Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10252g30930416230.0
YBR061C (TRM7)31030813060.0
Scas_718.4630930712471e-174
KLLA0F18414g30130412141e-169
Sklu_2357.331530812071e-168
Kwal_27.1054330330411861e-165
AGR036W30631010921e-151
CAGL0B00484g8372194195e-46
Scas_642.128392194187e-46
Kwal_33.130548302194152e-45
YCL054W (SPB1)8412194152e-45
AFR734C8452204152e-45
Sklu_2421.108492194082e-44
KLLA0C00737g8332194039e-44
KLLA0B01980g2892542113e-19
CAGL0H08954g2812461832e-15
Kwal_56.241583071411622e-12
Sklu_2160.23151411585e-12
Scas_720.463211061578e-12
AFL117C3031421506e-11
YGL136C (MRM2)3201101339e-09
Scas_672.11750184710.77
Kwal_56.2317143860644.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10252g
         (304 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10252g complement(1002563..1003492) highly similar to sp|P...   629   0.0  
YBR061C (TRM7) [252] chr2 complement(364747..365679) Methyltrans...   507   0.0  
Scas_718.46                                                           484   e-174
KLLA0F18414g complement(1695869..1696774) similar to sp|P38238 S...   472   e-169
Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement        469   e-168
Kwal_27.10543                                                         461   e-165
AGR036W [4346] [Homologous to ScYBR061C - SH] complement(774279....   425   e-151
CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomy...   166   5e-46
Scas_642.12                                                           165   7e-46
Kwal_33.13054                                                         164   2e-45
YCL054W (SPB1) [493] chr3 (31449..33974) Putative S-adenosyl-met...   164   2e-45
AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH] (1785487..1...   164   2e-45
Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement     161   2e-44
KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces cer...   159   9e-44
KLLA0B01980g complement(173710..174579) similar to sp|P53123 Sac...    86   3e-19
CAGL0H08954g complement(875104..875949) similar to sp|P53123 Sac...    75   2e-15
Kwal_56.24158                                                          67   2e-12
Sklu_2160.2 YGL136C, Contig c2160 1404-2351                            65   5e-12
Scas_720.46                                                            65   8e-12
AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH] (218993..21...    62   6e-11
YGL136C (MRM2) [1851] chr7 complement(252900..253862) Methyltran...    56   9e-09
Scas_672.11                                                            32   0.77 
Kwal_56.23171                                                          29   4.7  

>CAGL0H10252g complement(1002563..1003492) highly similar to
           sp|P38238 Saccharomyces cerevisiae YBR061c, start by
           similarity
          Length = 309

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/304 (100%), Positives = 304/304 (100%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK
Sbjct: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ
Sbjct: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI
Sbjct: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300
           DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK
Sbjct: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300

Query: 301 RDGK 304
           RDGK
Sbjct: 301 RDGK 304

>YBR061C (TRM7) [252] chr2 complement(364747..365679)
           Methyltransferase that methylates 2-prime-O-riboses in
           tRNA anticodon loop, required for optimal protein
           synthesis activity, member of the 2-prime-O-RNA
           methyltransferase family which includes Spb1p, Mrm2p,
           and E. coli FtsJ protein [933 bp, 310 aa]
          Length = 310

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/308 (79%), Positives = 271/308 (87%), Gaps = 7/308 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+GYRARSA+KLLQLN++FHFLDDP LKRVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDQFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSRKLF E  P +D  ++DRKI++VDLQPMSPI HV TLQADITHP+TL RI +LFGN+K
Sbjct: 61  LSRKLFDE-SPSSD--KEDRKIVSVDLQPMSPIPHVTTLQADITHPKTLARILKLFGNEK 117

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEY+Q QLIMSALQLT C+LK+GGTFVAKIFRGRDIDMLYSQ
Sbjct: 118 ADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGTFVAKIFRGRDIDMLYSQ 177

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LGYLF+KIVCAKPRSSRGTSLEAFIVC+GYNPP+ W PKLDVN+SV EFF  C L KL I
Sbjct: 178 LGYLFDKIVCAKPRSSRGTSLEAFIVCLGYNPPSNWTPKLDVNTSVDEFFQGCFLNKLCI 237

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPK----YGVALDPVQAPTNPPYKRA 296
            D L  W ++ R+IA+FMACGSL S+DSDATYHDLP        +LDPVQ+PTNPPYK+A
Sbjct: 238 SDKLSHWNEEERNIAEFMACGSLQSFDSDATYHDLPSSVAGTSSSLDPVQSPTNPPYKKA 297

Query: 297 LELKRDGK 304
           LELKR GK
Sbjct: 298 LELKRSGK 305

>Scas_718.46
          Length = 309

 Score =  484 bits (1247), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/307 (75%), Positives = 266/307 (86%), Gaps = 6/307 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGK+SKDKRD+YYRKAKE+G+RARSA+KLLQLN++FHFLDDP LKRVVDLCAAPGSWSQV
Sbjct: 1   MGKNSKDKRDMYYRKAKEQGFRARSAFKLLQLNDDFHFLDDPNLKRVVDLCAAPGSWSQV 60

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LS+KLF  +      +  DRKI+AVDLQPMSPI+HV TLQADITHP+TL+RI +LFGN+K
Sbjct: 61  LSQKLFDGKTA---EEIKDRKIVAVDLQPMSPINHVTTLQADITHPKTLKRILDLFGNEK 117

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEY+Q QLIMSALQLT C+LK+GG FVAKIFRGRDIDMLYSQ
Sbjct: 118 ADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTACILKKGGIFVAKIFRGRDIDMLYSQ 177

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LGYLF+K+VCAKP+SSRGTSLEAFIVCIGYNPP+ W   LDVNSSV EFF+ C + KLSI
Sbjct: 178 LGYLFDKVVCAKPKSSRGTSLEAFIVCIGYNPPSDWVSTLDVNSSVEEFFSGCHMSKLSI 237

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYH--DLPK-YGVALDPVQAPTNPPYKRAL 297
            D L  W++  R+IA FM+CG+L S+DSDATYH  D  +    +LDPVQ+PTNPPYK+AL
Sbjct: 238 HDKLPSWQEDERTIAKFMSCGNLESFDSDATYHLDDFKEDLNTSLDPVQSPTNPPYKKAL 297

Query: 298 ELKRDGK 304
           ELKR GK
Sbjct: 298 ELKRSGK 304

>KLLA0F18414g complement(1695869..1696774) similar to sp|P38238
           Saccharomyces cerevisiae YBR061c, start by similarity
          Length = 301

 Score =  472 bits (1214), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/304 (74%), Positives = 263/304 (86%), Gaps = 8/304 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+GYRARSA+KLLQL+++FHFL   +  RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLDDDFHFLQ--QAVRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSR+LF +          DRKI+AVDLQPMSPID+VITLQADITHP+TL+ I ELF  +K
Sbjct: 59  LSRRLFPQ-----SSDNSDRKIVAVDLQPMSPIDNVITLQADITHPKTLQTITELFEGKK 113

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADF+CSDGAPDVTGLHDLDEY+Q QLI+SALQL+TC+L++GG FVAKIFRGRDIDMLYSQ
Sbjct: 114 ADFICSDGAPDVTGLHDLDEYVQQQLILSALQLSTCLLRKGGNFVAKIFRGRDIDMLYSQ 173

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LGYLFEK++CAKPRSSRGTSLE+FIVC+GYNPPA WEPKLDVNSSV +FF  CD+GKL +
Sbjct: 174 LGYLFEKVICAKPRSSRGTSLESFIVCLGYNPPANWEPKLDVNSSVEDFFQGCDIGKLRL 233

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300
           +D    + ++PRSIA F+ACG LSS+DSDATYH +     ALDPVQ+PTNPPYK+ALELK
Sbjct: 234 EDKCPNYHEEPRSIATFIACGGLSSFDSDATYH-VDTSTPALDPVQSPTNPPYKKALELK 292

Query: 301 RDGK 304
           R GK
Sbjct: 293 RRGK 296

>Sklu_2357.3 YBR061C, Contig c2357 3590-4537 reverse complement
          Length = 315

 Score =  469 bits (1207), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/308 (73%), Positives = 260/308 (84%), Gaps = 8/308 (2%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+GYRARSA+KLLQLN+ FHFLD+  + RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNDHFHFLDN--VTRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSRKLF     + +  +  +KI+AVDLQPMSPIDHV TLQADITHP TL +I ELFG  K
Sbjct: 59  LSRKLFDNE--LENENKQSKKIVAVDLQPMSPIDHVTTLQADITHPGTLAKILELFGGDK 116

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SALQLTTC+LK GG FVAKIFRGRD+DMLYSQ
Sbjct: 117 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLKEGGCFVAKIFRGRDVDMLYSQ 176

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LGYLFE++VCAKPRSSRG+SLE+FIVC+GY PP  W P LDVN S+ +FF  CDLG+L++
Sbjct: 177 LGYLFERVVCAKPRSSRGSSLESFIVCLGYKPPHNWTPHLDVNQSIEDFFRGCDLGRLTL 236

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGV----ALDPVQAPTNPPYKRA 296
            D L  + D+PR+IA+F++CG L S+DSDATYH++    V    ALDPVQAPTNPPYK+A
Sbjct: 237 QDNLVEFYDEPRNIAEFVSCGGLDSFDSDATYHNVEGSDVTSKSALDPVQAPTNPPYKKA 296

Query: 297 LELKRDGK 304
           LELKR GK
Sbjct: 297 LELKRSGK 304

>Kwal_27.10543
          Length = 303

 Score =  461 bits (1186), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 260/304 (85%), Gaps = 6/304 (1%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKEEGYRARSA+KLLQL+E+FHFLD+  + RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDN--VTRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSR+LF E++    G    ++I++VDLQPM PI++V T+QADITHP+TL +I +LF  +K
Sbjct: 59  LSRRLF-EKDTENKGS---KRIVSVDLQPMFPIENVTTIQADITHPKTLNKIMDLFDGEK 114

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SALQLTTC+L+ GG FVAKIFRGRDIDMLYSQ
Sbjct: 115 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVAKIFRGRDIDMLYSQ 174

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           L +LFE++VCAKPRSSRGTSLE+FIVC+GY PP  W P LDVN SV +FF  CD+G+LS+
Sbjct: 175 LSFLFERVVCAKPRSSRGTSLESFIVCLGYKPPKNWTPHLDVNMSVEDFFQGCDIGRLSL 234

Query: 241 DDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYKRALELK 300
           DD L  +  QPRS+A+F++CG L S+DSDATYHD+P   V L+PVQ PTNPPYKRALELK
Sbjct: 235 DDKLPDYHVQPRSVAEFISCGGLDSFDSDATYHDVPVDRVTLNPVQPPTNPPYKRALELK 294

Query: 301 RDGK 304
           R GK
Sbjct: 295 RKGK 298

>AGR036W [4346] [Homologous to ScYBR061C - SH]
           complement(774279..775199) [921 bp, 306 aa]
          Length = 306

 Score =  425 bits (1092), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 217/310 (70%), Positives = 245/310 (79%), Gaps = 15/310 (4%)

Query: 1   MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQV 60
           MGKSSKDKRDLYYRKAKE+G+RARSA+KLLQLN+EFHFLD   ++RVVDLCAAPGSWSQV
Sbjct: 1   MGKSSKDKRDLYYRKAKEQGFRARSAFKLLQLNDEFHFLDG--VQRVVDLCAAPGSWSQV 58

Query: 61  LSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQK 120
           LSR+LF       DG+   ++I+AVDLQPMS I+HV TLQADITHPRTL +I ELF  +K
Sbjct: 59  LSRELFP------DGKNTKKRIVAVDLQPMSRIEHVTTLQADITHPRTLTKIIELFKGEK 112

Query: 121 ADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           ADFVCSDGAPDVTGLHDLDEY+Q QLI+SAL+LT  +L  GG FVAKIFRGRDIDMLYSQ
Sbjct: 113 ADFVCSDGAPDVTGLHDLDEYVQQQLILSALKLTVSLLAPGGCFVAKIFRGRDIDMLYSQ 172

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKLDVNSSVTEFFATCDLGKLSI 240
           LG LF+K+ CAKPRSSRGTSLE+FIVC GY PP  W P ++ N SV EFF        SI
Sbjct: 173 LGLLFDKVTCAKPRSSRGTSLESFIVCQGYTPPLSWAPNIEKNVSVEEFFEE-FFQNWSI 231

Query: 241 DDTLQPWKDQP------RSIADFMACGSLSSYDSDATYHDLPKYGVALDPVQAPTNPPYK 294
              L P +  P      R IA F++CG L S+DSDATYHDLPK   ALDPVQ+PTNPPYK
Sbjct: 232 QQPLTPGRPLPMYSEGHRGIAPFISCGGLDSFDSDATYHDLPKSATALDPVQSPTNPPYK 291

Query: 295 RALELKRDGK 304
           RALELKR GK
Sbjct: 292 RALELKRSGK 301

>CAGL0B00484g 35991..38504 highly similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1, start by similarity
          Length = 837

 Score =  166 bits (419), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 128/219 (58%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE+F HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S+       PV      +  II VD+ PM P+ +VIT Q+DIT      R+       KA
Sbjct: 65  SKLC-----PV------NSLIIGVDIVPMKPMPNVITFQSDITTEDCRSRLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q  L + AL+L    L   GTFV KIFR +D + L    
Sbjct: 114 DTVLHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVF 173

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LFEK+   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 174 QQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Scas_642.12
          Length = 839

 Score =  165 bits (418), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 130/219 (59%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE+F HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S+       PV      +  II VD+ PM P+++ IT Q+DIT      ++       KA
Sbjct: 65  SKLC-----PV------NSLIIGVDIVPMKPMNNCITFQSDITTEDCRSKLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q QL + AL+L    L  GGTFV K+FR +D + L    
Sbjct: 114 DTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAAENLVVGGTFVTKVFRSKDYNKLIWVF 173

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LF+K+   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 174 QQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>Kwal_33.13054
          Length = 830

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 128/219 (58%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE+F HF++  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFMEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S        PV      +  II VD+ PM P+ +VIT Q+DIT      ++       KA
Sbjct: 65  SNLC-----PV------NSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q  L + AL+L    L  GGTFV KIFR +D + L    
Sbjct: 114 DTVLHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVF 173

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LF+K+   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 174 SQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>YCL054W (SPB1) [493] chr3 (31449..33974) Putative
           S-adenosyl-methionine-dependent methyltransferase
           required for synthesis of the 60S ribosomal subunit,
           member of the 2-prime-O-RNA methyltransferase family,
           which includes Trm7p, Mrm2p, and E. coli FtsJ protein
           [2526 bp, 841 aa]
          Length = 841

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 129/219 (58%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE++ HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S+       PV      +  II VD+ PM P+ +VIT Q+DIT      ++       KA
Sbjct: 65  SKLC-----PV------NSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q QL + AL+L    L   GTFV KIFR +D + L    
Sbjct: 114 DTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVF 173

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LFEK+   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 174 QQLFEKVEATKPPASRNVSAEIFVVCKGFKAPKRLDPRL 212

>AFR734C [3927] [Homologous to ScYCL054W (SPB1) - SH]
           (1785487..1788024) [2538 bp, 845 aa]
          Length = 845

 Score =  164 bits (415), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 132/220 (60%), Gaps = 16/220 (7%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE+F HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S        PV      +  II VD+ PM P+ +VIT Q+DIT      ++       KA
Sbjct: 65  SNLC-----PV------NSLIIGVDIVPMQPMPNVITFQSDITTEDCRSKLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDL-DEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQ 180
           D V  DGAP+V GL+ + D + Q  L + AL+L    L  GGTFV KIFR +D + L   
Sbjct: 114 DTVLHDGAPNV-GLNWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLMWV 172

Query: 181 LGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
              LF+K+   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 173 FQQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>Sklu_2421.10 YCL054W, Contig c2421 13526-16075 reverse complement
          Length = 849

 Score =  161 bits (408), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/219 (42%), Positives = 127/219 (57%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE+F HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 7   KNSKGRLDRYYFLAKEKGYRARSSFKIIQINEKFGHFLEKSKV--VIDLCAAPGSWCQVA 64

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S        PV      +  II VD+ PM  + +VIT Q+DIT      R+       KA
Sbjct: 65  SNLC-----PV------NSLIIGVDIVPMKSMPNVITFQSDITTEDCRSRLRGYMKTWKA 113

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q  L + AL+L    L  GGTFV K+FR +D + L    
Sbjct: 114 DTVLHDGAPNVGLGWVQDAFTQSHLTLQALKLAVENLVVGGTFVTKVFRSKDYNKLIWLF 173

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LFE++   KP +SR  S E F+VC G+  P   +P+L
Sbjct: 174 QQLFERVEATKPPASRNVSAEIFVVCKGFKAPKKLDPRL 212

>KLLA0C00737g 53188..55689 similar to sp|P25582 Saccharomyces
           cerevisiae YCL054w SPB1 required for ribosome synthesis,
           putative methylase, start by similarity
          Length = 833

 Score =  159 bits (403), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 126/219 (57%), Gaps = 14/219 (6%)

Query: 3   KSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEF-HFLDDPELKRVVDLCAAPGSWSQVL 61
           K+SK + D YY  AKE+GYRARS++K++Q+NE++ HFL+  ++  V+DLCAAPGSW QV 
Sbjct: 8   KNSKGRLDKYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKV--VIDLCAAPGSWCQVA 65

Query: 62  SRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKA 121
           S        PV      +  II VD+ PM  + +VIT Q+DIT      ++       KA
Sbjct: 66  SNLC-----PV------NSLIIGVDIVPMKTMPNVITFQSDITTEDCRSKLRGYMKTWKA 114

Query: 122 DFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQL 181
           D V  DGAP+V      D + Q  L + AL+L    L  GGTFV KIFR +D + L    
Sbjct: 115 DTVLHDGAPNVGLSWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRSKDYNKLIWVF 174

Query: 182 GYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEPKL 220
             LFEK+   KP +SR  S E F+VC  +  P   +P+L
Sbjct: 175 QQLFEKVEATKPPASRNVSAEIFVVCKNFKAPKKLDPRL 213

>KLLA0B01980g complement(173710..174579) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c singleton, start by
           similarity
          Length = 289

 Score = 85.9 bits (211), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 111/254 (43%), Gaps = 62/254 (24%)

Query: 5   SKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRK 64
           ++ K D + + AKE+ +R+R+A+KL+ +++++ F    +  +V+DL  APG+WSQV    
Sbjct: 35  ARQKNDHFTKAAKEQQFRSRAAFKLMDIDDKYRFFKQNQ--KVLDLGFAPGAWSQV---- 88

Query: 65  LFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADI--------------------- 103
               R+ +  G      I+ VDL   +P   V +LQA+I                     
Sbjct: 89  ---ARKRIGSGG----MIMGVDLLRCTPPKGVYSLQANILSKKTHELIRLCFARHIQLNK 141

Query: 104 -------------------THPRTLERIYELFGNQK---------ADFVCSDGAPDVTGL 135
                               H +  E   ELF              D V SD   + TG+
Sbjct: 142 HDQLHKDHGYLQHMLEEELNHLKETEEYKELFSQTDISQNIERYPVDVVLSDMMANTTGI 201

Query: 136 HDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVCAKPRS 195
              D Y+   L  +AL +   +LK GG+F  K++ G +  +L  +L  +F+K+   KP +
Sbjct: 202 QSKDHYMSMDLCDAALIVAIDLLKPGGSFTCKLYAGSEDTLLEKRLKKVFKKVDRFKPNA 261

Query: 196 SRGTSLEAFIVCIG 209
           SR  S E + V  G
Sbjct: 262 SRNESKELYFVARG 275

>CAGL0H08954g complement(875104..875949) similar to sp|P53123
           Saccharomyces cerevisiae YGL136c, hypothetical start
          Length = 281

 Score = 75.1 bits (183), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 103/246 (41%), Gaps = 56/246 (22%)

Query: 6   KDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRKL 65
           + K+D Y R++K +  R+R+ +KL QL++ +H       +R++DL  APG+WSQV  ++ 
Sbjct: 32  RQKQDFYTRESKLDNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKR- 90

Query: 66  FAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQ------ 119
                        D  ++ VD+ P  P   V ++QA+I   RT + I + F  Q      
Sbjct: 91  ----------THPDSIVLGVDILPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDS 140

Query: 120 ------------------KADFVCSD---------------------GAPDVTGLHDLDE 140
                               + + SD                        + +GL+  D 
Sbjct: 141 QVESMARNDSDTEQQPQFPVNIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDH 200

Query: 141 YIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVCAKPRSSRGTS 200
                L  +AL     +L+  G+F+ K F G +  +   ++  +F+++   KP +SR  S
Sbjct: 201 LNSIDLCDAALITAVDLLEPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDES 260

Query: 201 LEAFIV 206
            E + +
Sbjct: 261 KEIYFI 266

>Kwal_56.24158
          Length = 307

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 71/141 (50%), Gaps = 18/141 (12%)

Query: 6   KDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRKL 65
           + K D + R AK +G R+R+A+KL+Q++++ H       + V+DL  APG+WSQV     
Sbjct: 35  RQKNDSFTRDAKVQGLRSRAAFKLMQIDDKVHLFRKNARQNVLDLGYAPGAWSQV----- 89

Query: 66  FAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKADFVC 125
                   D    D  I+ VD+ P +P   V ++QA+I   +T E I  LF +++     
Sbjct: 90  ------AFDRTGPDGVILGVDILPCAPPRGVSSIQANILSRKTHELI-RLFFSRQFQLYY 142

Query: 126 SDGAPDVTGLHDLDEYIQHQL 146
            D       LH  + Y QH L
Sbjct: 143 ED------RLHKDNGYFQHML 157

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 73/154 (47%), Gaps = 13/154 (8%)

Query: 55  GSWSQVLSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYE 114
           G +  +L ++L   ++ +  G E + KI        +PID +I+   D+  P    +I  
Sbjct: 151 GYFQHMLEQRLETTKDELNSGTEQETKI------QETPIDVIIS---DMYEP--WPQISG 199

Query: 115 LFGNQKADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDI 174
            + N        D   + +G+   D Y    L  +AL     +LK GG+FV K++ G++ 
Sbjct: 200 FWNNLTNS--AYDRMANTSGVAIKDHYASMDLCDAALVAAIDLLKPGGSFVCKLYTGKED 257

Query: 175 DMLYSQLGYLFEKIVCAKPRSSRGTSLEAFIVCI 208
            +L ++L  +F ++   KP +SR  S E + V +
Sbjct: 258 RILENRLKQVFNEVQRFKPTASRDESKELYFVGL 291

>Sklu_2160.2 YGL136C, Contig c2160 1404-2351
          Length = 315

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 18/141 (12%)

Query: 6   KDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRKL 65
           + + D Y ++AK +  R+R+A+KL++L++ F F    + +RV+DL  APG+WSQV     
Sbjct: 36  RQRNDFYTKEAKNQDLRSRAAFKLIELDDRFKFFLKNKSQRVLDLGFAPGAWSQV----- 90

Query: 66  FAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKADFVC 125
                   D  + +  ++ VD+ P  P   V ++QA+I   +T E I  LF ++      
Sbjct: 91  ------AFDRTKPNGMVLGVDILPCKPPRGVSSIQANILSRKTHELI-RLFFSKHFQINR 143

Query: 126 SDGAPDVTGLHDLDEYIQHQL 146
            D       LH+   Y QH L
Sbjct: 144 HD------ELHEDHGYFQHML 158

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%)

Query: 131 DVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVC 190
           + TG+   D Y+   L  +AL +   +L+ GG+F  K++ G++  +L  ++  +F K+  
Sbjct: 224 NTTGVAIKDHYMSMDLCDAALVVAIDLLRPGGSFACKVYTGKEDKLLEKRMKMVFSKVCR 283

Query: 191 AKPRSSRGTSLEAFIVCIG 209
            KP SSR  S E + V +G
Sbjct: 284 FKPDSSRNESKELYFVGLG 302

>Scas_720.46
          Length = 321

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 60/106 (56%), Gaps = 13/106 (12%)

Query: 10  DLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRKLFAER 69
           D Y R+AK   +R+R+A+KL +++++FH  +  +++RV+DL  APG+WSQV   +   E 
Sbjct: 42  DPYTREAKINNFRSRAAFKLTEIDDKFHIFNKSKIQRVLDLGFAPGAWSQVARERTSKE- 100

Query: 70  EPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRT--LERIY 113
                       I+ VD+ P  P   V  +QA+I   +T  L R+Y
Sbjct: 101 ----------SMILGVDILPCDPPHGVSAIQANILSKKTQMLIRLY 136

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 143 QHQLIMSALQLTTCV--LKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVCAKPRSSRGTS 200
           QH + +    L T +  L+  G+FV K+F G +  +   ++  +F+K +  KP+SSR  S
Sbjct: 240 QHSIDLCDAALVTALDLLRPKGSFVCKLFTGVEDKLFEKRVKMVFKKTIRFKPKSSRNES 299

Query: 201 LEAFIV 206
            E +I+
Sbjct: 300 KEVYII 305

>AFL117C [3078] [Homologous to ScYGL136C (MRM2) - SH]
           (218993..219904) [912 bp, 303 aa]
          Length = 303

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 5   SKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPELKRVVDLCAAPGSWSQVLSRK 64
           S+ +RD Y R+AK +  R+R+A+KL++++E+F      +  RV+DL  APG+WSQV    
Sbjct: 32  SRQRRDPYTREAKVQELRSRAAFKLIEIDEQFRLFRAGQ--RVLDLGFAPGAWSQV---- 85

Query: 65  LFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKADFV 124
             A++     G     K++ VD+ P  P   V ++QA+    +T E +  L+ ++     
Sbjct: 86  --AQQRTQPGG-----KVMGVDVLPCKPPTGVSSIQANALSRKTHE-LVRLYFSRHFQLN 137

Query: 125 CSDGAPDVTGLHDLDEYIQHQL 146
             D       LH    Y QH L
Sbjct: 138 MHD------ELHKKHGYFQHML 153

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%)

Query: 131 DVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVC 190
           + +G+   D Y+   L  +AL     +L+ GG+FV K++ G++  +L  +L  +F K+  
Sbjct: 212 NTSGVAVKDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRR 271

Query: 191 AKPRSSRGTSLEAFIVCI 208
            KP + R  S E + V +
Sbjct: 272 FKPEACRSESKELYFVGL 289

>YGL136C (MRM2) [1851] chr7 complement(252900..253862)
           Methyltransferase that methylates mitochondrial 21S rRNA
           at nucleotide U2791, member of the 2-prime-O-RNA
           methyltransferase family, which includes Trm7p, Spb1p,
           and E. coli FtsJ protein [963 bp, 320 aa]
          Length = 320

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 12/110 (10%)

Query: 9   RDLYYRKAKEEGYRARSAYKLLQLNEEFH-FLDDPELKRVVDLCAAPGSWSQVLSRKLFA 67
           +D Y ++AK +  R+R+A+KL+Q+++++  F  +   +R++DL  APG+WSQV  ++   
Sbjct: 37  KDPYTKEAKVQNLRSRAAFKLMQIDDKYRLFSKNRTDQRILDLGYAPGAWSQVARQR--- 93

Query: 68  EREPVADGQEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFG 117
                      +  I+ VD+ P  P   V ++QA+I   RT + I   F 
Sbjct: 94  --------SSPNSMILGVDILPCEPPHGVNSIQANILAKRTHDLIRLFFS 135

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 39/78 (50%)

Query: 131 DVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDIDMLYSQLGYLFEKIVC 190
           + +G+   D Y    L  +AL     +L+  G+FV K++ G + ++   ++  +F  +  
Sbjct: 228 NTSGVSIRDHYQSIDLCDAALVTAIDLLRPLGSFVCKLYTGEEENLFKKRMQAVFTNVHK 287

Query: 191 AKPRSSRGTSLEAFIVCI 208
            KP +SR  S E + + +
Sbjct: 288 FKPDASRDESKETYYIGL 305

>Scas_672.11
          Length = 750

 Score = 32.0 bits (71), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 65/184 (35%), Gaps = 33/184 (17%)

Query: 115 LFGNQKADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKRGGTFVAKIFRGRDI 174
           L G ++   V +D A   T  H+    I       A  L    +         + RGR  
Sbjct: 522 LMGAERKTMVLTDSARRATAYHEAGHAIMAMFTTGATPLYKATI---------LPRGR-- 570

Query: 175 DMLYSQLGYLFEKIVCAKPRSSRGTSLEAFIVCIGY-----------NPPAGWEPKLD-- 221
                 LG  F+     K   +R   L    VC+G            N  +G    L   
Sbjct: 571 -----ALGITFQLPEMDKVDVTRKECLATLDVCMGGKIAEELIYGKDNTTSGCGSDLQSA 625

Query: 222 ---VNSSVTEFFATCDLGKLSIDDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLPKY 278
                S VT++  + ++G +S+ +  + W ++ R +AD    G L   + D T   L K 
Sbjct: 626 TNTARSMVTQYGMSDEVGPISLAENWESWSNKIRDVADNEVIGLLKQSE-DRTRRMLAKK 684

Query: 279 GVAL 282
            + L
Sbjct: 685 SIEL 688

>Kwal_56.23171
          Length = 438

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 76  QEDDRKIIAVDLQPMSPIDHVITLQADITHPRTLERIYELFGNQKADFVCSDGAPDVTGL 135
           +E   K + +D++P  PI+  + L  +  H   L  + E   + K  F+  DG   + GL
Sbjct: 100 EEGKEKKVTIDIEPYKPINTSLYLCDNKFHTEVLSELLE--ADDKFGFIVMDGQGTLFGL 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,452,429
Number of extensions: 442792
Number of successful extensions: 1061
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1016
Number of HSP's successfully gapped: 31
Length of query: 304
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 203
Effective length of database: 13,099,691
Effective search space: 2659237273
Effective search space used: 2659237273
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)