Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10230g51450626460.0
YBR060C (ORC2)62050314660.0
Scas_718.4773051813111e-174
Kwal_27.1094159551912541e-168
AGR028C57940410741e-141
KLLA0F18590g5964127991e-99
Sklu_2291.5100076750.50
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10230g
         (506 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10230g complement(1000574..1002118) similar to sp|P32833 S...  1023   0.0  
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...   569   0.0  
Scas_718.47                                                           509   e-174
Kwal_27.10941                                                         487   e-168
AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH] (766480..76...   418   e-141
KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces...   312   1e-99
Sklu_2291.5 YGL094C, Contig c2291 9283-12280                           33   0.50 

>CAGL0H10230g complement(1000574..1002118) similar to sp|P32833
           Saccharomyces cerevisiae YBR060c RRR1 origin recognition
           complex, hypothetical start
          Length = 514

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/506 (97%), Positives = 494/506 (97%)

Query: 1   MSPPETPKKESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLVQLQTP 60
           MSPPETPKKESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLVQLQTP
Sbjct: 1   MSPPETPKKESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLVQLQTP 60

Query: 61  RKRRKVNLSKEHDFTSPLKKVIMNNLNEYXXXXXXXXXXXXRDFVNTQVPRPADVEKLKA 120
           RKRRKVNLSKEHDFTSPLKKVIMNNLNEY            RDFVNTQVPRPADVEKLKA
Sbjct: 61  RKRRKVNLSKEHDFTSPLKKVIMNNLNEYKKSDLADKLKLSRDFVNTQVPRPADVEKLKA 120

Query: 121 NRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHRNLHKNLRDH 180
           NRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHRNLHKNLRDH
Sbjct: 121 NRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHRNLHKNLRDH 180

Query: 181 LYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQAIEVPTYNGK 240
           LYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQAIEVPTYNGK
Sbjct: 181 LYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQAIEVPTYNGK 240

Query: 241 KSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNHVIMNIQKLIDYY 300
           KSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNHVIMNIQKLIDYY
Sbjct: 241 KSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNHVIMNIQKLIDYY 300

Query: 301 KDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQ 360
           KDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQ
Sbjct: 301 KDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQ 360

Query: 361 NYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTLNSKKMYKLLIET 420
           NYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTLNSKKMYKLLIET
Sbjct: 361 NYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTLNSKKMYKLLIET 420

Query: 421 QLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEH 480
           QLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEH
Sbjct: 421 QLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEH 480

Query: 481 KMASVSKNTVGTEFVWVPYTYAEMKR 506
           KMASVSKNTVGTEFVWVPYTYAEMKR
Sbjct: 481 KMASVSKNTVGTEFVWVPYTYAEMKR 506

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/503 (55%), Positives = 362/503 (71%), Gaps = 14/503 (2%)

Query: 9   KESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLV----QLQTPRKRR 64
           +ES   N    +++ G   +   +KI+V +   YE       ++N V    +   P    
Sbjct: 118 EESKTSNNKQVMEKTGIKEKREREKIQVATTT-YEDNVTPQTDDNFVSNSPEPPEPATPS 176

Query: 65  KVNLSKEHDFTSPLKKVIMNNLNEYXXXXXXXXXXXXRDFVNTQVPRPADVEKLKANRAV 124
           K +L+  HDFTSPLK++IMNNL EY            R+F  T VP+   + +    ++ 
Sbjct: 177 KKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSA 236

Query: 125 TSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHRNLHKNLRDHLYII 184
           +SF DTFEGYF+Q++ VR    S+++++MAP VTREEF L+SN F+ N  K  R  L+ I
Sbjct: 237 SSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEI 296

Query: 185 QKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQ-AIEVPTYNGKKSK 243
           QKK++PQYWFE+ QGFSLLFYG+GSK+ FLE+F   YLSPK+A SQ A E      K   
Sbjct: 297 QKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKP-- 354

Query: 244 FEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNHVIMNIQKLIDYYKDK 303
              IP +++NGYNP+CNYRDVFK+I  LL PAELT+SE+K+WGNHVI+ IQK+ID+YK++
Sbjct: 355 VNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQ 414

Query: 304 PLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHIYAPFLWDNLRAQNYN 363
           PLDIKLI+ +HN+DGP+IR+    T+LSFLS+IRQ+AIVAS DHIYAP LWDN++AQNYN
Sbjct: 415 PLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYN 474

Query: 364 FVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTLNSKKMYKLLIETQLQ 423
           FVFHD++N+ P   ES+FQDVM++GKS+ S+GAEGAKYVLQSLT+NSKKMYKLLIETQ+Q
Sbjct: 475 FVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQ 534

Query: 424 HMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEMALRSMLTEFIEHKMA 483
           +M  +S   +TG     KRGT   GVE K   HLCAADFIASNE+ALRSML EFIEHKMA
Sbjct: 535 NMGNLSA--NTG----PKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMA 588

Query: 484 SVSKNTVGTEFVWVPYTYAEMKR 506
           +++KN  G E +WVPYTYAE+++
Sbjct: 589 NITKNNSGMEIIWVPYTYAELEK 611

>Scas_718.47
          Length = 730

 Score =  509 bits (1311), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 259/518 (50%), Positives = 364/518 (70%), Gaps = 19/518 (3%)

Query: 4   PETPK--KESLKENEDLAIKENGTSPREIGDKIKVESAGEYETPELTSDEENLVQLQTPR 61
           PETPK  ++  +  ++  I EN +   E G   K    GE  + ++ SD E+L   QT  
Sbjct: 207 PETPKIKRKRGRPRKEPVISENNSE--EKGKSRKPNKKGE--SSDIESDRESLAMDQTSP 262

Query: 62  KRRKVNLSKEHDFTSPLKKVIMNNLNEYXXXX--XXXXXXXXRDFVNTQVPRPADVEK-L 118
              K+    EHDFTSPLK+VIMN+L +Y              R+FV TQVP+    EK L
Sbjct: 263 LPSKIAPLTEHDFTSPLKQVIMNSLRQYQEDSLLSSKKLVLNREFVPTQVPKTDKYEKRL 322

Query: 119 KA--NRAVTSFTDTFEGYFEQK-RSVR-GVKVSKNSITMAPHVTREEFGLISNIFHRNLH 174
           +A  N++  +F DTFEGYF+Q+  S++   K+SKN+++M P V+++EF + +N+F+++  
Sbjct: 323 EASENKSSKTFFDTFEGYFDQRSHSLKYTTKLSKNTMSMGPSVSKDEFAMFTNVFNKHYL 382

Query: 175 KNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKL------AL 228
           K  R  L  +Q+K++PQYWFE+ QGFSLLFYGIGSK+ FLED   KY+SPKL      AL
Sbjct: 383 KEPRAKLQALQRKMFPQYWFEITQGFSLLFYGIGSKRNFLEDLAIKYISPKLTFGKRIAL 442

Query: 229 SQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWGNH 288
            + +E+   N      +GIP +++NGYNPTC+YR++F+DI  ++ P  LT++E+KFWGN 
Sbjct: 443 QKELELKKVNKSTGSIQGIPCLIINGYNPTCSYREIFQDITDIMFPDGLTRNETKFWGNL 502

Query: 289 VIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASADHI 348
            I+ +QK+I++Y  +P DIKLI+ IHN+DGP +R+    TI S L+ I+Q+ ++AS DHI
Sbjct: 503 AILQVQKMIEFYSTQPKDIKLILVIHNLDGPALRKEIFQTIFSSLAQIKQIVLIASVDHI 562

Query: 349 YAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSLTL 408
           YAP L+DN +AQNYNFVFHDVTNY   E ESSFQD M LGKS +S+GAEGAKYVL+SLTL
Sbjct: 563 YAPVLFDNKKAQNYNFVFHDVTNYESNEVESSFQDKMNLGKSSSSSGAEGAKYVLESLTL 622

Query: 409 NSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASNEM 468
           N+KKMYKLL++ QL +M+  S +K+    + SKRG +S GVEFK  V +CA++FIASNE+
Sbjct: 623 NAKKMYKLLLDLQLNNMDLASGSKNKSASSVSKRGGLSTGVEFKSFVTMCASEFIASNEI 682

Query: 469 ALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKR 506
           +LR+MLTEFIEHKM  +S+++ GTE+++VPY Y+EM++
Sbjct: 683 SLRTMLTEFIEHKMLLLSRHSSGTEYLYVPYRYSEMEK 720

>Kwal_27.10941
          Length = 595

 Score =  487 bits (1254), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 242/519 (46%), Positives = 342/519 (65%), Gaps = 35/519 (6%)

Query: 3   PPETPKKESLKENEDLAIKENGTSPREIGD--KIKVESAGEYETPELTSDEENLVQLQTP 60
           PP +P +  ++             PR+ G    +K E   +  TP + +     +  Q P
Sbjct: 87  PPRSPSQSPVRH------------PRKRGRPRSVKAEHDPKITTPSVNASPSRSISPQGP 134

Query: 61  RKRRKVNLSKEHDF----TSPLKKVIM-----NNLNEYXXXXXXXXXXXXRDFVNTQVPR 111
           RK  K+    E +F    +SP+K   +      + ++             R FV T +P 
Sbjct: 135 RKLTKLEPVPESEFVTANSSPIKSSHVFSSPAKSPSKPVLKQSPFKIQLDRHFVPTPIPH 194

Query: 112 PADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFGLISNIFHR 171
             D  K    + +T F D FEGY +QK+ +R  + S N++ MAP VTREEF L+SN    
Sbjct: 195 EGDY-KPPQEKHLTYFFDGFEGYIDQKKPLRAHQKSTNTMAMAPQVTREEFSLLSNTLID 253

Query: 172 NLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLSPKLALSQA 231
           +LHK  ++ L  +Q+K++PQYWFE+ QGFSLLFYG+GSK+ FLE+FV +YLSP+LALS A
Sbjct: 254 SLHKPAKEALLEVQRKMFPQYWFELAQGFSLLFYGVGSKRSFLEEFVLQYLSPQLALSDA 313

Query: 232 IEVPTYNG-----KKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESKFWG 286
           +   T        ++S+ +G+P VV+NGYNPTCNYRD F  I  ++   EL++SE+K+WG
Sbjct: 314 LNFGTAEDSEAIDEESEIDGVPCVVINGYNPTCNYRDAFHSISQIMMQEELSKSETKYWG 373

Query: 287 NHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVASAD 346
           NHV + I K+I+ Y+D P  IKLIV +HN+DGP +R+     +LS LS +RQ+A++AS D
Sbjct: 374 NHVELQINKMIEVYRDSPPLIKLIVLVHNLDGPMVRKDPFQNMLSSLSRVRQIALIASTD 433

Query: 347 HIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGAEGAKYVLQSL 406
           ++YAP LWD++RAQN+NF+FHD+TNY  Y  ESSF D+M+LG+S  +TGAEGA+YVL+SL
Sbjct: 434 NLYAPLLWDHVRAQNFNFIFHDITNYQSYAVESSFSDIMQLGRSAGTTGAEGARYVLESL 493

Query: 407 TLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADFIASN 466
           T NSK+MYKLLIETQL +M+      S GK  A+KRG+ + G+EFKQ  H+CAADFIASN
Sbjct: 494 TSNSKRMYKLLIETQLSNMD------SQGKAVANKRGSHAFGIEFKQFYHMCAADFIASN 547

Query: 467 EMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMK 505
           E++LRSML EFIEHKMA++S++  G E +++PY ++EM+
Sbjct: 548 EVSLRSMLGEFIEHKMAAMSRDRTGAETLYIPYVHSEMQ 586

>AGR028C [4338] [Homologous to ScYBR060C (ORC2) - SH]
           (766480..768219) [1740 bp, 579 aa]
          Length = 579

 Score =  418 bits (1074), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/404 (49%), Positives = 281/404 (69%), Gaps = 15/404 (3%)

Query: 104 FVNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEFG 163
           FV   VP+     +L  +R +T F D FEGY +QK+ +R  K S+NS+ +AP V+R+EF 
Sbjct: 181 FVPAAVPK---GYRLPEDRNLTYFFDGFEGYIDQKKPIRAHKKSRNSMAIAPSVSRDEFR 237

Query: 164 LISNIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFVFKYLS 223
           L+S   +  +H+  R  L   Q++L+PQYWFEV+QGF+LLFYGIGSK+ FLE  VF+YLS
Sbjct: 238 LLSGALNGFMHQTPRAVLTGHQQRLFPQYWFEVMQGFTLLFYGIGSKRRFLETLVFEYLS 297

Query: 224 PKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAELTQSESK 283
           PKLALS A E        +  EG+P VV+NG+NP CNYRD F+ I + + P EL  +E+K
Sbjct: 298 PKLALSGAPE-------GADVEGVPCVVINGFNPACNYRDCFQSIAAYMLPDELRHAETK 350

Query: 284 FWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLIRQVAIVA 343
           +W NHV + IQK+++++  +P  ++++V +HN+DGP +R+     +LS L+ IRQ+AIVA
Sbjct: 351 YWHNHVHLQIQKMVEHWAAQPPQVQMVVLVHNLDGPMLRKDPFQQMLSSLARIRQIAIVA 410

Query: 344 SADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSENSTGA-EGAKYV 402
           S DHI+AP LW +LRAQ YNFVFHDVTNY PY  E++FQ+ +RL +SE   G+ + A+YV
Sbjct: 411 SVDHIHAPLLWYSLRAQLYNFVFHDVTNYEPYAIEAAFQESVRLNRSELQAGSIDAARYV 470

Query: 403 LQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQLVHLCAADF 462
           L SLT NSK++++LL+ET + +M+     K T     S+R  +S GV F      CAA F
Sbjct: 471 LASLTANSKRLFRLLLETVVANMQSAKRIKLTN----SRRAGISFGVPFSAFYQACAAQF 526

Query: 463 IASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKR 506
           +ASNEM+LRSML EF+EHKMA ++K+  G E V+V Y++ EM++
Sbjct: 527 VASNEMSLRSMLREFVEHKMAHLAKDKAGQEIVYVNYSFGEMQK 570

>KLLA0F18590g 1709034..1710824 similar to sp|P32833 Saccharomyces
           cerevisiae YBR060c RRR1 origin recognition complex, 72
           kDa subunit singleton, start by similarity
          Length = 596

 Score =  312 bits (799), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 163/412 (39%), Positives = 259/412 (62%), Gaps = 22/412 (5%)

Query: 103 DFVNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTREEF 162
           +F  T++P+  + ++    ++   F D FEG+ +Q + ++  K SKNS++ AP ++R+E+
Sbjct: 189 NFKPTKLPKSDNNDQTSDEQSQIYFFDGFEGFIDQTKILKTDKRSKNSMSSAPSISRDEY 248

Query: 163 GLIS----NIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFV 218
            ++S    +IFHR+  K ++     I + L+ Q+ FE++QGF+LLFYGIGSKK FLE F 
Sbjct: 249 NILSQLSNDIFHRSSTKAVQK----IHETLFQQFTFELLQGFTLLFYGIGSKKKFLESFA 304

Query: 219 FKYLSPKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAEL- 277
           F +LS K+AL Q  ++   +        IPV V+NGY  T   +++F DI  +L   E  
Sbjct: 305 FNFLSMKIALLQNPDIQKDDP------CIPVFVMNGY--TTLSKNIFLDIFKILVEGETI 356

Query: 278 -TQSESKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLSLI 336
             Q +S +W N + + + +L  Y+K +P  +K+I+ IHN+DGP+ RR    T +S L+ I
Sbjct: 357 DDQGQSNYWDNRIDLQMDRLSKYFKKRPPTVKMILLIHNLDGPSFRREHFQTRMSILAQI 416

Query: 337 RQVAIVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQD-VMRLGKSENST- 394
           +Q+ +VAS DHI APFLWD+ RAQ++NFV+HD+TN+ PY  E+   D  +   K   +  
Sbjct: 417 KQICVVASVDHIQAPFLWDHFRAQSFNFVYHDITNFEPYIVETVQTDNAIDFSKDSGTLF 476

Query: 395 GAEGAKYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVEFKQL 454
            A GAKYVL+SLT NSK+MYK+L++  +  +   + +K   K  +S    ++ G+EF +L
Sbjct: 477 NANGAKYVLESLTDNSKRMYKILLQLLMGQINAKNESKPRAK--SSSLNKITPGIEFSEL 534

Query: 455 VHLCAADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKR 506
              C   F+ S+EM LR++L+EFI+HKMA  +KN +G E + V Y+Y +M++
Sbjct: 535 FKTCTEQFVVSSEMGLRTILSEFIDHKMAVNTKNKMGKEIINVKYSYGDMEK 586

>Sklu_2291.5 YGL094C, Contig c2291 9283-12280
          Length = 1000

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 11/76 (14%)

Query: 388 GKSENSTGAEGAKYVLQSLTLNSKKMYKLLIETQ---------LQHMEKVSTTKSTGKVA 438
           G S   TG +   Y L  +T+   K + +L   Q         ++ +  VS +KS+    
Sbjct: 196 GHSSVITGMDSVDYTL--VTVGKSKKFNMLFSDQFVNVYDLRIMKQLPPVSFSKSSDFAP 253

Query: 439 ASKRGTMSMGVEFKQL 454
           ++  GT SMG +F QL
Sbjct: 254 SANSGTFSMGADFVQL 269

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,206,306
Number of extensions: 692519
Number of successful extensions: 2365
Number of sequences better than 10.0: 19
Number of HSP's gapped: 2409
Number of HSP's successfully gapped: 19
Length of query: 506
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 400
Effective length of database: 12,926,601
Effective search space: 5170640400
Effective search space used: 5170640400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)