417

Query: 408 KVYKKVNPKSKIFR----------------RVSLTNTVGNLVLPEPPK-----NITSDMK 446
                ++P +K+                  +VS+  +  +++LP  P      N  +   
Sbjct: 418 -----ISPLTKMLSIWAPQKFPQGPDSKLPKVSMLQSATSILLPPLPDQEYLLNPKARHP 472

Query: 447 VLIHDQVYQYNDIP-----------DSEYFPPDGIDEIMA-MDRHQ-LQECMARRWHAGK 493
           V+IHD+ Y   D+P           +SE        +I A   R+Q L+E +ARRWH G 
Sbjct: 473 VIIHDKTYTQEDLPKGDTELEDTFFNSENMLLQAFTDIKAGRKRYQKLEESIARRWHEGM 532

Query: 494 SWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADI-VSQPAS 552
           SWRKV+V L+ DAHN+I VRRR++N+ GW VI H+I  HF    + +  +    +  P  
Sbjct: 533 SWRKVVVALKPDAHNNIIVRRRFANAYGWNVIDHLIGVHFNGDDRLEEEQTKAGLEAPLP 592

Query: 553 RDEAD-MEPNKTYAWLLKEDKE 573
            D++  +EP   YAW+ K + E
Sbjct: 593 NDQSSVIEPIDEYAWVTKAESE 614

>Kwal_23.3464
          Length = 668

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 209/629 (33%), Positives = 316/629 (50%), Gaps = 85/629 (13%)

Query: 3   HVRGALAIGETSRFLIEVNSNID----------GPVFVRLRNRTKATRRATYLLGPFVLY 52
           H + ++ +GE  R++I      D            +++++RN    T RA YL+GP++LY
Sbjct: 9   HAKSSVKVGEMERYIISYQLYDDDEGLPADLNLNSLWLKVRNIESFTFRAAYLMGPYLLY 68

Query: 53  CDSRP---------VIPANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVV 103
           CD R           + A+Q    P F+  ++PQ  F  +L   + +       W++DVV
Sbjct: 69  CDVRASDYHHSQRLFVSADQ----PTFEPTLQPQQDFITELSLHNLKKT---YVWVVDVV 121

Query: 104 SEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAK 163
           S+++F   T+V +E+ +        KS     +  S+E  +   + ++ D+         
Sbjct: 122 SQIIFTTTTQVGFEVSVGTSRKCLAKSSEFSPVSGSLESKLNVTRLTSLDLWNL-----P 176

Query: 164 IKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTE 223
           ++ S    + +HLVI+THG+ SNV  DM Y+ EQ                G+ GNVC+TE
Sbjct: 177 VQLSTHTHQKEHLVILTHGLHSNVHADMFYLKEQIEKCQKYYPEEQIVVKGFNGNVCKTE 236

Query: 224 LGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVN 283
            GI  LG RLA YIVKE Y+  +KKISFIGHSLGGLVQTFAIAYI++ + WFF  V P+N
Sbjct: 237 KGINYLGTRLAEYIVKELYHERVKKISFIGHSLGGLVQTFAIAYIHVKYPWFFQNVSPIN 296

Query: 284 FISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSI 343
           FI+LATP LG+ +    Y   LLS G +G+TG+DL     +K     +LYLL G P  ++
Sbjct: 297 FITLATPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLTELSK-DGKPLLYLLPGKPTKTV 355

Query: 344 LQKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXETDDIRSIVMTWKEFQD 403
           L+ F+RRT+YANA+NDGIVP                       + +D+   + T  E ++
Sbjct: 356 LRMFKRRTIYANAVNDGIVP--------------LYSASLLFLDYEDVLGQLKTKPELRE 401

Query: 404 ------SEDFKVYKKVNPKSKIFR----------------RVSLTNTVGNLVLPEPPK-- 439
                 S DF     ++P SK                   +VS+  +  ++++P  P+  
Sbjct: 402 RLSSNTSSDFISRNFLSPISKAISFWAPQKFPDDGSLKIPKVSVIESATSVLIPPLPEKT 461

Query: 440 ---NITSDMKVLIHDQVYQYNDIPDSEYFPPDGIDE-----------IMAMDRHQLQECM 485
              N +S   ++IHD++Y   ++P  E      + E               D  +L+E +
Sbjct: 462 YIMNPSSRENIIIHDKIYCDQEVPPRESQSEKELLESNNTLLKAFTRSSGKDNRRLEEEI 521

Query: 486 ARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEAD 545
           ARRWH G SWRKV+V L+ DAHN+I VRRR+SN+ GW V+ H+  NHF            
Sbjct: 522 ARRWHEGISWRKVVVGLKPDAHNNIIVRRRFSNAYGWPVVDHLTQNHFNSMDDESEEMDS 581

Query: 546 IVSQPASRDEADMEPNKT-YAWLLKEDKE 573
           +V+     D+   E +K   +W+    KE
Sbjct: 582 MVTNSVKSDQTSPEDHKEDRSWMFDNGKE 610

>ADL285C [1456] [Homologous to ScYGL144C - SH; ScYDL109C - SH]
           (201714..203648) [1935 bp, 644 aa]
          Length = 644

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/596 (34%), Positives = 315/596 (52%), Gaps = 70/596 (11%)

Query: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51
           + H R ++ IGE  R++I        E+   I    ++++++N +  T RA YL+GP++L
Sbjct: 10  LYHYRSSVRIGEVERYVITYDLYDEEELPERIQLSSLWLKVKNVSSLTYRAAYLMGPYML 69

Query: 52  YCDSRPVIPANQNEY-----VPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106
           YCD R     +  +      +PQF+  ++PQ +F  +L       +  +  W++DVVS++
Sbjct: 70  YCDLRTEDYHHSQKLFSSADMPQFEPAMQPQHEFLAELS---LHRLQKRYVWLLDVVSQI 126

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKK 166
           +F   + V +E+ I+      + +        S    +   + +  D+    +   ++  
Sbjct: 127 IFTTNSVVPFEVTIASAKPALEDTATLAPQAGSFNRRLTVNRQTTLDLWNLPQ---QVFD 183

Query: 167 SQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGI 226
             TK   +HLV++THG+ SNV+ DM Y+ E                 G+  NVC+TE GI
Sbjct: 184 DYTKP--EHLVVLTHGLHSNVTADMQYLKETIEQCQQYYPNEHIVVKGFGDNVCKTEKGI 241

Query: 227 KNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFIS 286
           K LG RL  YIVK+ YN  IK+ISFIGHSLGGL QTFAIAYI I + WFF+ V PVNF++
Sbjct: 242 KYLGGRLGEYIVKQLYNERIKRISFIGHSLGGLTQTFAIAYIAINYPWFFEKVDPVNFVA 301

Query: 287 LATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQK 346
           L++P LG+ ++   Y   LLS G +G+TG+DL   +H    +  +L  L G     IL+K
Sbjct: 302 LSSPLLGIVTNNPAYVNILLSMGVVGKTGQDLGLQAHQG-DDQPLLCSLPGHTTRRILRK 360

Query: 347 FERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXETDDIRSIV--MTWKEFQ-D 403
           F++RTLYANA+NDGIVP                          D  SI+  +  +E+Q D
Sbjct: 361 FKKRTLYANAVNDGIVPLYTSALLYL-----------------DYDSILKQLDTQEYQVD 403

Query: 404 SEDFKVYKKVNP-------------KSKIFRRVSLTNTVGNLVLPEPPK-----NITSDM 445
            +DF     +NP              S    +VS+ ++  +++LP  P+     N + D 
Sbjct: 404 KQDFFTKTLINPLVKAINVLMPQTQSSSSIPKVSMFDSAMSVLLPPLPEKSYLMNPSGDP 463

Query: 446 KVLIHDQVYQYNDIPDSEYFPPDGIDEIMAM------DRHQLQECMARRWHAGKSWRKVI 499
            V++HD++Y   DIP+    P   I   + +      +  QL+E +A++WH G +WRKVI
Sbjct: 464 SVILHDKMYSEADIPEVGQPPEKNIWSSLLLNIGNNEEYKQLEEEIAKKWHKGMTWRKVI 523

Query: 500 VCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQPASRDE 555
           V L+ DAHN+I VRRR++N+ GW VI H++ NHF      D P  +  ++ A+ DE
Sbjct: 524 VHLKPDAHNNIIVRRRFANAYGWPVIDHLVQNHF---NGSDYPYTEGETEEAALDE 576

>YDL109C (YDL109C) [760] chr4 complement(265258..267201) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Rog1p [1944 bp, 647 aa]
          Length = 647

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 218/640 (34%), Positives = 323/640 (50%), Gaps = 76/640 (11%)

Query: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51
           + H + ++ +GE  R++I         + ++I    ++V+++N TK + +  YLLGPF+L
Sbjct: 11  LYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVKIKNTTKLSYKPAYLLGPFIL 70

Query: 52  YCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106
           YCD R     +  + +     P F++N++ Q KF  +L       +  +  WI+D+VS++
Sbjct: 71  YCDVRAKDYESSYKIICSADKPVFQSNLQAQQKFIAEL---SLHHIKPRYVWIVDIVSQI 127

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQ--EFIEVGAKI 164
           LFN+ TKV +E+++     + K+     D       +++    S H +   +  +V   I
Sbjct: 128 LFNKETKVTFEIVVGNSKASLKRKIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRPI 187

Query: 165 KKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTEL 224
             SQ      HLVI+THG  SNVS DM Y+ME+                GY  N C TE 
Sbjct: 188 DMSQ----KSHLVILTHGFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEK 243

Query: 225 GIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNF 284
           GIK LG+ LANYI+ E Y+ ++ KISFIGHSLGGL QTFAI YI   + +FF  V+P+NF
Sbjct: 244 GIKFLGVGLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEPINF 303

Query: 285 ISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSIL 344
           ISLA+P LG+ +   NY K  LS G +G TG++L     N   +  +LYLLS +   S+L
Sbjct: 304 ISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGN-YGDKPLLYLLSEESLISVL 362

Query: 345 QKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXX------------------ 386
            +F+RRTLYANA+NDGIVP                                         
Sbjct: 363 ARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLGGQTTAPCDPLFQPEVSPIGELP 422

Query: 387 -----ETDDIRSIVMTWKEFQDSEDFKVYKKVNPKSKIFRRVSLTNTVGNLVL-PEPPKN 440
                  DD      +W  F  S++       + KSK     S+  ++ +++L P P   
Sbjct: 423 NHSDVANDDDGINASSWNTFWKSKE----NNCDKKSKRLMNASVIKSMKSVLLSPCPDAK 478

Query: 441 ITSD----MKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAMD-------RHQLQECMARRW 489
             SD    +  +IHD++Y   ++P     P   + E  A         R +++E +ARRW
Sbjct: 479 FFSDPDARVATIIHDKIYTEKNLPP----PSPTLYEGTAAKEGETRKTRKEMEEIIARRW 534

Query: 490 HAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQ 549
           H G  WRKV+V L+ DAHN+I VRRR+SN+ GW V+ H++  HF +      P  D   Q
Sbjct: 535 HKGMHWRKVVVLLKPDAHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQD--KQ 592

Query: 550 PASRD----EADMEPNKTYAWLLK-EDKE--KGGLIRRAT 582
            A  D       +EPNK Y+WL K ED     GG++  A+
Sbjct: 593 FAEEDINMATGGVEPNKFYSWLTKIEDPSVYHGGIVSTAS 632

>YGL144C (ROG1) [1843] chr7 complement(232453..234510) Protein of
           unknown function, has high similarity to uncharacterized
           S. cerevisiae Ydl109p [2058 bp, 685 aa]
          Length = 685

 Score =  313 bits (803), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 195/591 (32%), Positives = 307/591 (51%), Gaps = 80/591 (13%)

Query: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51
           + H + ++ +GE  R++I        E+  +++   +++++RN    + RA YL+GPF+L
Sbjct: 10  LFHYKSSVKVGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYRAAYLMGPFML 69

Query: 52  YCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSEV 106
           YCD +     +  + V     P+F+ N++ Q  F  +L   + R    K  WI DV+S++
Sbjct: 70  YCDVKTAQYHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQ---KYVWIADVMSQI 126

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEF-IEVGAKIK 165
           LF   T V YE+ I     + +          S    +   + +  D+    +++     
Sbjct: 127 LFTTNTNVTYEVTIGTSKESVENPHDLPSHLGSYSPKLTVNRLTTLDLWNLPVQI----- 181

Query: 166 KSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELG 225
              T ++ +HLV++THG+ SNVS D++YIMEQ                GY GNVC+TE G
Sbjct: 182 --TTPQKKKHLVVLTHGLHSNVSTDLVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKG 239

Query: 226 IKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFI 285
           +K LG RLA YI+++ Y+ +I+KISF+GHSLGGL+Q FAIAYIY ++ WFF  V P+NFI
Sbjct: 240 VKYLGTRLAEYIIQDLYDESIRKISFVGHSLGGLIQAFAIAYIYEVYPWFFKKVNPINFI 299

Query: 286 SLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAH---- 341
           +LA+P LG+ +    Y K LLS G +G+TG+DL   +  ++          G P      
Sbjct: 300 TLASPLLGIVTDNPAYIKVLLSFGVIGKTGQDLGLENDVEV----------GKPLLYLLS 349

Query: 342 -----SILQKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXETDDIRSIVM 396
                 IL++F+RRT+YANAINDGIVP                        +   +S ++
Sbjct: 350 GLPLIEILRRFKRRTVYANAINDGIVPLYTASLLFLDYNDILEQLQKLKENSK--KSPLI 407

Query: 397 TWKEFQDSEDFKVYKKVNPKSKIFR----------------RVSLTNTVGNLVLPEPPK- 439
                  ++DF     ++P +K+                  +VS   +  +++LP  P+ 
Sbjct: 408 NDASTPVNQDFFNKTFISPLTKMLSILAPQKFPTENGSEIPKVSFFESASSILLPPLPER 467

Query: 440 ----NITSDMKVLIHDQVYQYNDIPDSEYFPPDG--------IDEIMAMDRHQ-----LQ 482
               +  S   V+IHD++Y  +DIP SE+   DG        +    A  + +     L+
Sbjct: 468 AYIMDPDSRDPVIIHDKIYNEDDIPQSEFDIEDGFFGKKNILLQAFFAGKKERAKYRNLE 527

Query: 483 ECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533
           E +ARRWH G +WRKV+V L+ DAHN+I VRR+++N+ GW VI H+I  HF
Sbjct: 528 ETIARRWHEGMAWRKVVVALKPDAHNNIIVRRKFANAYGWPVIDHLIDVHF 578

>CAGL0E04950g 478626..480647 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c or tr|Q12103 Saccharomyces cerevisiae
           YDL109c, hypothetical start
          Length = 673

 Score =  309 bits (791), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 203/586 (34%), Positives = 307/586 (52%), Gaps = 70/586 (11%)

Query: 1   MIHVRGALAIGETSRFLIEV----------NSNIDGPVFVRLRNRTKATRRATYLLGPFV 50
           + H R ++ +GE  R+LIE           +  +D  ++VRL+N +  + RA YL GPF+
Sbjct: 11  LYHYRSSVKVGEIERYLIEYILYEDDEIPDDLKLDS-LYVRLKNCSPLSFRAGYLAGPFI 69

Query: 51  LYCDSRPVIPANQNEYV-----PQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDVVSE 105
           LY D R     +    V     PQF+AN++ Q     +L      ++  K  WI+DVVS+
Sbjct: 70  LYGDVRSNNYHHSQHIVSSADYPQFEANLQAQQVKVMELS---LHNIQSKYVWILDVVSQ 126

Query: 106 VLFNQITKVDYELLISLDINNFKKSKYQQDI--YESIEGDVVAKQYSNHDIQEFIEVGAK 163
           +LF   T V +E+ + +D    +++   + +    S   +++  + +  D+ +       
Sbjct: 127 ILFTTNTNVPFEVTVGMDRKMLEENNEIECLPHLGSTSNNLIVSRLTTDDLWKLP----- 181

Query: 164 IKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTE 223
            ++   K+  +HLVI+THG+ SNVS D+ Y+ME+                GY  NVC TE
Sbjct: 182 -RELAPKKDIKHLVILTHGLHSNVSADLSYLMEEIYKSQANFPNEILIVDGYFDNVCETE 240

Query: 224 LGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVN 283
            G++ LG RLA+YI+   Y+ ++KKISF+GHSLGGLVQTFAI  +   + WFFD VKPVN
Sbjct: 241 KGVRYLGTRLADYIIDNLYDADVKKISFVGHSLGGLVQTFAIGNLAARYPWFFDKVKPVN 300

Query: 284 FISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSI 343
           FI++A+P LG+ +    Y   LLS G +G+TG+DL     +      +LY LSG+   SI
Sbjct: 301 FITIASPMLGIVTDNPAYINLLLSFGVVGRTGKDLNLDV-DLPDEKPLLYSLSGEFIRSI 359

Query: 344 LQKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXETDDIRSIVMTWKEFQD 403
           L+KFERRT+YANA+NDGIVP                       E ++ +S+         
Sbjct: 360 LRKFERRTIYANAVNDGIVP----LYTSGLLYLDYDAILKKLREKEENKSLSGP-NNITV 414

Query: 404 SEDFKVYKK--VNPKSKIFR---------------RVSLTNTVGNLVLPEPPK-----NI 441
           S++   + K  ++P +K+                 +VS   +  +++LP  P      N 
Sbjct: 415 SDNTAFFNKNFISPLTKMLSLWAPQKFPESDPKIPKVSFFQSAASILLPPLPDINFIVNP 474

Query: 442 TSDMKVLIHDQVYQYNDI------PDSEYFPPDGIDEIMAMDR--------HQLQECMAR 487
                ++IHD++Y   DI      PDS +F    I  + A+           +L++ +A 
Sbjct: 475 KHRNDIIIHDKIYTEEDIKDVEKDPDSSFFNNKNI-FLQALSTVTSEKTKYQELEKTIAI 533

Query: 488 RWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533
           RWH G SWRKVIV L+ DAHN+I VRRR+SN+ GW VI H+I  HF
Sbjct: 534 RWHKGLSWRKVIVALKPDAHNNIIVRRRFSNAYGWPVIDHLISEHF 579

>KLLA0E14872g 1326334..1328367 similar to sp|P53118 Saccharomyces
           cerevisiae YGL144c, start by similarity
          Length = 677

 Score =  292 bits (747), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 204/596 (34%), Positives = 298/596 (50%), Gaps = 92/596 (15%)

Query: 1   MIHVRGALAIGETSRFLI--------EVNSNID-GPVFVRLRNRTKATRRATYLLGPFVL 51
           M H + +L IGE  R++         E+ S++    ++++++N    T RA YL+GP+VL
Sbjct: 35  MYHFQSSLRIGELERYIFTYDLYMGDEIPSDLTLDSLWLKIKNIENVTLRAAYLMGPYVL 94

Query: 52  YCDSRP---------VIPANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDV 102
           Y D R           I A+Q    PQF++NI+PQ  F  +L      ++  +  WI+D+
Sbjct: 95  YADVRTKDYHHKQRLFISADQ----PQFESNIQPQQDFIAELS---LHNLKKRYVWIVDI 147

Query: 103 VSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEV-- 160
            S++LF +   +++ + +        K     D   +I+  V   Q S   +        
Sbjct: 148 ASQILFTKQASINFSITVG-----GSKESISVDSARNIQLGV---QSSRMKVDRLTTADL 199

Query: 161 --GAKIKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGN 218
              + + KS    R +HLVI+THG+ SNV++D+ YI EQ                G+T N
Sbjct: 200 WNASLLSKSVFGRRKEHLVILTHGLHSNVTSDLFYIKEQIEKTQNQHEEMLVVK-GFTDN 258

Query: 219 VCRTELGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDA 278
           VC+TE GIK LG RLA +IV   YN    KISFIGHSLGGLVQ+FAIAYI   +  FF+ 
Sbjct: 259 VCKTEKGIKWLGTRLAEHIVHNLYNDATVKISFIGHSLGGLVQSFAIAYISYNYPKFFEQ 318

Query: 279 VKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGD 338
           V+PVNFI++A+P LG+ S    Y +RLL+ G  G+TG+DL   ++N LK   +  L S  
Sbjct: 319 VEPVNFITMASPMLGIVSDNAVYIQRLLAMGIAGKTGQDLSLQTYNGLKQPLLQTLSSSS 378

Query: 339 PAHSILQKFERRTLYANAINDGIVPXXXXXXXXXXXXXXXXXXXXXXXETDDI-RSIVMT 397
               IL+ F+  T+YANA NDGIVP                       + DDI   + M 
Sbjct: 379 ALRRILKCFKSCTVYANACNDGIVP--------------LYTSALLFLDYDDILDKLNMN 424

Query: 398 WKEFQDSEDFKVYKKVNPKSKIF-----RRVS-----------LTNTVGNLVLPEPPKNI 441
            ++ Q   DF     ++P +K       +RVS           L +    L+ P P K+ 
Sbjct: 425 TEDLQ--TDFFQRNFISPLTKAMDILMPQRVSQNGTKIPVASMLDSAYSVLIPPLPDKSY 482

Query: 442 TSDMK----VLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR--------------HQLQE 483
            +D K    V++HD+VY   DIPD +    +   E+M                   +L+E
Sbjct: 483 ITDPKTRKDVVVHDKVYSGQDIPDHQ---SNSQLEVMNSSNVLLKTFNIAFGGQYKKLEE 539

Query: 484 CMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHFIKPQKC 539
            +AR WH    WRKVI+ L+ DAHN+I  RRR+SN+ GW V+ H+   HF+   K 
Sbjct: 540 QIARNWHKDVKWRKVIINLKPDAHNNIITRRRFSNAYGWPVVDHLTETHFLNDDKS 595

>YDR444W (YDR444W) [1264] chr4 (1350278..1352341) Protein of unknown
           function, has low similarity to C. albicans Orf6.7404p
           [2064 bp, 687 aa]
          Length = 687

 Score =  184 bits (467), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 134/405 (33%), Positives = 199/405 (49%), Gaps = 59/405 (14%)

Query: 1   MIHVRGALAIGETSRFLIEVNSNI-------DGPVFVRLRNRTKATRRATYLLGPFVLYC 53
           ++  R  L IGE  R+   VN ++          +F+R++N   A  R  YL GP+  Y 
Sbjct: 22  LVDERKRLRIGELYRYKFSVNKDVIKEQGLDVSHLFLRIKNEESALLRPLYLTGPYSFYI 81

Query: 54  DSRPVIPANQNEYVP-----QFKANIEPQGKFTFQLKPEDARDVGGKR--CWIIDVVSEV 106
           D RP    N+N   P      F  N++P  +F  ++   +   VG      W ID++S++
Sbjct: 82  DVRPH-NYNENRKFPGKEIIPFVENLKPDERFKVKILLNENSRVGDTSLYSWTIDIISQL 140

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKK 166
               I K+++   I       KKS     +++SIEG V  + +   D +   ++  K   
Sbjct: 141 AVTTIPKLEFSFRIGTTRKVVKKS---NGLFKSIEG-VSLEMW---DTETLWDLPPKFP- 192

Query: 167 SQTKERNQHLVIVTHGMISNVSNDMMYI---MEQXXXXXXXXXXXXXXXXGYTGNVCRTE 223
               E+  HLVI+THG+ SN+  DM+Y+   +E+                G+ GNV ++ 
Sbjct: 193 ----EKPVHLVIMTHGIFSNIGCDMLYMKDKIEEMTFPMDESINPNIIVRGFMGNVGKSG 248

Query: 224 LGIKNLGIRLANYIVK--ERYNTNIK--KISFIGHSLGGLVQTFAIAYIYILHGWFFDA- 278
            GI  LG+R+  Y+++  ++ N   K  +ISFIGHSLGG  Q+ A+ YI I    FFDA 
Sbjct: 249 HGIHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIKRPDFFDAV 308

Query: 279 --VKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLR----------------- 319
             VKPVNFI+LA+PF+G+      Y    L  GALG TG DL                  
Sbjct: 309 KGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDLNLKYTPLTSKDGLYADDE 368

Query: 320 -YHSHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
            Y  H+K     IL +L   PA  + + F+RRT+YAN ++DGIVP
Sbjct: 369 VYPEHSKY----ILEILPQAPAKKVFESFKRRTIYANVMDDGIVP 409

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 448 LIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR--HQLQECMARRWHAGKSWRKVIVCLEGD 505
           +IHD++Y   ++P   Y     + +++  +   +++QE +AR W    +WRKV+V ++ D
Sbjct: 556 VIHDKLYHPEELPPPHYENRPIVKKLIYPNESVNRIQERIAREWQETMTWRKVLVQIQPD 615

Query: 506 AHNSINVRRRYSNSCGWAVISHMILNHF 533
           +HN+I VRRR+ N  G+  + HM+ +HF
Sbjct: 616 SHNNIVVRRRFVNLYGYVAVEHMVEHHF 643

>KLLA0B01375g 110709..112631 similar to sgd|S0002852 Saccharomyces
           cerevisiae YDR444w, start by similarity
          Length = 640

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/412 (29%), Positives = 201/412 (48%), Gaps = 67/412 (16%)

Query: 1   MIHVRGALAIGETSRFLIEVNSN---------IDGPVFVRLRNRTKATRRATYLLGPFVL 51
           ++   G+L IG+ +R+ I V+ N          D  +++  +N+  A  R  ++ GP+ +
Sbjct: 20  LLRETGSLGIGDVNRYKIIVDKNKLLSDGIECTDDTLYLEFKNQESALLRPLWITGPYSI 79

Query: 52  YCDSRPVIPANQNEYVP---QFKANIEPQGKFTFQLKPEDARDVGGKRC--WIIDVVSEV 106
           Y +  P     + +++    +F ++++P   F  +L       V G  C  W ID++++ 
Sbjct: 80  YVEITPNNYDERKQFIGDGIEFMSDLKPDENFKAKLYLNSNARVDGTSCYAWKIDLIAQ- 138

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKK 166
            F  +T V    + +L    +K +K+ Q             +  N ++Q+    G KI K
Sbjct: 139 -FTVVTIVRLPFVFTL-ATTYKTAKHSQ-------------KDKNIEVQQ--TDGLKISK 181

Query: 167 SQTKE----------RNQHLVIVTHGMISNVSNDMMYI---MEQXXXXXXXXXXXXXXXX 213
             T++          +  HLVI+THG+ S++  DM+ +   +E+                
Sbjct: 182 LDTEQLWNLPPPFPDKPVHLVIITHGIFSSIGGDMLCLKDTIERASNFLPDDNNGNLVIR 241

Query: 214 GYTGNVCRTELGIKNLGIRLANYIV----KERYNTNIKKISFIGHSLGGLVQTFAIAYIY 269
           GY GNV ++  GI++LG +LA YI+    K +    + +ISF+GHSLGG VQ  AI YI 
Sbjct: 242 GYPGNVGKSHKGIRHLGFKLAEYIIDTIDKLQQQFTLTRISFVGHSLGGPVQAMAIHYIS 301

Query: 270 ILHGWFFD---AVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYH----- 321
           +     FD    + PVNF++ A+PFLG+   +  Y   +L  GALGQTG DL        
Sbjct: 302 VERPDIFDKTTGLTPVNFVAAASPFLGVIGDLPKYISIVLDIGALGQTGRDLTLKRSYFL 361

Query: 322 ----------SHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
                     SH+++K+  IL LL   PA  + Q+F+ RT+YAN   DGIVP
Sbjct: 362 PSKGIVNNDGSHDRIKSKPILELLPKHPALEVFQRFKCRTVYANVAFDGIVP 413

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 2/88 (2%)

Query: 448 LIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR--HQLQECMARRWHAGKSWRKVIVCLEGD 505
           +IHD+VY   ++PD  Y     + +I+  +   H  +E +AR W     WRKVIV L+ D
Sbjct: 546 IIHDKVYTPEELPDKHYKHKKLVKKIIYPNYSIHMKEERIARYWQETMDWRKVIVELQPD 605

Query: 506 AHNSINVRRRYSNSCGWAVISHMILNHF 533
           +HN+I VRRR+ NS GW V++H+   HF
Sbjct: 606 SHNNIIVRRRFVNSFGWIVVNHIADEHF 633

>Kwal_47.18482
          Length = 623

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 192/405 (47%), Gaps = 60/405 (14%)

Query: 1   MIHVRGALAIGETSRFLIEVNSNI-------DGPVFVRLRNRTKATRRATYLLGPFVLYC 53
           ++  R  L +GE  R+ + V+ ++           ++  +N   A  R  YL GP+  Y 
Sbjct: 11  LVDDRLKLGLGELVRYNVTVDRSLLDDHLSHITEFYLTFKNTESAFLRPIYLTGPYSFYV 70

Query: 54  DSRPVIPANQNEYVP-----QFKANIEPQGKF--TFQLKPEDARDVGGKRCWIIDVVSEV 106
           D   V P N +E +P     QF  +++P  ++    QL      +   +  W I+V+S++
Sbjct: 71  D---VQPCNYDERIPFNEKLQFCEDVKPNEEYRAVLQLNDNSRVEESERFVWQINVMSQL 127

Query: 107 LFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKK 166
              +I  + + L IS      K S+       SI+G  V +++  H +            
Sbjct: 128 SVTKIPVLGFRLCISCG----KSSEIPSSPVTSIKG-FVCEKWDTHGLWNL--------P 174

Query: 167 SQTKERNQHLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXX----XGYTGNVCRT 222
            +  +R  HLV++THG+ SNV  D++Y+ ++                    GY GN  R+
Sbjct: 175 PRFPDRPLHLVVLTHGIFSNVGCDLVYLKDRIEAAASVAGKDSKTSNLVVRGYMGNQGRS 234

Query: 223 ELGIKNLGIRLANYIV------KERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFF 276
             GIK  G+RLA +I+      KE Y+  ++ ISF+ HSLGG  Q  AI YI +     F
Sbjct: 235 SKGIKANGVRLAKFIIETVDDLKEEYD--LQYISFVAHSLGGPSQAMAIRYICLERPDIF 292

Query: 277 D---AVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYH------------ 321
           D    +KP+NFI+LA+P+LG+   +  +    L  G LGQTG DL  +            
Sbjct: 293 DPAKGLKPLNFITLASPYLGIAGEVPPFVTLALDVGVLGQTGADLNLNRTFFLSKDGIVR 352

Query: 322 SHNKLKNF---SILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
              KL ++    +L ++   P   ++Q+FE RT+YAN ++DGIVP
Sbjct: 353 KDEKLGSYRRKPLLEIIPSRPLTELIQRFENRTIYANILHDGIVP 397

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 62/90 (68%), Gaps = 2/90 (2%)

Query: 448 LIHDQVYQYNDIPDSEYFPPDGIDEIM-AMDR-HQLQECMARRWHAGKSWRKVIVCLEGD 505
           ++HD++Y  +++P + Y   D + +I+   DR +++QE +AR+W    +WRKV+V +E D
Sbjct: 528 IVHDKIYYPDELPPAHYRKRDVLKKIIYPNDRIYRVQERIARQWQETMNWRKVLVSIEPD 587

Query: 506 AHNSINVRRRYSNSCGWAVISHMILNHFIK 535
           +HN+I VRR++ N+ GW V+ H++  HF K
Sbjct: 588 SHNNIVVRRKFVNAFGWVVVDHLVKEHFGK 617

>AER322C [2823] [Homologous to ScYDR444W - SH] (1229579..1231489)
           [1911 bp, 636 aa]
          Length = 636

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 193/398 (48%), Gaps = 57/398 (14%)

Query: 7   ALAIGETSRFLIEVN-SNIDGP-----VFVRLRNRTKATRRATYLLGPFVLYCDSRPVIP 60
            ++ GE  R++I+V+ + +D       + +R++N      R  YL GP+ +Y + RP   
Sbjct: 31  GISQGEVFRYIIKVDKAQLDAKTKIEELVLRIKNVESPLLRPIYLTGPYSVYAEVRPY-- 88

Query: 61  ANQNEYVP------QFKANIEPQGKFTFQLKPEDARDV--GGKRCWIIDVVSEVLFNQIT 112
            N +E         QF ++++P   F+  LK      V       W  DV+S++ +    
Sbjct: 89  -NYDENTAFQGDDLQFISDLKPDEAFSATLKLNGDSQVLESTVYSWTADVLSQMTW---- 143

Query: 113 KVDYELLISLDINNFKK-----SKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKKS 167
            VD+ +L+ L I N +       K      E + G  V       +IQ+ + V  +    
Sbjct: 144 MVDHPILVRLSIGNTRSIGKAAMKTPARAVEPVSGFTV-------EIQDTMTVWNE--PP 194

Query: 168 QTKERNQHLVIVTHGMISNVSNDMMYI---MEQXXXXXXXXXXXXXXXXGYTGNVCRTEL 224
              ER  HLVIVTHG+ SN+  DM+Y+   +++                GY GN+ ++  
Sbjct: 195 LFPERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNIGKSHK 254

Query: 225 GIKNLGIRLANYIVKERYNTN----IKKISFIGHSLGGLVQTFAIAYIYILHGWFFD--- 277
           GI+ L +R+A+Y++K          + +ISFIGHSLGGLVQTFAI Y+       F    
Sbjct: 255 GIEYLAMRVADYVLKTIAQMPNEYFLDRISFIGHSLGGLVQTFAIQYMLERDPGIFSPQA 314

Query: 278 -AVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNF------- 329
             ++P+NFI+LA+PFLG+      Y    L+ GALG+TG+DL   +   +          
Sbjct: 315 GGLRPMNFIALASPFLGVIGDFPLYATVALNFGALGRTGKDLNLKNDFAISELVRNPKQA 374

Query: 330 ----SILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
                +L  +      S+LQ F  RTLYANA++DGIVP
Sbjct: 375 YNRRPVLESIVSGSMKSVLQAFSNRTLYANALHDGIVP 412

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 7/119 (5%)

Query: 422 RVSLTNTVGNLVLPEPP-----KNITSDMKVLIHDQVYQYNDIPDSEYFPPDGIDEIMAM 476
           + S  ++  N+++  PP     K+  S    + HD+ Y   ++P + Y   + + +I+  
Sbjct: 510 KASALSSAANILVAPPPTQDYYKDPQSRTDYIFHDKRYSPEELPPAYYRNRELLKKILYP 569

Query: 477 DR--HQLQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533
           +   H+ QE +AR +    SWRKV+V ++ ++HN+I VRRR+ NS GW VI H++  HF
Sbjct: 570 NDKVHRTQEKIARGYQESMSWRKVLVNIQPESHNNIIVRRRFVNSFGWIVIEHLVNEHF 628

>CAGL0M10043g complement(999113..1001089) similar to tr|Q04093
           Saccharomyces cerevisiae YDR444w, hypothetical start
          Length = 658

 Score =  152 bits (385), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 189/408 (46%), Gaps = 58/408 (14%)

Query: 1   MIHVRGALAIGETSRFLIEVN------SNIDG-PVFVRLRNRTKATRRATYLLGPFVLYC 53
           ++H + +L IG   R++++V+        ID   +++R +N      R  YL GP+  Y 
Sbjct: 9   LVHEKNSLGIGGMCRYILQVDHKKLKEDGIDTQELYLRFKNLESPLLRPVYLTGPYAFYI 68

Query: 54  DSRPVIPANQNEYVPQ----FKANIEPQGKFTFQL--------KPEDARDVGGKRCWIID 101
           D RP        Y+      F ++++P  KF  +L        + ++ARD      W ID
Sbjct: 69  DVRPCNYDEDKTYIGSEDVAFCSDLKPDEKFKAKLYFNANSRLQTKNARD--EIYSWTID 126

Query: 102 VVSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVG 161
           ++S++       + Y   +    +     K +     S+ G +  K +    +       
Sbjct: 127 IISQLAVVTFPILKYSFKVG--TSKKIVKKSKGKKVTSVRG-LSLKMWDEKSLWNL---- 179

Query: 162 AKIKKSQTKERNQHLVIVTHGMISNVSNDMMYI---MEQXXXXXXXXXXXXXXXXGYTGN 218
                 +  ++  HLVI+THG+ SNV  DM+Y+   +EQ                G   N
Sbjct: 180 ----PPKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEERYNPNVVVRGCMDN 235

Query: 219 VCRTELGIKNLGIRLANYIVKE----RYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGW 274
           + ++  GI  LG RLA ++V+     R   ++ KISFIGHSLGG  Q+ AI YI +++  
Sbjct: 236 MGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPTQSMAIHYISVMYPD 295

Query: 275 FFDAV---KPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGED--LRYHSHNKLKNF 329
           FF+ V   KP++FI+LA+PF+G+      Y    L  GALG TG D  L+Y      +  
Sbjct: 296 FFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGRDLNLKYTPLTSNEGL 355

Query: 330 S--------------ILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
           S              IL ++   PA  + Q F  RTLYAN ++DGIVP
Sbjct: 356 SALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHDGIVP 403

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 6/116 (5%)

Query: 424 SLTNTVGNLVLPEPPKNITSDMKV----LIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR- 478
           +  + +  L  P P +    + KV    ++HD+VY+  D+P+  Y     +  ++  +  
Sbjct: 523 TFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQHYLKRSTMKRVVYPNES 582

Query: 479 -HQLQECMARRWHAGKSWRKVIVCLEGDAHNSINVRRRYSNSCGWAVISHMILNHF 533
            +++QE +AR W    SWRKV+V ++ D+HN+I VRRR+ N  G   +SHM+  HF
Sbjct: 583 VNRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVREHF 638

>Scas_717.50
          Length = 658

 Score =  146 bits (369), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 114/397 (28%), Positives = 174/397 (43%), Gaps = 57/397 (14%)

Query: 8   LAIGETSRFLIEVNSN-------IDGPVFVRLRNRTKATRRATYLLGPFVLYCDSRPVIP 60
           L IG+ SR++I V+             +F+R++N      R  YL GP+  Y D RP   
Sbjct: 26  LGIGDLSRYIISVDKKKLEDSGICIEELFLRIKNEESPLLRPVYLTGPYTFYVDVRPHNY 85

Query: 61  ANQ-----NEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRC--WIIDVVSEVLFNQITK 113
                   +E +P F  +++P  +F  ++       V       W +D++S++       
Sbjct: 86  HEDEIFEGDEVIP-FCEHLKPDARFKTKIFLNKHSRVANTNTYSWTVDILSQLCVIPTPT 144

Query: 114 VDYELLISLDINNFK-----KSKYQQDIYESIEGDVVAKQYSNHDIQEFIEVGAKIKKSQ 168
           + Y   I+      K     K   + D +E        K      +  F          +
Sbjct: 145 LKYSFRIATTKKETKNGSKGKKPVKMDGFE-------VKLLDTSSLWSF--------PPK 189

Query: 169 TKERNQHLVIVTHGMISNVSNDMMYI---MEQXXXXXXXXXXXXXXXXGYTGNVCRTELG 225
              +  HLVI+THG+ SN+  DM+Y+   +E+                G   N+ ++  G
Sbjct: 190 YPNKPVHLVIMTHGIFSNIGCDMLYMKDKIEETANSVPEDINPNVVVRGCMKNMGKSAHG 249

Query: 226 IKNLGIRLANYIVKERYNTN----IKKISFIGHSLGGLVQTFAIAYIYILHGWFF---DA 278
           +  LG R+A YI++     N    + KISFIGHSLGG  Q  A+ YI +     F     
Sbjct: 250 VHYLGKRVAEYIIETVDELNKKYKVDKISFIGHSLGGPTQGMAVHYISVKRPDIFHPTKG 309

Query: 279 VKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYH------------SHNKL 326
           +KPVNFI+LA+PF+G+      Y    L +G+LG TG DL                 N  
Sbjct: 310 IKPVNFITLASPFIGVIGDFPLYVSLPLDAGSLGLTGRDLNLKYTPLTSKDGLTTDGNAA 369

Query: 327 KNFSILYLLSGDPAHSILQKFERRTLYANAINDGIVP 363
           K   IL ++   PA +I ++F  RTLYAN ++DGIVP
Sbjct: 370 KTKLILEIIPQPPALAIFERFVHRTLYANVVHDGIVP 406

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 447 VLIHDQVYQYNDIPDSEYFPPDGIDEIMAMDR--HQLQECMARRWHAGKSWRKVIVCLEG 504
            ++HD++Y   +IP + Y     I +++  +   ++ QE +AR+W    +WRKV+V ++ 
Sbjct: 558 AIVHDKIYTPKEIPRAHYANRPAIKKVIYPNESVNRTQERIARQWQMTMNWRKVLVKIKP 617

Query: 505 DAHNSINVRRRYSNSCGWAVISHMILNHF 533
           D+HN+I VRRR+ N  G   +SHM+  HF
Sbjct: 618 DSHNNIVVRRRFVNLYGDVAVSHMVEEHF 646

>Kwal_27.10102
          Length = 258

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 103/209 (49%), Gaps = 13/209 (6%)

Query: 163 KIKKSQTKERNQHLVIVTHGMISNVSN-DMMYIMEQXXXXXXXXXXXXXXXXGYTGNV-- 219
           ++++  T ++  HLV++ HG+  N S+ D M    +                 YT ++  
Sbjct: 3   ELERGSTGKKPCHLVVLVHGLWGNRSHLDYMSNALKESFESREDTCSKEELVVYTPHLNE 62

Query: 220 -CRTELGIKNLGIRLANYIVKERYNT-NIKKISFIGHSLGGLVQTFAIAYIYILHGWFFD 277
             +T  GI   G+R+A+ I ++  +  ++ K S  G+SLGGL+  +A+  ++    +   
Sbjct: 63  GYKTYDGIDVCGVRVASEIEEQIVSLGSVTKFSICGYSLGGLISRYALGVLHKRQLFKKR 122

Query: 278 AVKPVNFISLATPFLGLYSHIGNYTKRLLSS---GALGQTGEDLRYHSHNKLKNFSILYL 334
            ++ VNF +  TP +G+Y+   N   RL ++     LG +G+ +      K     +  +
Sbjct: 123 DIQLVNFTTFCTPHVGVYAPGKNVAVRLYNAIVPLVLGSSGKQMFLKDKPKFSG-ELPLI 181

Query: 335 LSGDPAHSI----LQKFERRTLYANAIND 359
           LS    +SI    LQ+F+ ++LYAN IND
Sbjct: 182 LSMSLENSIFYKALQEFQTKSLYANVIND 210

>AFR386C [3578] [Homologous to NOHBY] (1131324..1132838) [1515 bp,
           504 aa]
          Length = 504

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 90/198 (45%), Gaps = 14/198 (7%)

Query: 175 HLVIVTHGMISNVSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGIKNLGIRLA 234
           HLV + HG+  NV++ M Y+                          RT  GI   G R+A
Sbjct: 5   HLVFLVHGLWGNVTH-MEYLGRAVSQLQERSPETLVVYAAKMNQGYRTYDGIDICGYRVA 63

Query: 235 NYIVKERYNTN-------IKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISL 287
             I ++    N       + K S +G+S+GGL+  +A+  +Y    +    +K +NF + 
Sbjct: 64  KEIQEQVATLNCPETGTVVTKFSIVGYSMGGLISRYAVGLLYSNQFFKKQDIKLINFTTF 123

Query: 288 ATPFLGLYSHIGNYTKRLLS---SGALGQTGEDLRYHSHNKLKN-FSILYLLS-GDPA-H 341
            +P +G+ +   N   R+ +   S  LG +G  +      K  N   ++ L+S GD   +
Sbjct: 124 CSPHVGVLAPGKNLAVRVFNFVCSLILGNSGRQMFLKDRIKAANGMPLIVLMSVGDSIFY 183

Query: 342 SILQKFERRTLYANAIND 359
             L++F+ R+LYAN +ND
Sbjct: 184 KALEQFQHRSLYANIVND 201

>KLLA0F16709g 1539612..1541207 weakly similar to ca|CA1159|IPF13423
           Candida albicans unknown function, start by similarity
          Length = 531

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 95/199 (47%), Gaps = 17/199 (8%)

Query: 175 HLVIVTHGMISNVSN-----DMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGIKNL 229
           HLV++ HG+  N S+     + +  +                   +     +T  GI   
Sbjct: 16  HLVVLVHGLWGNRSHMNEICNYLLSLNDSSAGHKSLNEMIVVHQTHLNEGYKTYDGIDVC 75

Query: 230 GIRLANYIVKERYN----TNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFI 285
           GIR++  I K++ N     ++ K S IG+SLGGL+  +A+  +Y    +  + ++ VNFI
Sbjct: 76  GIRVSKEI-KDQINHYGSDHVVKFSLIGYSLGGLICRYALGVLYQAQTFKKNDIELVNFI 134

Query: 286 SLATPFLGLYSHIGNYTKRLLS---SGALGQTGEDLRYHSHNKLKNFSILYLLSGDPA-- 340
           +  TP +G+ +   N    L +      LG +G+ +     +K   + +LY++S   +  
Sbjct: 135 TFCTPHVGVLAPGNNVAVNLFNIIVPLVLGNSGKQMFL--KDKYNGYPLLYVMSSPSSVF 192

Query: 341 HSILQKFERRTLYANAIND 359
           +  L++F+ R LYAN IND
Sbjct: 193 YKALKQFKYRALYANIIND 211

>CAGL0L10318g complement(1103690..1105063) similar to tr|Q08448
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 457

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (51%), Gaps = 13/135 (9%)

Query: 237 IVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLATPFLGL-- 294
            +KE  + NI KISF+G+SLGGLV  F +  +Y      F  ++   F+++ATP LG+  
Sbjct: 74  FMKEFKDGNITKISFVGYSLGGLVARFVVGKMYSECNDIFGNIERCIFMTMATPHLGIQF 133

Query: 295 YSHIGNYTKRL-------LSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKF 347
           Y+ +G   ++L       L S  LG++G +L   + +      IL  LS       L++F
Sbjct: 134 YNPLGYLHRKLLFSTFTGLGSTILGKSGRELFIANSSN----DILVRLSEGKYIEALEEF 189

Query: 348 ERRTLYANAINDGIV 362
             R L+AN  ND  V
Sbjct: 190 NHRILFANVKNDRTV 204

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 99/205 (48%), Gaps = 18/205 (8%)

Query: 172 RNQHLVIVTHGMISN------VSNDMMYIMEQXXXXXXXXXXXXXXXXGYTGNV---CRT 222
           ++ HLV++ HG+  N      +SN +   ++                  YT  +    +T
Sbjct: 7   KDYHLVVLVHGLWGNGSHFDYISNSIDTSLKTHDVFQPGGKLAGEEIVVYTTCLNEGYKT 66

Query: 223 ELGIKNLGIRLANYIVKERYNT--NIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVK 280
             GI   G+R+A  I +++  T  ++ K S +G+SLGGL+  +A+  +Y    +    ++
Sbjct: 67  YDGIDVCGLRVAKEI-EDQIETLGSVIKFSLVGYSLGGLIARYALGILYKKQLFKKHDIE 125

Query: 281 PVNFISLATPFLGLYSHIGNYTKRLLSS---GALGQTGEDLRYHSH-NKLKNFSILYLLS 336
            +NF +  TP +G+Y+   N    L ++     LG +G+ +          N  ++YL+S
Sbjct: 126 LINFTTFCTPHVGVYAPGKNIAVNLFNTIVPFVLGNSGKQMFLKDQVRSAGNLPLVYLMS 185

Query: 337 GDPA--HSILQKFERRTLYANAIND 359
            + +  +  LQ+F+ + LYAN IND
Sbjct: 186 MENSVFYKALQEFKYKALYANVIND 210

>Kwal_55.21703
          Length = 441

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 89/205 (43%), Gaps = 23/205 (11%)

Query: 174 QHLVIVTHGMISNVS--NDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELGIKNLGI 231
           +HL ++ HG+  N    N +  +  +                GY     +T  GI+ +G 
Sbjct: 4   KHLFVLVHGLWGNYKHMNAIRDVFAETFHDHENTLFFSPRQNGYF----KTFDGIEIMGY 59

Query: 232 R----LANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISL 287
           R    L  +I ++     I KISF+G+S+GGL+  F I  ++      F  ++P  FI+ 
Sbjct: 60  RTLLELCRFI-EQFPKGEITKISFVGYSMGGLIARFMIGKMFTECHELFQCIEPQLFITF 118

Query: 288 ATPFLGLY--------SHIGNYTKRL--LSSGALGQTGEDLRYHSHNKLKNFSILYLLSG 337
           ATP LG++        SH     + L  L +  LG+TG  L     + L   SIL  LS 
Sbjct: 119 ATPHLGVHFFLKEDRASHRRALLRILSALGTTILGRTGRQL--FIQDSLPEQSILVQLSS 176

Query: 338 DPAHSILQKFERRTLYANAINDGIV 362
                 L +F+ R   AN  ND  V
Sbjct: 177 GEYLHGLARFKHRLCVANVKNDRTV 201

>KLLA0F16423g complement(1516717..1518096) similar to sgd|S0005585
           Saccharomyces cerevisiae YOR059c, start by similarity
          Length = 459

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 90/209 (43%), Gaps = 18/209 (8%)

Query: 168 QTKERNQHLVIVTHGMISNVS--NDMMYIMEQXXXXXXXXXXXXXXXXGYTGNVCRTELG 225
            T+ + +HL I+ HG+  N    N +  ++E+                GY     +T  G
Sbjct: 1   MTETKKKHLFILVHGLWGNHKHMNSIKEMLEKTLDDIDDIVIFKPENSGY----LKTLHG 56

Query: 226 IKNLGIRLANYIVKERYNTNIKK---ISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPV 282
           I+ +   + + I K   N   +K   +S IG+S+GGLV  F I  +       F  ++P+
Sbjct: 57  IRVVSYNVLDEICKFVLNYGPEKFDRVSMIGYSMGGLVSRFIIGKMVTECRDIFQHMEPM 116

Query: 283 NFISLATPFLGLYSHIGN-----YTKRLLSSGALGQTGEDLRYHSHNKL----KNFSILY 333
            F++ ATP LG+  ++ +     Y  R + +  L   G  +   S  ++    K+  IL 
Sbjct: 117 IFMTFATPHLGVNFYLPSDKTRRYVSRKILTSVLSGLGRTILGRSGAEIFISNKDDRILV 176

Query: 334 LLSGDPAHSILQKFERRTLYANAINDGIV 362
            LS       L +F  R  +AN  ND  V
Sbjct: 177 DLSQGEYLYGLSRFHHRVCFANVKNDRTV 205

>ADR202C [1943] [Homologous to ScYOR059C - SH] (1060157..1061488)
           [1332 bp, 443 aa]
          Length = 443

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 69/166 (41%), Gaps = 26/166 (15%)

Query: 219 VCRTELGIKNL-GIRLANY--------IVKERYNTNIKKISFIGHSLGGLVQTFAIAYIY 269
           V R+   +K L GI L  Y         V+ R      +ISFIG+S+GGLV  F I  I+
Sbjct: 40  VPRSNGYVKTLHGIELVGYQTVVELTEFVQARDPQKFDRISFIGYSMGGLVSRFVIGTIF 99

Query: 270 ILHGWFFDAVKPVNFISLATPFLGLYSH-----------IGNY--TKRLLSSGALGQTGE 316
                 F  ++PV F++ ATP LG+  +           +G      R + S  LG++G 
Sbjct: 100 TECRVIFGHMRPVLFMTFATPHLGVQFYQPRNPQAKSTVMGAVLPVARFVGSHFLGRSGR 159

Query: 317 DLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIV 362
            L     N       L  ++       L +F  R   AN  ND  V
Sbjct: 160 QLFLAYEND----DTLVRMTEGVYLEQLARFRHRVCLANVKNDRTV 201

>YOR059C (YOR059C) [4867] chr15 complement(438907..440259) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.7873p [1353 bp, 450 aa]
          Length = 450

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 94/221 (42%), Gaps = 53/221 (23%)

Query: 173 NQHLVIVTHGMISN-------------------VSNDMMYIMEQXXXXXXXXXXXXXXXX 213
           ++HL ++ HG+  N                   V++DM+Y + +                
Sbjct: 4   DKHLFVLIHGLWGNYTHMESMRTILSTTLKKEDVNDDMIYFLPKQNA------------- 50

Query: 214 GYTGNVCRTELGIKNLGIRLANYI---VKERYNTNIKKISFIGHSLGGLVQTFAIAYIYI 270
                + +T  GI+ +G R    +   +++  +  I K+S +G+S GGLV  F I  +  
Sbjct: 51  -----MFKTFDGIEIIGYRTLIEVCEFIRDYKDGKITKLSVMGYSQGGLVARFMIGKMLT 105

Query: 271 LHGWFFDAVKPVNFISLATPFLGL--YSHIGNYTK-------RLLSSGALGQTGEDLRYH 321
                F+ ++P  FI++ATP LG+  Y+  G   K       R L S  LG++G ++   
Sbjct: 106 EFKELFEDIEPQLFITMATPHLGVEFYNPTGIAYKSALYSALRTLGSTILGKSGREMFIA 165

Query: 322 SHNKLKNFSILYLLSGDPAHSILQKFERRTLYANAINDGIV 362
           + +     +IL  LS       L  F+ R  +AN  ND  V
Sbjct: 166 NSSN----NILVKLSQGEYLEALSLFKWRIAFANVKNDRTV 202

>Sklu_2232.4 YOR059C, Contig c2232 3289-4626
          Length = 445

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 246 IKKISFIGHSLGGLVQTFAIAYIYILHGWFFDAVKPVNFISLATPFLGLYSH------IG 299
           I KISFIG+S+GGL+  F I  +       F+ +    FI+ ATP LG+  +      + 
Sbjct: 76  ITKISFIGYSMGGLISRFIIGKMETECQELFEGINRQLFITFATPHLGVEFYLPKEKPLQ 135

Query: 300 NYTKR-------LLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTL 352
             ++R        L S  LG++G  L     +     S L  LS D     L  F+ R  
Sbjct: 136 TRSRRFLHSVLSFLGSTVLGRSGRQLFIRDKHSWD--STLVKLSSDEYLLGLSAFKYRIC 193

Query: 353 YANAINDGIV 362
            AN  ND  V
Sbjct: 194 IANVKNDRTV 203

>Scas_698.39
          Length = 471

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 20/129 (15%)

Query: 248 KISFIGHSLGGLVQTFAIAYIYILHG-----WFFDAVKPVNFISLATPFLGL--YSHIGN 300
           K+S +G+S+GGL+  F I  ++  +        F  ++P  FI+ ATP LG+  Y+ + N
Sbjct: 94  KLSILGYSMGGLIARFLIGVMFDKNNDEDEMKVFKGMEPQLFITFATPHLGIHFYNPLNN 153

Query: 301 YTK-------RLLSSGALGQTGEDLRYHSHNKLKNFSILYLLSGDPAHSILQKFERRTLY 353
             +        L+ S  +G +G ++       ++N  ++ L SG    + L KF+ R ++
Sbjct: 154 MLRTFLNPMLTLIGSNIIGVSGREMFI-----MRNTELVELSSGKYLDA-LSKFKWRIVF 207

Query: 354 ANAINDGIV 362
           AN  ND  V
Sbjct: 208 ANVKNDRTV 216

>Sklu_2382.6 YDL140C, Contig c2382 11462-16654
          Length = 1730

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 142 GDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVTHGM 183
           GD +A Q +  +I E I V  K  ++ TKE   +L+   HGM
Sbjct: 667 GDTIADQKTMREITEAIAVAKKKVENVTKEAQANLLTAKHGM 708

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 500 VCLEGDAHNSINVRRRYSNSCGWAVISHMI 529
           +CL  DA+  +N+ R+ SN C  ++IS+MI
Sbjct: 319 ICLGSDAYEKLNIDRQ-SNPCSGSLISYMI 347

>KLLA0F05071g complement(496371..501533) gi|4096110|gb|AAC99803.1
           Kluyveromyces lactis RNA polymerase II largest subunit,
           start by similarity
          Length = 1720

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 142 GDVVAKQYSNHDIQEFIEVGAKIKKSQTKERNQHLVIVTHGM 183
           GD +A + +  +I E I V  K  +  TKE   +L+   HGM
Sbjct: 667 GDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGM 708

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,414,997
Number of extensions: 791097
Number of successful extensions: 2162
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2121
Number of HSP's successfully gapped: 49
Length of query: 583
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 476
Effective length of database: 12,891,983
Effective search space: 6136583908
Effective search space used: 6136583908
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)