Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10208g1027101249390.0
Scas_661.27109549015010.0
Sklu_1752.285838814270.0
CAGL0K11990g99138513901e-176
KLLA0F18612g81439513441e-171
Kwal_27.1094593546713391e-169
AGR027C96137313361e-168
Kwal_27.115427913228237e-96
Scas_671.167233208039e-94
Sklu_2226.77953208019e-93
KLLA0E08371g7773227885e-91
YIL095W (PRK1)8103267896e-91
Scas_601.66613217797e-91
YNL020C (ARK1)6383197645e-89
ADL217W7503117691e-88
CAGL0G02607g6883237614e-88
CAGL0J03432g6223167442e-86
KLLA0C06138g7082852473e-21
Sklu_2419.96952892448e-21
Scas_644.157262852402e-20
KLLA0E21780g10162342395e-20
KLLA0F11319g8431942386e-20
Scas_700.288961992376e-20
ACL006W7082882368e-20
YMR001C (CDC5)7052952322e-19
CAGL0J11638g7462882313e-19
YPL150W9011982323e-19
Sklu_2361.38841952289e-19
Kwal_56.224766972912261e-18
Sklu_1962.23643342173e-18
CAGL0M02299g8932032233e-18
Kwal_56.242743463342154e-18
ACR133C8511942224e-18
Kwal_55.215458652432172e-17
Kwal_26.87518481962172e-17
Sklu_2419.105662232108e-17
YPL236C3643382059e-17
Scas_580.610152292056e-16
AFL101C3672381986e-16
CAGL0L11550g10722282047e-16
YHR102W (KIC1)10802792021e-15
Kwal_33.131125052331991e-15
Scas_707.369152222011e-15
ACL104C9472271984e-15
AEL230W6083171939e-15
Scas_660.286232481939e-15
AFR724C4402881901e-14
AFR696C11422731941e-14
KLLA0C01650g11122611931e-14
Scas_598.67902401885e-14
YDR477W (SNF1)6332451875e-14
KLLA0B02332g3612861836e-14
ABL034W14252281878e-14
YNL298W (CLA4)8422031869e-14
KLLA0A03806g6023171849e-14
CAGL0M08910g6122381841e-13
Kwal_47.182335982401831e-13
AEL205W7932031822e-13
CAGL0K05709g11032271832e-13
YOL100W (PKH2)10812311823e-13
CAGL0M10153g8671761813e-13
Kwal_26.715412131711823e-13
KLLA0A07403g8792411813e-13
AGR058W10711921814e-13
Kwal_26.735514463281789e-13
Sklu_2323.34002411741e-12
Kwal_23.52908192031761e-12
CAGL0K02673g9151761761e-12
AFR335C10331951761e-12
Kwal_23.632515422721761e-12
Kwal_26.778812672701761e-12
YDR507C (GIN4)11422301762e-12
Scas_564.712101931752e-12
CAGL0K02167g11622761752e-12
CAGL0K08514g14892561752e-12
YDR523C (SPS1)4902321722e-12
Kwal_47.1726311273021742e-12
Sklu_1603.24881831722e-12
YBR274W (CHK1)5271911713e-12
CAGL0J03872g6612611723e-12
YER129W (PAK1)11422031733e-12
Scas_685.245152291713e-12
YGL179C (TOS3)5602041713e-12
YPR054W (SMK1)3882611684e-12
CAGL0M03729g8612741715e-12
Scas_668.228931761715e-12
Scas_627.73492391675e-12
Scas_602.1111863411715e-12
KLLA0B13607g9891761716e-12
Scas_693.1710492051716e-12
Sklu_2086.42431251626e-12
Kwal_56.237178581931707e-12
AER264C14832691707e-12
YHR205W (SCH9)8242851697e-12
YOR233W (KIN4)8002021698e-12
YHL007C (STE20)9391761698e-12
Kwal_26.78619551761699e-12
ABR014W9711761691e-11
Scas_548.613821691691e-11
CAGL0I07513g10762321681e-11
CAGL0M11396g11922191681e-11
YAL017W (PSK1)13561231681e-11
KLLA0B03586g7342851662e-11
CAGL0H06259g13361661672e-11
YAR019C (CDC15)9742471672e-11
KLLA0F13552g12672281672e-11
YPL141C8652591662e-11
Scas_703.57492851662e-11
CAGL0B01925g9441931662e-11
Kwal_56.226939841971662e-11
Sklu_2366.54662501633e-11
Sklu_2073.311822121653e-11
Scas_493.211172621653e-11
Scas_458.13673451613e-11
CAGL0F09075g7462851643e-11
CAGL0G09020g3611501603e-11
CAGL0E05720g3582981604e-11
Scas_643.2010822481644e-11
YDL028C (MPS1)7643201634e-11
YKL101W (HSL1)15182581644e-11
YJL095W (BCK1)14783281644e-11
Scas_675.25271871615e-11
YLR096W (KIN2)11471931635e-11
ADL389W7112851625e-11
ACR196C5302061615e-11
KLLA0C00979g4832081606e-11
CAGL0F00913g12061231627e-11
KLLA0C12485g9252191617e-11
Scas_477.57031881608e-11
KLLA0E17127g8521901609e-11
YCR073C (SSK22)13312531619e-11
YCL024W (KCC4)10371731601e-10
CAGL0G04609g9652061601e-10
KLLA0F14190g13383021601e-10
YDR122W (KIN1)10641921591e-10
KLLA0C08525g15512541591e-10
KLLA0F19536g11041921591e-10
YDR490C (PKH1)7662011581e-10
Sklu_2186.45212341571e-10
ACL053C11812861582e-10
Kwal_47.167617442881582e-10
Kwal_27.125594141831562e-10
KLLA0F07623g12291231582e-10
KLLA0B11902g4952341562e-10
YPL203W (TPK2)3802871552e-10
KLLA0C03828g7932561572e-10
Scas_711.2515152621572e-10
YOL045W (PSK2)11011691572e-10
Kwal_55.203267502331563e-10
Kwal_26.87098291431563e-10
Scas_616.1014611731573e-10
Kwal_23.566816891951563e-10
Scas_502.211162181563e-10
Scas_544.64892011543e-10
YPL209C (IPL1)3672641524e-10
YJL164C (TPK1)3972921534e-10
Sklu_2066.26392611544e-10
YDL159W (STE7)5152021544e-10
CAGL0L03520g14473171554e-10
Kwal_56.240913812021515e-10
Scas_700.348642701546e-10
AEL284C4791791526e-10
Scas_651.183712751507e-10
AAR009W4531991517e-10
KLLA0B13112g7301871528e-10
Sklu_2437.1610711941538e-10
ADR300C8901911528e-10
CAGL0H01639g5212841518e-10
AER232C5692351519e-10
ACR281C12591711529e-10
CAGL0F03311g10451941511e-09
Sklu_2211.511752781511e-09
Scas_720.9416832601512e-09
CAGL0C03509g8953021502e-09
ACL054W9723231502e-09
AEL115C3861391472e-09
Sklu_1995.27291871482e-09
Scas_629.169182941492e-09
Kwal_56.240593532951462e-09
Scas_715.3411501431492e-09
YPL140C (MKK2)5061781473e-09
Scas_688.144792341463e-09
YHR082C (KSP1)10291931483e-09
KLLA0D03190g3722641453e-09
Kwal_56.245844351961463e-09
ACR117W5242381463e-09
CAGL0I03498g4512461463e-09
ADL315C4341841463e-09
Kwal_27.100047351591473e-09
CAGL0J03828g4672211453e-09
Scas_640.14*7281791474e-09
Scas_673.20*7581981464e-09
CAGL0C05005g10762501474e-09
Kwal_27.1058111541851474e-09
Scas_640.165052421454e-09
Kwal_33.138463751321444e-09
YBL105C (PKC1)11511851464e-09
YDR283C (GCN2)16591951465e-09
KLLA0D07304g4652171445e-09
AFR377C7262001456e-09
KLLA0D09328g10461991456e-09
CAGL0J00539g4882371446e-09
YNR047W8933041456e-09
Kwal_33.141678383151447e-09
Scas_713.216413311447e-09
ACR119W9312291447e-09
AER223C9022261448e-09
CAGL0M02519g7562021448e-09
KLLA0B11946g4391821428e-09
YOL113W (SKM1)6552431438e-09
AFL090W3461281419e-09
Sklu_1843.34861831429e-09
Kwal_33.144347592341431e-08
YKL166C (TPK3)3981281411e-08
KLLA0F01276g5191861421e-08
CAGL0M08404g4622561411e-08
YDL101C (DUN1)5132581421e-08
KLLA0C18568g7743021431e-08
ADR313W5781421421e-08
KLLA0E15378g7242611421e-08
KLLA0A02497g3621791401e-08
CAGL0B02739g6761901421e-08
KLLA0D07348g9091151421e-08
Kwal_27.97638682471421e-08
Scas_633.297892661411e-08
YKL126W (YPK1)6801501412e-08
Scas_689.25*4091271392e-08
ACR191C11491431412e-08
YKL048C (ELM1)6401841402e-08
Scas_653.256661931402e-08
ABL028W7221501402e-08
Scas_667.184371961392e-08
CAGL0M09361g11441431402e-08
KLLA0E07414g3652031372e-08
YJL187C (SWE1)8192281402e-08
AFR092W14232621403e-08
KLLA0D08415g7742341393e-08
Scas_690.133542711373e-08
CAGL0K03399g7031871393e-08
KLLA0C04191g7972471393e-08
KLLA0B07205g4551281373e-08
Scas_610.76682101383e-08
Kwal_26.87034442081374e-08
Scas_717.696741861384e-08
ADR317C8192741384e-08
CAGL0C02893g6491661374e-08
Kwal_47.172528722711375e-08
Kwal_26.89416611411375e-08
Kwal_55.220013632061355e-08
CAGL0K07458g7041691375e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10208g
         (1012 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...  1907   0.0  
Scas_661.27                                                           582   0.0  
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement         554   0.0  
CAGL0K11990g complement(1155395..1158370) some similarities with...   540   e-176
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...   522   e-171
Kwal_27.10945                                                         520   e-169
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...   519   e-168
Kwal_27.11542                                                         321   7e-96
Scas_671.16                                                           313   9e-94
Sklu_2226.7 YIL095W, Contig c2226 8986-11373                          313   9e-93
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...   308   5e-91
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...   308   6e-91
Scas_601.6                                                            304   7e-91
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...   298   5e-89
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...   300   1e-88
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...   297   4e-88
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...   291   2e-86
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   100   3e-21
Sklu_2419.9 YMR001C, Contig c2419 14049-16136                          99   8e-21
Scas_644.15                                                            97   2e-20
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    97   5e-20
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    96   6e-20
Scas_700.28                                                            96   6e-20
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    96   8e-20
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    94   2e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    94   3e-19
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    94   3e-19
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            92   9e-19
Kwal_56.22476                                                          92   1e-18
Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement          88   3e-18
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    91   3e-18
Kwal_56.24274                                                          87   4e-18
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    90   4e-18
Kwal_55.21545                                                          88   2e-17
Kwal_26.8751                                                           88   2e-17
Sklu_2419.10 , Contig c2419 14439-16135                                86   8e-17
YPL236C (YPL236C) [5213] chr16 complement(101608..102702) Serine...    84   9e-17
Scas_580.6                                                             84   6e-16
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    81   6e-16
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    83   7e-16
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    82   1e-15
Kwal_33.13112                                                          81   1e-15
Scas_707.36                                                            82   1e-15
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    81   4e-15
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    79   9e-15
Scas_660.28                                                            79   9e-15
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    78   1e-14
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    79   1e-14
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    79   1e-14
Scas_598.6                                                             77   5e-14
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    77   5e-14
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    75   6e-14
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    77   8e-14
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    76   9e-14
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    75   9e-14
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    75   1e-13
Kwal_47.18233                                                          75   1e-13
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    75   2e-13
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    75   2e-13
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    75   3e-13
CAGL0M10153g complement(1010688..1013291) some similarities with...    74   3e-13
Kwal_26.7154                                                           75   3e-13
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    74   3e-13
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    74   4e-13
Kwal_26.7355                                                           73   9e-13
Sklu_2323.3 YPL209C, Contig c2323 5241-6443                            72   1e-12
Kwal_23.5290                                                           72   1e-12
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    72   1e-12
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    72   1e-12
Kwal_23.6325                                                           72   1e-12
Kwal_26.7788                                                           72   1e-12
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    72   2e-12
Scas_564.7                                                             72   2e-12
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    72   2e-12
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    72   2e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    71   2e-12
Kwal_47.17263                                                          72   2e-12
Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement         71   2e-12
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    70   3e-12
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    71   3e-12
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    71   3e-12
Scas_685.24                                                            70   3e-12
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    70   3e-12
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    69   4e-12
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    70   5e-12
Scas_668.22                                                            70   5e-12
Scas_627.7                                                             69   5e-12
Scas_602.11                                                            70   5e-12
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    70   6e-12
Scas_693.17                                                            70   6e-12
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                67   6e-12
Kwal_56.23717                                                          70   7e-12
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    70   7e-12
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    70   7e-12
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    70   8e-12
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    70   8e-12
Kwal_26.7861                                                           70   9e-12
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    70   1e-11
Scas_548.6                                                             70   1e-11
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    69   1e-11
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   1e-11
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    69   1e-11
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    69   2e-11
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    69   2e-11
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    69   2e-11
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    69   2e-11
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    69   2e-11
Scas_703.5                                                             69   2e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    69   2e-11
Kwal_56.22693                                                          69   2e-11
Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement       67   3e-11
Sklu_2073.3 YER129W, Contig c2073 2194-5742                            68   3e-11
Scas_493.2                                                             68   3e-11
Scas_458.1                                                             67   3e-11
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    68   3e-11
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    66   3e-11
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    66   4e-11
Scas_643.20                                                            68   4e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    67   4e-11
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    68   4e-11
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    68   4e-11
Scas_675.2                                                             67   5e-11
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    67   5e-11
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    67   5e-11
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    67   5e-11
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    66   6e-11
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    67   7e-11
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    67   7e-11
Scas_477.5                                                             66   8e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    66   9e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    67   9e-11
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    66   1e-10
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    66   1e-10
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    66   1e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    66   1e-10
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    66   1e-10
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    66   1e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    65   1e-10
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         65   1e-10
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    65   2e-10
Kwal_47.16761                                                          65   2e-10
Kwal_27.12559                                                          65   2e-10
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    65   2e-10
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    65   2e-10
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    64   2e-10
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    65   2e-10
Scas_711.25                                                            65   2e-10
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    65   2e-10
Kwal_55.20326                                                          65   3e-10
Kwal_26.8709                                                           65   3e-10
Scas_616.10                                                            65   3e-10
Kwal_23.5668                                                           65   3e-10
Scas_502.2                                                             65   3e-10
Scas_544.6                                                             64   3e-10
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    63   4e-10
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    64   4e-10
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            64   4e-10
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    64   4e-10
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    64   4e-10
Kwal_56.24091                                                          63   5e-10
Scas_700.34                                                            64   6e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    63   6e-10
Scas_651.18                                                            62   7e-10
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    63   7e-10
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    63   8e-10
Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement      64   8e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    63   8e-10
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    63   8e-10
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    63   9e-10
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    63   9e-10
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    63   1e-09
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          63   1e-09
Scas_720.94                                                            63   2e-09
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    62   2e-09
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    62   2e-09
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    61   2e-09
Sklu_1995.2 YLR362W, Contig c1995 1578-3767                            62   2e-09
Scas_629.16                                                            62   2e-09
Kwal_56.24059                                                          61   2e-09
Scas_715.34                                                            62   2e-09
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    61   3e-09
Scas_688.14                                                            61   3e-09
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    62   3e-09
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    60   3e-09
Kwal_56.24584                                                          61   3e-09
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    61   3e-09
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    61   3e-09
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    61   3e-09
Kwal_27.10004                                                          61   3e-09
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    60   3e-09
Scas_640.14*                                                           61   4e-09
Scas_673.20*                                                           61   4e-09
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    61   4e-09
Kwal_27.10581                                                          61   4e-09
Scas_640.16                                                            60   4e-09
Kwal_33.13846                                                          60   4e-09
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    61   4e-09
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    61   5e-09
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    60   5e-09
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    60   6e-09
KLLA0D09328g complement(788565..791705) some similarities with s...    60   6e-09
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    60   6e-09
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    60   6e-09
Kwal_33.14167                                                          60   7e-09
Scas_713.21                                                            60   7e-09
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    60   7e-09
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    60   8e-09
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    60   8e-09
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    59   8e-09
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    60   8e-09
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    59   9e-09
Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement         59   9e-09
Kwal_33.14434                                                          60   1e-08
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    59   1e-08
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    59   1e-08
CAGL0M08404g complement(836791..838179) some similarities with s...    59   1e-08
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    59   1e-08
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    60   1e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    59   1e-08
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    59   1e-08
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    59   1e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    59   1e-08
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    59   1e-08
Kwal_27.9763                                                           59   1e-08
Scas_633.29                                                            59   1e-08
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    59   2e-08
Scas_689.25*                                                           58   2e-08
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    59   2e-08
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    59   2e-08
Scas_653.25                                                            59   2e-08
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    59   2e-08
Scas_667.18                                                            58   2e-08
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    59   2e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    57   2e-08
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    59   2e-08
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    59   3e-08
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    58   3e-08
Scas_690.13                                                            57   3e-08
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    58   3e-08
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    58   3e-08
KLLA0B07205g complement(624606..625973) some similarities with s...    57   3e-08
Scas_610.7                                                             58   3e-08
Kwal_26.8703                                                           57   4e-08
Scas_717.69                                                            58   4e-08
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    58   4e-08
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    57   4e-08
Kwal_47.17252                                                          57   5e-08
Kwal_26.8941                                                           57   5e-08
Kwal_55.22001                                                          57   5e-08
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    57   5e-08
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    57   5e-08
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    57   6e-08
Kwal_33.14192                                                          57   7e-08
Scas_707.34                                                            57   7e-08
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    57   7e-08
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    57   8e-08
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    57   8e-08
CAGL0H00979g complement(94328..95527) similar to tr|Q12003 Sacch...    56   8e-08
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    57   8e-08
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    57   8e-08
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    57   8e-08
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    57   8e-08
Kwal_0.96                                                              56   9e-08
Kwal_33.14081                                                          56   9e-08
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    56   1e-07
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    55   1e-07
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    56   1e-07
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    55   1e-07
Kwal_14.1416                                                           55   1e-07
Scas_700.35                                                            56   1e-07
Kwal_17.2687                                                           55   1e-07
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    56   1e-07
Scas_721.124                                                           56   1e-07
Scas_718.90                                                            56   1e-07
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    56   1e-07
Scas_720.103                                                           56   1e-07
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    56   1e-07
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    56   1e-07
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    55   1e-07
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    55   2e-07
Kwal_26.8347                                                           55   2e-07
Kwal_55.20189                                                          55   2e-07
Kwal_26.7635                                                           55   2e-07
Scas_336.1                                                             55   2e-07
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    55   2e-07
Scas_692.24                                                            55   2e-07
Scas_582.1                                                             55   2e-07
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        55   2e-07
Scas_683.12                                                            55   2e-07
KLLA0C16577g complement(1451181..1452695) some similarities with...    55   2e-07
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    55   2e-07
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    55   2e-07
Scas_678.24                                                            55   2e-07
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement          55   2e-07
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         55   2e-07
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    55   2e-07
Scas_584.11                                                            55   2e-07
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    55   2e-07
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    55   2e-07
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    54   2e-07
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    55   2e-07
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    55   3e-07
Scas_201.1*                                                            54   3e-07
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    55   3e-07
Scas_623.11                                                            54   3e-07
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    54   3e-07
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           55   4e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    54   4e-07
Kwal_23.5576                                                           54   4e-07
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    54   4e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   4e-07
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    54   4e-07
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        54   4e-07
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    54   4e-07
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    54   5e-07
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    54   5e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    54   5e-07
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    54   5e-07
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    54   5e-07
Kwal_23.6458                                                           54   5e-07
Scas_635.1                                                             53   5e-07
Kwal_47.17868                                                          53   6e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    54   6e-07
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    54   6e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    54   6e-07
Scas_593.14d                                                           53   7e-07
Kwal_23.3590                                                           53   7e-07
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    52   8e-07
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    53   9e-07
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    53   9e-07
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    53   9e-07
Scas_619.5*                                                            53   1e-06
Sklu_1886.2 YDL025C, Contig c1886 2790-4733                            53   1e-06
Scas_655.2                                                             53   1e-06
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    53   1e-06
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    52   1e-06
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    53   1e-06
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    52   1e-06
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    53   1e-06
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    53   1e-06
Sklu_2255.4 YGR040W, Contig c2255 6834-7940 reverse complement         52   2e-06
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    52   2e-06
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    52   2e-06
Scas_710.28                                                            52   2e-06
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    52   2e-06
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    52   2e-06
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    52   2e-06
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    52   2e-06
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    52   2e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    52   2e-06
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    52   3e-06
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    52   3e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    51   3e-06
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    51   3e-06
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    52   3e-06
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    51   3e-06
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...    51   4e-06
Kwal_56.23841                                                          51   4e-06
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    51   4e-06
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    51   4e-06
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    51   4e-06
CAGL0K01661g complement(146952..148400) some similarities with t...    51   4e-06
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    50   4e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    50   4e-06
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    50   4e-06
Scas_618.8                                                             51   4e-06
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    51   4e-06
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    51   4e-06
Kwal_14.2497                                                           50   4e-06
Sklu_2307.1 YPL042C, Contig c2307 215-1945                             51   4e-06
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            50   5e-06
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    51   5e-06
Kwal_14.1273                                                           50   5e-06
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         50   5e-06
Kwal_27.11919                                                          49   5e-06
Scas_683.6                                                             50   5e-06
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 50   5e-06
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    50   5e-06
KLLA0B06501g complement(576636..579089) some similarities with s...    51   6e-06
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    50   6e-06
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    50   6e-06
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    50   6e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    50   6e-06
Sklu_2417.13 YMR139W, Contig c2417 24824-25915 reverse complement      50   6e-06
Scas_634.5                                                             50   7e-06
Scas_713.7                                                             50   7e-06
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    50   8e-06
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    50   8e-06
Scas_711.15                                                            50   8e-06
Kwal_27.9773                                                           50   9e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    50   9e-06
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    50   1e-05
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    50   1e-05
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    49   1e-05
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    49   1e-05
Kwal_33.13222                                                          47   1e-05
YPR161C (SGV1) [5576] chr16 complement(864443..866416) Serine/th...    49   1e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   1e-05
Kwal_33.13681                                                          49   1e-05
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    49   1e-05
Scas_713.38                                                            49   1e-05
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    49   2e-05
Scas_660.20                                                            49   2e-05
Kwal_27.11830                                                          49   2e-05
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    48   2e-05
Kwal_55.21900                                                          49   2e-05
Scas_613.5                                                             48   3e-05
Scas_680.20                                                            48   3e-05
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    48   3e-05
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    48   3e-05
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    48   3e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    47   3e-05
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         48   4e-05
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            48   4e-05
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    48   4e-05
Scas_698.37                                                            47   4e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    48   4e-05
Kwal_26.7682                                                           48   4e-05
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    47   5e-05
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    47   5e-05
Kwal_56.22788                                                          47   5e-05
Kwal_26.7552                                                           47   5e-05
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    47   5e-05
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    47   6e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    48   6e-05
Kwal_55.20221                                                          47   7e-05
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    47   7e-05
Kwal_33.13831                                                          47   7e-05
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    46   7e-05
Scas_651.19                                                            47   8e-05
CAGL0M08360g complement(833220..835520) some similarities with s...    47   8e-05
Scas_677.18                                                            47   9e-05
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    47   9e-05
Kwal_47.18307                                                          47   1e-04
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         47   1e-04
Kwal_26.7276                                                           47   1e-04
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    46   1e-04
Scas_721.132                                                           46   1e-04
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    46   1e-04
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    46   1e-04
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    46   1e-04
Scas_721.61                                                            46   1e-04
Scas_654.12                                                            46   1e-04
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    46   1e-04
Scas_22.1                                                              45   1e-04
YPL026C (SKS1) [5412] chr16 complement(500671..502179) Serine/th...    46   1e-04
Scas_721.110                                                           46   2e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    45   2e-04
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    45   2e-04
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    44   3e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    45   3e-04
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             44   3e-04
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    45   3e-04
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    45   3e-04
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    45   4e-04
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    44   4e-04
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    44   5e-04
Scas_721.46                                                            44   5e-04
Kwal_0.307                                                             44   5e-04
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    44   5e-04
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    44   5e-04
Kwal_33.14554                                                          44   6e-04
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    44   6e-04
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    44   6e-04
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    43   7e-04
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    44   7e-04
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    43   7e-04
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    44   7e-04
Scas_628.9                                                             44   8e-04
Sklu_2442.21 YLR248W, Contig c2442 39541-41052 reverse complement      44   8e-04
Kwal_23.3471                                                           43   8e-04
Sklu_2392.6 YNL161W, Contig c2392 12867-15293 reverse complement       44   0.001
Scas_568.13                                                            43   0.001
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...    43   0.001
Sklu_1987.1 YBL016W, Contig c1987 623-1996                             43   0.001
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    43   0.001
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    43   0.001
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...    43   0.001
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    42   0.001
Sklu_2232.2 YOR061W, Contig c2232 1216-2340 reverse complement         42   0.001
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    42   0.001
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    42   0.001
Scas_584.8                                                             43   0.002
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    43   0.002
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    42   0.002
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    43   0.002
Scas_568.9*                                                            42   0.002
Scas_704.50                                                            42   0.002
Scas_649.30                                                            42   0.002
Scas_684.28                                                            42   0.002
Scas_613.13*                                                           42   0.002
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    42   0.003
Kwal_47.18098                                                          41   0.003
KLLA0E11979g complement(1060048..1061892) some similarities with...    42   0.003
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    41   0.003
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    42   0.004
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    41   0.004
Sklu_1851.1 YJL106W, Contig c1851 2732-4783 reverse complement         42   0.004
Scas_707.3                                                             42   0.004
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    41   0.004

>CAGL0H10208g complement(996853..999936) similar to sp|P38080
            Saccharomyces cerevisiae YBR059c AKL1 Ark-family
            Kinase-Like protein, hypothetical start
          Length = 1027

 Score = 1907 bits (4939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 937/1012 (92%), Positives = 937/1012 (92%)

Query: 1    MERPNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFE 60
            MERPNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFE
Sbjct: 1    MERPNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFE 60

Query: 61   SLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDG 120
            SLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDG
Sbjct: 61   SLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDG 120

Query: 121  KPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRD 180
            KPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRD
Sbjct: 121  KPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRD 180

Query: 181  IKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYR 240
            IKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYR
Sbjct: 181  IKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYR 240

Query: 241  YLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLA 300
            YLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLA
Sbjct: 241  YLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLA 300

Query: 301  ENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNX 360
            ENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQN 
Sbjct: 301  ENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNK 360

Query: 361  XXXXXXXXXXEDGLVLDELYIKTFEMIPKIPNPRLSEKQPTLEIGLNSPSIQDQHLDVNN 420
                      EDGLVLDELYIKTFEMIPKIPNPRLSEKQPTLEIGLNSPSIQDQHLDVNN
Sbjct: 361  VVSSKSKLSKEDGLVLDELYIKTFEMIPKIPNPRLSEKQPTLEIGLNSPSIQDQHLDVNN 420

Query: 421  KRRSMHESINSRQASDNISQKSVRTSSNTIEKTFSQTSNKEFSKETDPESHDESGEPYFP 480
            KRRSMHESINSRQASDNISQKSVRTSSNTIEKTFSQTSNKEFSKETDPESHDESGEPYFP
Sbjct: 421  KRRSMHESINSRQASDNISQKSVRTSSNTIEKTFSQTSNKEFSKETDPESHDESGEPYFP 480

Query: 481  SVNELNTYLDKEFKQQKAQDNVVKNQIIXXXXXXXXXXXPERQXXXXXXXXXXXXXXXXX 540
            SVNELNTYLDKEFKQQKAQDNVVKNQII           PERQ                 
Sbjct: 481  SVNELNTYLDKEFKQQKAQDNVVKNQIINNSGGNMNSSNPERQKSISSFSSSGKSMKSSS 540

Query: 541  XXXXAGFVGADATEGPKMVGYLKSQNHKSNNPFPFMAGDRQRSTESLNNKHNNYDANNTT 600
                AGFVGADATEGPKMVGYLKSQNHKSNNPFPFMAGDRQRSTESLNNKHNNYDANNTT
Sbjct: 541  HVPSAGFVGADATEGPKMVGYLKSQNHKSNNPFPFMAGDRQRSTESLNNKHNNYDANNTT 600

Query: 601  APVKGNYGGIQANNIPSQPKNFEYNNPVNDTNRIQDTGIGQSAGRPQNVSQFSNTKMNFV 660
            APVKGNYGGIQANNIPSQPKNFEYNNPVNDTNRIQDTGIGQSAGRPQNVSQFSNTKMNFV
Sbjct: 601  APVKGNYGGIQANNIPSQPKNFEYNNPVNDTNRIQDTGIGQSAGRPQNVSQFSNTKMNFV 660

Query: 661  PGTNMSVNFDVTNPINQHNIPISQGVVNNSGVPSNQGFHNKVPLPNAGSNYIPFPPRPQM 720
            PGTNMSVNFDVTNPINQHNIPISQGVVNNSGVPSNQGFHNKVPLPNAGSNYIPFPPRPQM
Sbjct: 661  PGTNMSVNFDVTNPINQHNIPISQGVVNNSGVPSNQGFHNKVPLPNAGSNYIPFPPRPQM 720

Query: 721  MQQSYEAPQKQMQKYDQVYHEQPSQQNAYINTTPQEVQNEQLLIDISPPRDIKRTSSPQK 780
            MQQSYEAPQKQMQKYDQVYHEQPSQQNAYINTTPQEVQNEQLLIDISPPRDIKRTSSPQK
Sbjct: 721  MQQSYEAPQKQMQKYDQVYHEQPSQQNAYINTTPQEVQNEQLLIDISPPRDIKRTSSPQK 780

Query: 781  ELSNVKTHAPQVLDLQLNEMDISEASIADSSNGNXXXXXXXXXXXXXXXXTNRLKMHYPF 840
            ELSNVKTHAPQVLDLQLNEMDISEASIADSSNGN                TNRLKMHYPF
Sbjct: 781  ELSNVKTHAPQVLDLQLNEMDISEASIADSSNGNDVDSSLLSSESVDLDVTNRLKMHYPF 840

Query: 841  GNQRQTKLAQKPIQSKVKDTDKQQKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGI 900
            GNQRQTKLAQKPIQSKVKDTDKQQKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGI
Sbjct: 841  GNQRQTKLAQKPIQSKVKDTDKQQKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGI 900

Query: 901  KGSMSEESVEDTIKSLPPSNTLPRSQSSKVISQSTNARTSLDRQRQRHIEPRDSKSRSRS 960
            KGSMSEESVEDTIKSLPPSNTLPRSQSSKVISQSTNARTSLDRQRQRHIEPRDSKSRSRS
Sbjct: 901  KGSMSEESVEDTIKSLPPSNTLPRSQSSKVISQSTNARTSLDRQRQRHIEPRDSKSRSRS 960

Query: 961  HGLEEYXXXXXXXXXXXXXXXXKFEMKRSFAKARQSLDLERARRDAMSRSNS 1012
            HGLEEY                KFEMKRSFAKARQSLDLERARRDAMSRSNS
Sbjct: 961  HGLEEYTSSNGSNSSINISTSNKFEMKRSFAKARQSLDLERARRDAMSRSNS 1012

>Scas_661.27
          Length = 1095

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/490 (59%), Positives = 365/490 (74%), Gaps = 13/490 (2%)

Query: 15  PNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIA 74
           PN E+Y  G  ++VGAH+VEI+ Y+AEGGFAQIY VKF+E+LNEFE+   K  + +GD+A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 75  CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP 134
           CLKRV+V DE GLNEMRNEVEVMK+L+ +PNIVQY+DSNASRR +G PGFEVLLLMELCP
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136

Query: 135 NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194
           NKSLLDYMNQRL TKL+E EILKIMYDV+  +S MHYL  PL+HRDIKIENVLVDA NNF
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254
           KLCD GSTS   P + ++QDIA++TQNIYVHTTPQYR+PEMIDLYR LPI+EKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 255 IFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVY 314
           IFLYKLLF+TTPFE+TGQ AILHSKY+FP N YSSK+INLIIIMLAENPNLRPNI+QV++
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKNNYSSKLINLIIIMLAENPNLRPNIYQVLH 316

Query: 315 HICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNXXXXXXXXXXXEDGL 374
           +ICSI  + VPIED+Y  GPY+F+ YT FQ+KVQ++Q Q+  LQ             D  
Sbjct: 317 NICSISGMKVPIEDQYAEGPYDFEKYTHFQNKVQSVQYQLYLLQEKKFKTNGKLPQADIN 376

Query: 375 VLDELYIKTFEMIPKIPNPRLSEKQPT------LEIGLNSPSIQDQHLDVNNKRRS---M 425
           +L++L++ +F++  K+P      K PT       EI  ++ + Q+Q  +  N   +   +
Sbjct: 377 LLNDLFVTSFDIASKVP---FELKVPTPLPGYSAEIPESNFAKQEQQYEPRNIPTAGDYL 433

Query: 426 HESINSRQASDNISQKSVRTSSNTIE-KTFSQTSNKEFSKETDPESHDESGEPYFPSVNE 484
           +E+  S  ++D +S+ +  T+  + +  T S    KE   E  P    E+ E YFP+V E
Sbjct: 434 NENRKSFTSNDALSRHTSNTADTSRDIATPSNFEKKENVNEKSPGKPIENTEQYFPTVGE 493

Query: 485 LNTYLDKEFK 494
           L+ YLD E K
Sbjct: 494 LDYYLDNELK 503

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 131/337 (38%), Gaps = 65/337 (19%)

Query: 715  PPRPQMMQQSYEAPQKQMQKYDQVYHEQPSQQNAYINTTPQEVQNEQLLIDISPPRDI-- 772
            PP PQ    +   P+ Q            SQ    +   P + + EQLLID+SPPRD+  
Sbjct: 768  PPHPQTKSGTTLPPRPQ------------SQNPPKVPPHPSKEKEEQLLIDLSPPRDLPG 815

Query: 773  ---KRTSSPQKELSNVKTHAPQVLDLQ-------LNEMDISEASIADS-SNGNXXXXXXX 821
               + ++SP +   +    A + L L        LN  D+S A + +S S G        
Sbjct: 816  RKPRESTSPLRLEDDTSRMARRSLSLNNPKRQVTLNLSDMSNAEVMESFSTGGVESSVAS 875

Query: 822  XXXXXXXXXTNRLKMHYPFGNQRQTKLAQK---------------PIQSKVKDTDK---Q 863
                          M +  G Q    LA+                P +  +K  D+   +
Sbjct: 876  TESINLDLE----DMKHKKGGQEDDNLAEMVARRSIEERETPLNVPKRENLKQKDENRLE 931

Query: 864  QKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGIKGSMSEESVEDTIKSLPPSNTLP 923
               GRRSLDL  QE++F+ +  K+    N +T    I     +ESV +    L  +    
Sbjct: 932  NITGRRSLDLRYQEINFSPDLRKDK--SNSSTSVHHISSIREDESVNEDDSELTLTENEK 989

Query: 924  RSQSSKVISQSTNARTSLDRQRQRHIEPRDSKSRSRSHG-------LEEYXXXXXXXXXX 976
            R +      Q T+  +S +   +         +RS S G       LE Y          
Sbjct: 990  RQRQQPRHHQHTHFDSSSNLNSK-------GANRSSSRGNIRGKQDLESYKHSTKNNSNS 1042

Query: 977  XX--XXXXKFEMKRSFAKARQSLDLERARRDAMSRSN 1011
                      EMK+SFAKARQSLDLER RR+A+  S+
Sbjct: 1043 SIPISTTNTNEMKKSFAKARQSLDLERVRREALLNSD 1079

>Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement
          Length = 858

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/388 (68%), Positives = 311/388 (80%), Gaps = 15/388 (3%)

Query: 6   SRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSK 65
           +RS +S  SP  EK   G +I VG+H+VEIV YLAEGGFA IYVVKFVE+ NE E+    
Sbjct: 18  TRSASSSASPTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELET--PS 75

Query: 66  SAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE 125
           S++  GD+ACLKRV+V DE GLNE+RNEVEVMK+LK+S NIVQY+DSNASRR DG PG+E
Sbjct: 76  SSLKEGDLACLKRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYE 135

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           VLLLMELCPNKSLLDYMNQRL TKLSE E+LKIMYDV+  ++ MH+L  PLIHRDIKIEN
Sbjct: 136 VLLLMELCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIEN 195

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           VLVD+ NNFKLCD GSTS C P M ++QDIA++T NIYVHTTPQYRAPEMIDLYR LPI+
Sbjct: 196 VLVDSENNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPID 255

Query: 246 EKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNL 305
           EKSDIWALGIFLYKLLFYTTPFE+TGQ AILHSKYD P N YSSK+INLIIIMLAENPNL
Sbjct: 256 EKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYDIPANNYSSKLINLIIIMLAENPNL 315

Query: 306 RPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQ--INYLQNXXXX 363
           RPNI+QV+Y +C+IM + VP ED+Y  GPY+FD Y+K+Q K+Q  Q Q  I+Y Q     
Sbjct: 316 RPNIYQVIYQVCAIMKVDVPFEDKYQTGPYDFDKYSKYQEKLQAFQYQLYISYHQK---- 371

Query: 364 XXXXXXXEDGLVLDELYIKTFEMIPKIP 391
                  +D   L++L+I  FE+ PK P
Sbjct: 372 -------QDVDTLNDLFINCFEIAPKQP 392

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 22/28 (78%)

Query: 985  EMKRSFAKARQSLDLERARRDAMSRSNS 1012
            EM++S ++AR+SLDLE  +R++   S++
Sbjct: 818  EMRKSLSRARKSLDLEGVKRESAGGSDT 845

>CAGL0K11990g complement(1155395..1158370) some similarities with
           sp|P38080 Saccharomyces cerevisiae YBR059c AKL1
           Ark-family Kinase-Like protein, hypothetical start
          Length = 991

 Score =  540 bits (1390), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 249/385 (64%), Positives = 307/385 (79%), Gaps = 10/385 (2%)

Query: 17  EEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSA---ITVGDI 73
           EEK+P G++++VG+HRVE+VSYLAEGGFAQIYVVKFVEY NEFE    +S    +  G  
Sbjct: 93  EEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSP 152

Query: 74  ACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKP----GFEVLLL 129
           ACLKRV+V DE+GLN+MR+EVEVMKKL+ +PNIVQYFDSNASR  D       GFEVLLL
Sbjct: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212

Query: 130 MELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVD 189
           MELCPNKSLLDYMNQRL TKL+E EI KIMYD+++ ++ MHYL  PLIHRDIKIENVLVD
Sbjct: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272

Query: 190 ANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSD 249
           ANNNFKLCD GSTS C P   S QDIAM++Q++Y+HTTPQYR+PEMIDL++Y+PINEKSD
Sbjct: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332

Query: 250 IWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNI 309
           IWALG+FLYKLLF+TTPFE TGQ A+LHSK++FPPN YSSK+INLII+MLAENP+LRPNI
Sbjct: 333 IWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNI 392

Query: 310 FQVVYHICSIMNLPVP---IEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNXXXXXXX 366
           +QV+Y++  + N  VP   + D+YG GPYNF+ YT+FQ + Q +Q Q++ LQ        
Sbjct: 393 YQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDPNS 452

Query: 367 XXXXEDGLVLDELYIKTFEMIPKIP 391
                D  + D +Y+  F ++P++P
Sbjct: 453 TMQPADWELYDRMYMSAFTIVPQLP 477

>KLLA0F18612g 1711131..1713575 some similarities with sp|P38080
           Saccharomyces cerevisiae YBR059c AKL1 Ark-family
           Kinase-Like protein, hypothetical start
          Length = 814

 Score =  522 bits (1344), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 254/395 (64%), Positives = 303/395 (76%), Gaps = 10/395 (2%)

Query: 1   MERPNSRSMTSLNS---PNEEKY-PNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYL 56
           + RPNS + T+  S   PN     PN Q++ VG HR EI+ +LAEGGFA IY VKF+E  
Sbjct: 7   ISRPNSVAHTAATSAMIPNSHLLSPNTQVV-VGTHRCEILEHLAEGGFANIYKVKFLELT 65

Query: 57  NEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASR 116
           NE ++      +  GDIACLKRVIV DE GLNE+RNEVE MK+L+ SPNIVQY+DSNASR
Sbjct: 66  NEMDAGIDSKLLKAGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASR 125

Query: 117 RTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPL 176
             DG PGFE+LLLMELCP KSLLDYMN +L TKL+E+EILKIMYDVS  I+ MHYL  PL
Sbjct: 126 HPDGSPGFEILLLMELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPL 185

Query: 177 IHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI 236
           IHRDIKIENVLVD ++NFKLCD GSTS C P + ++QDIA++T NIYVHTTPQYR+PEMI
Sbjct: 186 IHRDIKIENVLVDKDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMI 245

Query: 237 DLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLII 296
           DLYR LPINEKSDIWALGIFLYKLLFYTTPFE+TGQ AILHSKY+ P N YSSK+INLII
Sbjct: 246 DLYRCLPINEKSDIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNGYSSKLINLII 305

Query: 297 IMLAENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINY 356
           IMLAENP+LRPNI+QV++H+CSI+   VP  D+Y LGPY+F  Y+++  K+Q IQ Q+  
Sbjct: 306 IMLAENPSLRPNIYQVMHHVCSILKCDVPFTDKYELGPYDFAKYSQYHLKLQQIQYQMFE 365

Query: 357 LQNXXXXXXXXXXXEDGLVLDELYIKTFEMIPKIP 391
           L              D   L++L+I+ FE+ PK P
Sbjct: 366 LYKNEKVTSG-----DVDKLNDLFIQNFEIAPKQP 395

>Kwal_27.10945
          Length = 935

 Score =  520 bits (1339), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 267/467 (57%), Positives = 330/467 (70%), Gaps = 40/467 (8%)

Query: 15  PNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIA 74
           P  E+   G  + VG HRVEIV YLAEGGFA IYVV+F+EY NE E + +   + VGD+A
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPT-IKLEVGDLA 124

Query: 75  CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP 134
           CLKRV+V DE GLNEMRNEV VMK+L   PNIVQY+DS+ASR  DG  GFEV LLMELCP
Sbjct: 125 CLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCP 184

Query: 135 NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194
           N SLLDYMNQRL TKLSE EILKIM+DV+  ++ MHYL  PLIHRD+KIENVLVDAN+NF
Sbjct: 185 NNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNF 244

Query: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254
           KLCD GSTS C P   ++Q+IA++T NIYVHTTPQYR+PEMIDLYR LPINEKSDIWALG
Sbjct: 245 KLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 304

Query: 255 IFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVY 314
           IFLYKLLFYTTPFE+TGQ AILHSKY+FP N YSSK+INLIIIMLAENPNLRPNI+QV+ 
Sbjct: 305 IFLYKLLFYTTPFELTGQFAILHSKYEFPVNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 315 HICSIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNXXXXXXXXXXXEDGL 374
           ++CSI+ +  P+ED+Y LG Y+F+ Y+++Q+K+Q +Q Q+ YL                 
Sbjct: 365 NLCSILKVKNPLEDKYQLGSYSFEKYSQYQAKLQKVQYQM-YLAYENKQQID-------- 415

Query: 375 VLDELYIKTFEMIPKIP-------------------NPRLSEKQPTL------EIGL--- 406
            L++++I  FE+ PK P                   N  + E  P +      +IGL   
Sbjct: 416 TLNDMFINCFEVAPKQPVDISDKKWASGPSSYKTRENKTVPEVNPDVTLAGEEDIGLVQQ 475

Query: 407 NSPSIQ--DQHLDVNNKRRSMHESINSRQASDNISQKSVRTSSNTIE 451
             PS++  D +LD  NKR +   S N   ++++ S  S +T  + I+
Sbjct: 476 QFPSVEDLDHYLDGENKRDTNKSSSNGAFSTEHSSGSSSKTDLSAIQ 522

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 985  EMKRSFAKARQSLDLERARRDAMS 1008
            E K+SF++AR+SLDLER +RD  S
Sbjct: 894  EPKKSFSRARKSLDLERTKRDTPS 917

>AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH]
           (763309..766194) [2886 bp, 961 aa]
          Length = 961

 Score =  519 bits (1336), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 243/373 (65%), Positives = 291/373 (78%), Gaps = 15/373 (4%)

Query: 23  GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82
           G  + VG H+VE++ YLAEGGFA IY V FV Y NE +       +  GD  CLKRV V+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDR--QDRILQPGDTVCLKRVRVS 89

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142
           DE GLNE+RNEVEVMKKL++  NIVQY+DSNASR  DGKPG+EVLLLMELCPN SLLDYM
Sbjct: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149

Query: 143 NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202
           NQRL TKLSE+E+LKIMYD+++G+S+MHY   PLIHRDIKIENVLVDA+NNFKLCD GST
Sbjct: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209

Query: 203 SQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLF 262
           S C P + S+Q+IAM+  NIYVHTTPQYR+PEMIDLYR LPINEKSDIWALGIFLYKLLF
Sbjct: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269

Query: 263 YTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNL 322
           YTTPFE+TGQ AILHSKY+ P N +SSK+INL+IIMLAENP LRPN++QV+YHICS+M  
Sbjct: 270 YTTPFELTGQFAILHSKYEIPRNSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMEC 329

Query: 323 PVPIEDRYGLGPYNFDLYTKFQSKVQTIQNQINYLQNXXXXXXXXXXXEDGLV----LDE 378
            V I+D YG GPYNFD+Y ++Q K+Q +Q  +                + G++    +++
Sbjct: 330 EVKIDDLYGQGPYNFDMYGRYQEKLQRLQYDM---------LMSHQLAQRGIINTDKVND 380

Query: 379 LYIKTFEMIPKIP 391
           L+I TFE  PK P
Sbjct: 381 LFISTFECAPKQP 393

>Kwal_27.11542
          Length = 791

 Score =  321 bits (823), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 212/322 (65%), Gaps = 11/322 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N P+   Y  G  ++VG+H+  I+ YL  GGFA IY  +          +      ++G
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAE----------ISPADPNSIG 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           ++ACLKRV+V D+  LN +R EV+ MK L+ + ++V Y DS+A++       +EV LLME
Sbjct: 51  NVACLKRVLVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L+E+E+LKIM D++ GI+ MH L  PLIHRDIKIENVL+  +
Sbjct: 111 YCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDD 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
             FK+CD GS      P  + Q+ + +  +I  +TT QYR+PEMIDLYR  PINEKSDIW
Sbjct: 171 KTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYKL +YTTPFE  G  AILHS++ FP   +YS ++ NLI +ML+ENPN RPNI 
Sbjct: 231 ALGVFLYKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNIC 290

Query: 311 QVVYHICSIMNLPVPIEDRYGL 332
           QV+  +  I N+P P+ + Y L
Sbjct: 291 QVLEEVSRIQNVPCPLRNFYLL 312

>Scas_671.16
          Length = 723

 Score =  313 bits (803), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 208/320 (65%), Gaps = 11/320 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N PN   YP G +++VG+H  +I+ YL  GGFAQIY  + +  +N + +          
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNN---------S 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
             ACLKRVIV D+ GLN +R EV+ MK LK++ ++V Y DS+A+R T     +EV LLME
Sbjct: 51  QTACLKRVIVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L+E EIL I+     G+S MH L   LIHRDIKIENVL+ A 
Sbjct: 111 YCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAK 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
             FK+CD GS      P  + Q++A +  ++  +TT QYRAPEM+DLYR LPINEKSDIW
Sbjct: 171 GEFKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYKL +YTTPFE  G+ AILHS+Y +P    Y+ K+ NLI   L E+P+ RPNI 
Sbjct: 231 ALGVFLYKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNIC 290

Query: 311 QVVYHICSIMNLPVPIEDRY 330
           Q++  I  I  +P PI + Y
Sbjct: 291 QLLEEISRIQGIPCPINNFY 310

>Sklu_2226.7 YIL095W, Contig c2226 8986-11373
          Length = 795

 Score =  313 bits (801), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 152/320 (47%), Positives = 208/320 (65%), Gaps = 12/320 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           ++ P  E YP+G +++VG+H+  I+ YL  GGFA IY  +            S       
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI-----------SPPDPNSS 49

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
            IACLKRV+V D+  LN +R EV+ MK LK+   +V Y DS+A++ +     +EV LLME
Sbjct: 50  SIACLKRVLVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLME 109

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L E E+LKIM  VS G++ MH L  PLIHRDIKIENVL+  +
Sbjct: 110 YCARGGLIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISED 169

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
            NFK+CD GS      P  + Q++  +  +I  +TT QYR+PEMIDLYR LP++EKSDIW
Sbjct: 170 GNFKVCDFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIW 229

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYKL +YTTPFE  G++AILHSK+ FP   +YS ++ NLI  +L ENP  RPNI 
Sbjct: 230 ALGVFLYKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNIC 289

Query: 311 QVVYHICSIMNLPVPIEDRY 330
           Q++  +  I  +P P+++ Y
Sbjct: 290 QLLAEVSRIQGVPCPVKNFY 309

>KLLA0E08371g complement(756205..758538) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1 serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization, start by similarity
          Length = 777

 Score =  308 bits (788), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 208/322 (64%), Gaps = 11/322 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N P  EKY +G ++ VG+H+V+++ YLA GGFA +Y V+          +     +   
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVE----------ISPPDPVCPD 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           ++ACLKRV+V D+  LN +R EV+ MK L+ +  IV Y DS+A++       +EV LLME
Sbjct: 51  NVACLKRVVVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L E EIL IM  VS G++ MH L  PLIHRDIKIENVL+  N
Sbjct: 111 YCSGGGLIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKN 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
           + FKLCD GS S       + ++   +  +I  +TT QYR PEMIDLYR LPI+EKSDIW
Sbjct: 171 HEFKLCDFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYK  +YTTPFE  G+ AIL SK++FP   +YS ++ NLI +ML  +P  RPNI 
Sbjct: 231 ALGVFLYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNIC 290

Query: 311 QVVYHICSIMNLPVPIEDRYGL 332
           QVV  +  I  +P PI++ Y L
Sbjct: 291 QVVEEVSRIQGIPCPIKNFYLL 312

>YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine
           protein kinase involved in regulation of actin
           cytoskeleton organization [2433 bp, 810 aa]
          Length = 810

 Score =  308 bits (789), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 211/326 (64%), Gaps = 12/326 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N+P    Y  G +++VG+H  +I+ YL  GGFAQ+Y  +          +      +  
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAE----------ISPPDPYSNA 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           +IACLKRVIV  + GLN +R EV+ MK L+++ ++V Y DS+A+R  +G   +EV +LME
Sbjct: 51  NIACLKRVIVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGI-AYEVFVLME 109

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L ESEIL+IM     GI+ MH L  PLIHRDIKIENVL+  +
Sbjct: 110 FCERGGLIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHD 169

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
             +K+CD GS S    P  + Q+   +  +I  +TT QYR+PEMIDLYR LPI+EKSDIW
Sbjct: 170 GLYKVCDFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIW 229

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYK+ +YTTPFE +G+  ILH++Y +P   +YS ++ NLI +ML E P+ RPNI 
Sbjct: 230 ALGVFLYKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNIC 289

Query: 311 QVVYHICSIMNLPVPIEDRYGLGPYN 336
           QV+  +  + N P PI + Y L   N
Sbjct: 290 QVLEEVSRLQNKPCPIRNFYLLRAMN 315

>Scas_601.6
          Length = 661

 Score =  304 bits (779), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 210/321 (65%), Gaps = 13/321 (4%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N P    Y  G +++VG+H+V++V YL  GGFAQIY V+          +      T  
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQ----------ISPPDKFTNT 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           ++ACLKRVIV D+  LN +R EV+ MK L+++ ++V Y DS+A++    +  +EV LLME
Sbjct: 51  NVACLKRVIVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L E EIL IM  V+ GI+ MH L  PL+HRDIKIENVL+ + 
Sbjct: 111 YCDMGGLIDFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSK 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
             +K+CD GS      P  + Q+++ +  +I  +TT QYRAPEMIDLYR LPI+EKSDIW
Sbjct: 171 GEYKVCDFGSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309
           ALG+FLYKL +YTTPFE  G+ AILH+ + FP  P +YS ++  LI  ML E P+ RPN 
Sbjct: 231 ALGVFLYKLCYYTTPFEKNGEAAILHATFQFPNYP-QYSDRLKKLITYMLMEQPSQRPNS 289

Query: 310 FQVVYHICSIMNLPVPIEDRY 330
           +QV+  + S+ N+  PI + Y
Sbjct: 290 YQVLEEVSSMQNVQCPIPNFY 310

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score =  298 bits (764), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 152/319 (47%), Positives = 211/319 (66%), Gaps = 13/319 (4%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N P    Y  G  ++VG+H+VEI+ YL  GGFAQ+Y       +N  +   + S     
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSA----LINPPDPHSNSS----- 51

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
            +ACLKRVIV D+  LN +R EV+ M+ LK++  +V Y DS+A++       +EV +LME
Sbjct: 52  -VACLKRVIVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L E EIL+IM  V+ G++ MH L  PLIHRDIKIENVL+ AN
Sbjct: 111 YCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISAN 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
           N +KLCD GS      P  ++Q+++ + Q+I  +TT QYR+PEMID +R LPI+EKSDIW
Sbjct: 171 NEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309
           ALGIFLYKL +YTTPFE  G +AIL  K++FP  PN YS ++  LI  +L ++P  RPN+
Sbjct: 231 ALGIFLYKLCYYTTPFEKGGDLAILSGKFEFPLYPN-YSEQLKGLIRDILVQDPRHRPNV 289

Query: 310 FQVVYHICSIMNLPVPIED 328
           +Q++  I  + N+P PI D
Sbjct: 290 YQLLKRISIMQNVPCPIND 308

>ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C
           (ARK1) - SH] complement(321493..323745) [2253 bp, 750
           aa]
          Length = 750

 Score =  300 bits (769), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 206/311 (66%), Gaps = 16/311 (5%)

Query: 23  GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82
           G +++VG+H V+I+ YL  GGFAQIY  + +          S   I  G +ACLKRV V 
Sbjct: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------SPGPIQ-GSLACLKRVHVP 60

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASR--RTDGKPGFEVLLLMELCPNKSLLD 140
           D+  LN +R EV+ MK LK   ++V Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118

Query: 141 YMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
           +MN RL+T+LSE E+LKIM  V+ GI  MH L  PLIHRDIKIENVL+  + +FK+CD G
Sbjct: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178

Query: 201 STSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKL 260
           S S    P  +  +   +  +I  +TT QYRAPEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238

Query: 261 LFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIFQVVYHICSI 319
            ++TTPFE  G+ AIL +K+ FP   +Y+ ++ NLI +ML+E+P  RPNI QV+  +  I
Sbjct: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 320 MNLPVPIEDRY 330
             +P P+ + Y
Sbjct: 299 QGVPCPLPNFY 309

>CAGL0G02607g complement(240244..242310) similar to sp|P40494
           Saccharomyces cerevisiae YIL095w PRK1, start by
           similarity
          Length = 688

 Score =  297 bits (761), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 209/323 (64%), Gaps = 13/323 (4%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N P  ++   G  ++VG H V+I+ YL  GGFAQIY V       E  S+G        
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAV-------EILSMG---LFNGS 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           ++ACLKRV V D++ LN +R EV+ MK L ++ ++V Y DS+A+R       +EV LLME
Sbjct: 51  NVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L+E EIL IM   + GI+ MH L  PL+HRDIKIENVL+   
Sbjct: 111 YCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKG 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
             +K+CD GS S    P  + Q++  +  +I  +TT QYR PEM+DLYR LPI+EK+DIW
Sbjct: 171 GIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFP--PNKYSSKIINLIIIMLAENPNLRPNI 309
           ALG+FLYKL +YTTPFE  G+ AILH+++ FP  PN YS ++ NLI  ML E+P+ RPN+
Sbjct: 231 ALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPN-YSDRLKNLIKSMLREHPSDRPNV 289

Query: 310 FQVVYHICSIMNLPVPIEDRYGL 332
            QV+  +  + N+P PI + Y L
Sbjct: 290 CQVLEEVSRMQNVPCPIRNFYLL 312

>CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces
           cerevisiae YNL020c ARK1 or sp|P40494 Saccharomyces
           cerevisiae YIL095w PRK1, start by similarity
          Length = 622

 Score =  291 bits (744), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 208/316 (65%), Gaps = 11/316 (3%)

Query: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71
           +N+P+  KY  G  ++VG+H V I+ YL  GG+AQIY  + +   ++F  LG+       
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP-ADQF--LGT------- 50

Query: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           ++A LKRVIV D+  LN +R EV+ MK+LK    IV Y DS+A++       +EV L+ME
Sbjct: 51  NMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIME 110

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
            C    L+D+MN RL+ +L+E+EIL I   +S G++ MH L  PLIHRDIKIENVL+  +
Sbjct: 111 YCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISND 170

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251
           + +KLCD GS S    P  + +++A +  +I + TT QYRAPEM+DL +   +N+KSDIW
Sbjct: 171 HKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIW 230

Query: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310
           ALG+FLYKL +YTTPFE TG+  IL+   +FPP   YS  +  LI+ MLA+NP  RPNIF
Sbjct: 231 ALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIF 290

Query: 311 QVVYHICSIMNLPVPI 326
           Q++  +  ++N+  PI
Sbjct: 291 QIIQTVSKLLNVNCPI 306

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 140/285 (49%), Gaps = 50/285 (17%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSK-SAITVGDIACLKRVIVNDEMGLNEMRNEVEV 96
           +L EGGFA+ + +K        +  G   +A TV  ++      +  E    ++ +E+++
Sbjct: 95  FLGEGGFARCFQMK--------DDKGKVFAAKTVAKLS------IKSEKTRRKLLSEIQI 140

Query: 97  MKKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSE 152
            K +K  PNIVQ+ D            FE    V +L+E+CPN S+++ + QR    L+E
Sbjct: 141 HKSMKH-PNIVQFTDC-----------FEDDTNVYILLEICPNGSVMELLRQR--KHLTE 186

Query: 153 SEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSN 212
            E+   M  +   I  MH   + +IHRD+K+ N+  D   N K+ D G  +     +++N
Sbjct: 187 PEVRFCMIQIIGAIRYMH--SRRVIHRDLKLGNIFFDKEYNLKIGDFGLAA-----VLAN 239

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI--- 269
                 T    +  TP Y APE++   ++   + + DIW++G+ LY LLF   PF+    
Sbjct: 240 DKERKYT----ICGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEV 294

Query: 270 -TGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIFQV 312
            T    I    + FP +K  SS   NLI  +L  NP  RP+++++
Sbjct: 295 ETIYERIKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEI 339

>Sklu_2419.9 YMR001C, Contig c2419 14049-16136
          Length = 695

 Score = 98.6 bits (244), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 149/289 (51%), Gaps = 50/289 (17%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVM 97
           +L EGGFA+ + +K        +S    +A TV  I+      +  E    ++ +E+++ 
Sbjct: 82  FLGEGGFARCFQMKD-------DSGKIFAAKTVAKIS------IKSEKTRKKLLSEIQIH 128

Query: 98  KKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSES 153
           K +K  PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    L+E 
Sbjct: 129 KSMKH-PNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKR--KVLTEP 174

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E+      +   I  MH  ++ +IHRD+K+ N+  D+N N K+ D G  +     +++N 
Sbjct: 175 EVRYFTTQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLAA-----VLAND 227

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM 273
                T    V  TP Y APE++   ++   + + DIW++G+ +Y LL    PF+   ++
Sbjct: 228 RERKYT----VCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEV 281

Query: 274 AILHSK-----YDFPPNKYSSK-IINLIIIMLAENPNLRPNIFQVVYHI 316
            I++ +     Y FP  K +SK ++ LI  +L+ +P  RP++ +++ ++
Sbjct: 282 NIIYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Scas_644.15
          Length = 726

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 142/285 (49%), Gaps = 48/285 (16%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVM 97
           +L EGGFA+ + +K        ES    +A TV  I+      +  E    ++ +E+++ 
Sbjct: 97  FLGEGGFARCFQIKD-------ESGKIFAAKTVAKIS------IKTEKTKKKLLSEIQIH 143

Query: 98  KKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSES 153
           K +K  PNIV + D            FE    V +L+E+C N SL+D M +R KT L+E 
Sbjct: 144 KSMKH-PNIVHFVDC-----------FEDDTNVYILLEICSNGSLMDLMKKR-KT-LTEP 189

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E+      +   +  MH   + +IHRD+K+ N+  D + N K+ D G     +  + +N+
Sbjct: 190 EVRFFTTQICGAVKYMH--SRRVIHRDLKLGNIFFDKDYNLKVGDFG----LAAVLANNR 243

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM 273
           +     +   V  TP Y APE++ + ++   + + DIW++G+ +Y LL    PF+     
Sbjct: 244 E-----RKYTVCGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVN 297

Query: 274 AIL----HSKYDFPPNKY-SSKIINLIIIMLAENPNLRPNIFQVV 313
            I       +Y +P +KY SS+   LI  +L  +P  RP+I +++
Sbjct: 298 VIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREII 342

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 111/234 (47%), Gaps = 34/234 (14%)

Query: 82  NDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
           N E  + ++R E++ +  LK +PNI  Y+    S   D K    + ++ME C   SL   
Sbjct: 51  NTEDEVEDIRKEIQFLSSLKQTPNITHYY---GSYLIDTK----LWVIMEYCAGGSLRTL 103

Query: 142 MNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGS 201
           +   +   + E  I  IM ++ + + ++H  +  +IHRDIK  N+L+  N + KLCD G 
Sbjct: 104 LRPGI---IEEKYIGVIMREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGV 158

Query: 202 TSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
            +Q S  M+  Q +A          TP + APE+I    Y   + K DIW+LGI  Y++ 
Sbjct: 159 AAQLSQSMLKRQTMA---------GTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIA 207

Query: 262 FYTTPF----EITGQMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNLRP 307
               P+     I     I  SK   PP     +YS  +   I + L E+P  RP
Sbjct: 208 TGNPPYCHMEAIRAMQMITKSK---PPRLEGREYSQPLKEFIALCLDEDPKERP 258

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 96.3 bits (238), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 101/194 (52%), Gaps = 20/194 (10%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           V +++E C    L +++ +  +  L ES+  K+   ++  +   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLKEQRLSLEESK--KLFSQIASAVYYAHEL--KCVHRDLKLEN 158

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           VL+D N + KL D G T          +++A  +Q   +  T  Y APE+I+   Y    
Sbjct: 159 VLLDGNGHAKLTDFGFT----------REMATRSQLETICGTTVYMAPELIERKCYDGF- 207

Query: 246 EKSDIWALGIFLYKLLFYTTPF----EITGQMAILHSKYDFPPNKYSSKIINLIIIMLAE 301
            K DIW+LGI LY ++    PF    +I  ++ I++ + DF     S   I+LI  ML +
Sbjct: 208 -KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAIDLIQGMLRK 266

Query: 302 NPNLRPNIFQVVYH 315
           NPN R ++ QV+ H
Sbjct: 267 NPNERISLAQVLSH 280

>Scas_700.28
          Length = 896

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 100/199 (50%), Gaps = 28/199 (14%)

Query: 125 EVLLLMELCPNKSLLDYM--NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIK 182
           +V + +E CP K L D +    R+ T     E +++   +  G+   H L+   +HRD+K
Sbjct: 103 KVWMALEYCPGKELYDRVLSMHRVPT----DECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 183 IENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY--VHTTPQYRAPEMIDLYR 240
           +EN+L+D + + KL D G T +C            MT+     +  T  Y APE+I+   
Sbjct: 157 LENILLDKSGDAKLTDFGFTREC------------MTKTTLETICGTTVYMAPELIERKS 204

Query: 241 YLPINEKSDIWALGIFLYKLLFYTTPF----EITGQMAILHSKYDFPPNKYSSKIINLII 296
           Y     K DIW+LG+ LY ++  + PF    E   +  I+H       N  ++   +LI+
Sbjct: 205 YDGF--KIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLIL 262

Query: 297 IMLAENPNLRPNIFQVVYH 315
            +LA+NPN RP + Q++ H
Sbjct: 263 RLLAKNPNDRPTVEQILKH 281

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 95.5 bits (236), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 143/288 (49%), Gaps = 48/288 (16%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVM 97
           +L EGGFA+ + +K        +S    +A TV  I+      +  E    ++ +E+++ 
Sbjct: 78  FLGEGGFARCFQMKD-------DSGKVFAAKTVAKIS------IKSEKTRKKLLSEIQIH 124

Query: 98  KKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSES 153
           K +K  PNIVQ+ D            FE    V +L+E+CPN SL+D + QR   +L+E 
Sbjct: 125 KSMKH-PNIVQFTDC-----------FEDDTNVYILLEICPNGSLMDLLKQR--KQLTEP 170

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E+      +   I  MH   + +IHRD+K+ N+  D + N K+ D G  +     +++N 
Sbjct: 171 EVRFFTTQIVGAIKYMH--SRRIIHRDLKLGNIFFDKHFNLKIGDFGLAA-----VLAND 223

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI---- 269
                T    +  TP Y APE++   ++   + + DIW++G+ +Y LL    PF+     
Sbjct: 224 RERKYT----ICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN 278

Query: 270 TGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIFQVVYHI 316
           T    I    + FP +K  SS+   LI  +L+ +P  RP++ +++ ++
Sbjct: 279 TIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 144/295 (48%), Gaps = 48/295 (16%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVM 97
           +L EGGFA+ + +K     +  E   +K+         + +  +  E    ++ +E+++ 
Sbjct: 87  FLGEGGFARCFQIK----DDSGEIFAAKT---------VAKASIKSEKTRKKLLSEIQIH 133

Query: 98  KKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSES 153
           K + S PNIVQ+ D            FE    V +L+E+CPN SL++ + +R    L+E 
Sbjct: 134 KSM-SHPNIVQFIDC-----------FEDDSNVYILLEICPNGSLMELLKRR--KVLTEP 179

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E+      +   I  MH   + +IHRD+K+ N+  D+N N K+ D G  +     +++N+
Sbjct: 180 EVRFFTTQICGAIKYMH--SRRVIHRDLKLGNIFFDSNYNLKIGDFGLAA-----VLANE 232

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI---- 269
                T    +  TP Y APE++ + ++   + + DIW+LG+ LY LL    PF+     
Sbjct: 233 SERKYT----ICGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN 287

Query: 270 TGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLP 323
           T    I    + FP +K  S +   LI  +L+ +P  RP++ +++ ++      P
Sbjct: 288 TIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFP 342

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 144/288 (50%), Gaps = 48/288 (16%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVM 97
           +L EGGFA+ + +K        +S    +A TV  I+      +  E    ++ +E+++ 
Sbjct: 86  FLGEGGFARCFQIKD-------DSGKIFAAKTVAKIS------IKSEKTRKKLLSEIQIH 132

Query: 98  KKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSES 153
           K + S  NIVQ+ D            FE    V +L+E+CPN SL++ + +R KT ++E 
Sbjct: 133 KSM-SHTNIVQFIDC-----------FEDNVNVYILLEICPNGSLMELIKKR-KT-ITEP 178

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E+   M  +  GI  MH     +IHRD+K+ N+  D + N K+ D G  +     +++N 
Sbjct: 179 EVRFFMTQICGGIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLAA-----VLAND 231

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI---- 269
                T    +  TP Y APE++ + ++   + + DIW++G+ LY LL    PF+     
Sbjct: 232 RERKFT----ICGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN 286

Query: 270 TGQMAILHSKYDFPPNKYSSKIINLII-IMLAENPNLRPNIFQVVYHI 316
           T    I    + +P +K  S+    +I  +L+ NP  RP+I +++ ++
Sbjct: 287 TIYERIKQRNFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 98/198 (49%), Gaps = 26/198 (13%)

Query: 125 EVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           +V + +E CP K L D++    +  L E    ++   +S  +   H +    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLSLRRISLLECG--ELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY--VHTTPQYRAPEMIDLYRYL 242
           N+L+D N N KL D G T +C            MT+     V  T  Y APE+I+   Y 
Sbjct: 162 NILLDKNGNAKLTDFGFTREC------------MTKTTLETVCGTTVYMAPELIERRTYD 209

Query: 243 PINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKII-----NLIII 297
               K DIW+LG+ LY L+    PF+   +        +  P KY +K+I     +LI  
Sbjct: 210 GF--KIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEP-KYDAKVIPDDARDLISR 266

Query: 298 MLAENPNLRPNIFQVVYH 315
           +LA+NP  RP++ QV+ H
Sbjct: 267 LLAKNPGERPSLSQVLRH 284

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 92.4 bits (228), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 95/195 (48%), Gaps = 20/195 (10%)

Query: 125 EVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           +V + +E CP K L +Y+  + +  L ES   K+   +   +   H L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYLLMQHRISLEESG--KLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           N+L+D     K+ D G T +C+   M             V  T  Y APE+I+   Y   
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLET----------VCGTTVYMAPELIERKSYDGF 207

Query: 245 NEKSDIWALGIFLYKLLFYTTPF----EITGQMAILHSKYDFPPNKYSSKIINLIIIMLA 300
             K DIW+LG+ LY ++  T PF    E   +  I++ +  +  +  S    +LI  +L 
Sbjct: 208 --KIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLC 265

Query: 301 ENPNLRPNIFQVVYH 315
           ++P+ RP + QV+ H
Sbjct: 266 KDPSQRPQLSQVLAH 280

>Kwal_56.22476
          Length = 697

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 146/291 (50%), Gaps = 54/291 (18%)

Query: 38  YLAEGGFAQIYVVKFVEYLNEFESLGSK--SAITVGDIACLKRVIVNDEMGLNEMRNEVE 95
           +L EGGFA+ + +K           G K  +A TV  I+      +  E    ++ +E++
Sbjct: 84  FLGEGGFARCFQIK---------DDGGKIFAAKTVAKIS------IKSEKTRKKLLSEIQ 128

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLS 151
           + K ++ + NIVQ+ D            FE    V +L+E+CPN SL+D + +R    L+
Sbjct: 129 IHKSMRHT-NIVQFVDC-----------FEDDTNVYILLEICPNGSLMDLLKRR--KMLT 174

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E E+      +   +  MH   + +IHRD+K+ N+  D + N K+ D G  +     +++
Sbjct: 175 EPEVRFFTTQIVGAVKYMH--SRRVIHRDLKLGNIFFDKHYNLKVGDFGLAA-----VLA 227

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
           N      T    V  TP Y APE++   ++   + + DIW+ G+ +Y LL    PF+   
Sbjct: 228 NDRERKYT----VCGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AK 281

Query: 272 QMAILHSK-----YDFPPNKY-SSKIINLIIIMLAENPNLRPNIFQVVYHI 316
           ++ I++ +     + FP +K+ S + + LI  +L+ +P  RP++ +++ ++
Sbjct: 282 EVNIIYERIKCGDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Sklu_1962.2 YPL236C, Contig c1962 744-1838 reverse complement
          Length = 364

 Score = 88.2 bits (217), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 140/334 (41%), Gaps = 79/334 (23%)

Query: 39  LAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMK 98
           L EGGF+ +Y+V+  E  N+  +L  K     G+I             ++E   EV   K
Sbjct: 34  LGEGGFSFVYLVQSREN-NDLFAL-KKIHCPFGNIE-----------SVSEAMREVNSYK 80

Query: 99  KLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL--KTKLSESEIL 156
           K +S P I     S   +  DG     V +L+   P  SLLD +N  L   T +SE EI+
Sbjct: 81  KFRS-PYITHCVSSQVLQEQDGSK--TVFILLPYFPTGSLLDKINTHLLDGTTISEEEIV 137

Query: 157 KIMYDVSIGI--------------------SNMHYLDQPLI------------------- 177
           +I+  V+ G+                    +++ Y D   +                   
Sbjct: 138 RILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELDVLS 197

Query: 178 --------------HRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY 223
                         H+DIK  N++  ++    +CD+GS S+    + S   +    +   
Sbjct: 198 GNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCN 257

Query: 224 VHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM-------AIL 276
            H T  +R+PE++++     I+EK DIW+LG  LY + F  +PFE   Q+       AI 
Sbjct: 258 EHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIA 317

Query: 277 HSKYDFPPNK-YSSKIINLIIIMLAENPNLRPNI 309
             K+  PPN  YS ++I +I   +  +   RP+I
Sbjct: 318 TGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSI 351

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 95/203 (46%), Gaps = 36/203 (17%)

Query: 125 EVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           +V + +E CP K L D++    K++L   E  ++   ++  +   H L+   +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLS--KSRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY--VHTTPQYRAPEMIDLYRYL 242
           NVL+D N N KL D G T +             MT+ +   V  T  Y APEMI    Y 
Sbjct: 163 NVLLDKNGNAKLTDFGFTRES------------MTKAVLETVCGTTVYMAPEMIQHKPYD 210

Query: 243 PINEKSDIWALGIFLYKLLFYTTPFE----------ITGQMAILHSKYDFPPNKYSSKII 292
               K DIW+LG+ LY LL    PF+          I     ++  +   P  +      
Sbjct: 211 GF--KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQ------ 262

Query: 293 NLIIIMLAENPNLRPNIFQVVYH 315
           NLI  +L+++P  RPN   ++ H
Sbjct: 263 NLIEQLLSKDPTERPNTSAILLH 285

>Kwal_56.24274
          Length = 346

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 143/334 (42%), Gaps = 62/334 (18%)

Query: 25  MISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDE 84
            +S+   +  I   L EGG + +Y+V+  E   E  +L  K+    G I           
Sbjct: 18  FVSINGRKYRIQKLLGEGGLSFVYLVESKE--GELFAL-KKTRCPFGSIG---------- 64

Query: 85  MGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ 144
             ++    EV   ++  SSP I Q  DS   +  DG     V +L+      SL D +N+
Sbjct: 65  -SISPAMKEVANYQRF-SSPYIAQIVDSQVVQEKDGSK--TVYVLLPYFAKGSLQDLINR 120

Query: 145 RL--KTKLSESEILKIMYDVSIGISNMHY-----------------------------LD 173
            L   T++SE +IL++   ++ G+  +H                              LD
Sbjct: 121 HLLDCTQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELD 180

Query: 174 ------QPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTT 227
                 Q   HRD+K  N+++   +   + D+GS S+    + S Q +    +    + T
Sbjct: 181 TFGESQQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCT 240

Query: 228 PQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE----ITGQ---MAILHSKY 280
             Y APE++D+     I EK DIW+ G  +Y + F  +PFE    I+G     AI   KY
Sbjct: 241 LSYAAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKY 300

Query: 281 DFP-PNKYSSKIINLIIIMLAENPNLRPNIFQVV 313
             P    YSS +I LI   L+ NP  RP++ +++
Sbjct: 301 TVPRGTSYSSSLIELIGKCLSVNPEQRPSVNELI 334

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 91/194 (46%), Gaps = 20/194 (10%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           V + +E CP   L DY+   LK ++   E  ++   +   +   H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           +L+D N    L D G T +C          A  TQ   V  T  Y APE+I    Y    
Sbjct: 159 ILLDKNGYAMLTDFGFTREC----------ATKTQLETVCGTTVYMAPELIKREAY--DG 206

Query: 246 EKSDIWALGIFLYKLLFYTTPFE----ITGQMAILHSKYDFPPNKYSSKIINLIIIMLAE 301
            K D W+LGI LY +L    PF+    +   + I+H +        S +  +LI+ +L +
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLDK 266

Query: 302 NPNLRPNIFQVVYH 315
           N   RPN+ +V+ H
Sbjct: 267 NAAQRPNLNEVLQH 280

>Kwal_55.21545
          Length = 865

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 114/243 (46%), Gaps = 34/243 (13%)

Query: 75  CLKRVI----VNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLM 130
           C  +V+     +DE  + +++ E++ +  LK  PNI  Y+    S   D K    + ++M
Sbjct: 45  CAIKVLNLDSADDE--VEDVQKEIQFLSSLKQVPNITHYY---GSYLNDTK----LWVIM 95

Query: 131 ELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDA 190
           E C   SL   +      K+ E  I  IM ++   +  MH     +IHRDIK  NVL+  
Sbjct: 96  EYCAGGSLRTLLR---PGKIGEQYIGVIMRELLTAL--MHIHKDGVIHRDIKAANVLITN 150

Query: 191 NNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDI 250
           + + KLCD G  +Q S   +  Q +A          TP + APE+I    Y   + K DI
Sbjct: 151 DGHIKLCDFGVAAQLSQTKIRRQTMA---------GTPYWMAPEVIMEGVYY--DTKVDI 199

Query: 251 WALGIFLYKLLFYTTPF-EITGQMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNL 305
           W+LGI  Y++     P+ E+    A+       PP     ++SS +  +I + L E+P  
Sbjct: 200 WSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKE 259

Query: 306 RPN 308
           RP+
Sbjct: 260 RPS 262

>Kwal_26.8751
          Length = 848

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 94/196 (47%), Gaps = 24/196 (12%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           V + +E CP K L +Y+  +    L E    ++   +   +   H +    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY--VHTTPQYRAPEMIDLYRYLP 243
           +L+D   + KL D G T +C+            T+ I   +  T  Y APE+I+   Y  
Sbjct: 159 ILLDKKGHAKLTDFGFTRECA------------TKGILETICGTTVYMAPELIERKPYE- 205

Query: 244 INEKSDIWALGIFLYKLLFYTTPF----EITGQMAILHSKYDFPPNKYSSKIINLIIIML 299
              K D W+LGI LY ++  T PF    E+  +  I+H    +  +   S    LI  +L
Sbjct: 206 -GYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYDNDYIDSNGKELISQLL 264

Query: 300 AENPNLRPNIFQVVYH 315
            ++PN RP++ QV+ H
Sbjct: 265 EKDPNQRPSLTQVLQH 280

>Sklu_2419.10 , Contig c2419 14439-16135
          Length = 566

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 118/223 (52%), Gaps = 36/223 (16%)

Query: 104 PNIVQYFDSNASRRTDGKPGFE----VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIM 159
           PNIVQ+ D            FE    V +L+E+CPN SL+D + +R    L+E E+    
Sbjct: 4   PNIVQFIDC-----------FEDDTNVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFT 50

Query: 160 YDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMT 219
             +   I  MH  ++ +IHRD+K+ N+  D+N N K+ D G  +     +++N      T
Sbjct: 51  TQIVGAIKYMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLAA-----VLANDRERKYT 103

Query: 220 QNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSK 279
               V  TP Y APE++   ++   + + DIW++G+ +Y LL    PF+   ++ I++ +
Sbjct: 104 ----VCGTPNYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYER 157

Query: 280 -----YDFPPNKYSSK-IINLIIIMLAENPNLRPNIFQVVYHI 316
                Y FP  K +SK ++ LI  +L+ +P  RP++ +++ ++
Sbjct: 158 IKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 200

>YPL236C (YPL236C) [5213] chr16 complement(101608..102702)
           Serine/threonine protein kinase of unknown function
           [1095 bp, 364 aa]
          Length = 364

 Score = 83.6 bits (205), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 88/338 (26%), Positives = 147/338 (43%), Gaps = 64/338 (18%)

Query: 26  ISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEM 85
           I V   R  I   L EGG + +Y+V+  +      SL   + I   ++  LK++I     
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSK-----NSLIIDNGIATPELYALKKIICPSVE 77

Query: 86  GLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDG-KPGFEVLLLMELCPNKSLLDYMNQ 144
            ++    E+E  K+ +S P +++  DS   +  DG K  + VL    L    SL D +N+
Sbjct: 78  SISNGMREIENYKRFQS-PYVIKSIDSQVMQEKDGSKTIYIVLPYYSL---GSLQDSINR 133

Query: 145 RL--KTKLSESEILKIMYDVSIGISNMH-----------------------------YLD 173
           RL   T +SE+E ++IM  V+ G+  +H                               D
Sbjct: 134 RLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLED 193

Query: 174 QPL---------------IHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMM 218
            PL                HRDI   N+L  ++    + D+GS SQ    + +   ++ +
Sbjct: 194 TPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSEL 253

Query: 219 TQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM----- 273
            + +  + T  Y  PE+++L     ++ K DIW+LG   Y L+F  +PFE   Q+     
Sbjct: 254 QEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASL 313

Query: 274 --AILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPN 308
             AI   KY FP N ++S  ++++I   +  +P  RP 
Sbjct: 314 TYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRPT 351

>Scas_580.6
          Length = 1015

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 105/229 (45%), Gaps = 28/229 (12%)

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142
           DE  + +++ EV+ +  LK  PNI +Y+ S     +       + ++ME C   SL   +
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTS-------LWIIMEYCAGGSLRSLL 125

Query: 143 NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202
                 K+ E  I  IM ++ + +  +H  +  +IHRDIK  NVL+    + KLCD G  
Sbjct: 126 R---PGKIDEKYIGVIMRELLVALKYIHKDN--VIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 203 SQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLF 262
           +Q +   +  Q +A          TP + APE+I    Y   + K DIW+LGI  Y++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIAT 229

Query: 263 YTTPF-EITGQMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNLR 306
              P+ E+    A+       PP      Y+  +   I + L E+P  R
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 106/238 (44%), Gaps = 43/238 (18%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLN---EM 90
           EI   L +G F ++Y V+ +E                G +  LK +   D +  N   + 
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIE---------------SGFVCALKAMEKKDIIQYNIEKQF 154

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKL 150
           R EVE+   L+  PN+ Q +      +        V LLME   N  L  ++  R  +  
Sbjct: 155 RREVEIQSSLRH-PNLTQLYGYFHDEK-------RVYLLMEYLVNGELYKHLKGR--SHF 204

Query: 151 SESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMM 210
           ++      +Y ++  +  MH  ++ ++HRDIK EN+++  NN  KL D G  S  +P   
Sbjct: 205 NDVVASYYVYQMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG-WSVITPKGS 261

Query: 211 SNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
             + +           T  Y +PE+I    Y   NEK D+WALG+  Y+LL  + PFE
Sbjct: 262 KRKTLC---------GTVDYLSPELIRSREY---NEKVDVWALGVLTYELLVGSPPFE 307

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 103/228 (45%), Gaps = 34/228 (14%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           + +++ E++ +  LK  PNI +Y+ S          G  + ++ME C   SL   +    
Sbjct: 56  VEDVQREIQFLASLKQIPNITRYYGSYLR-------GTSLWIIMEYCAGGSLRSLLR--- 105

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
             K+ E  I  IM ++ + +  +H     +IHRDIK  NVL+      KLCD G  +Q +
Sbjct: 106 PGKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDFGVAAQLN 163

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
              +  Q +A          TP + APE+I    Y   + K DIW+LGI  Y++     P
Sbjct: 164 QTSLRRQTMA---------GTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIATGNPP 212

Query: 267 F----EITGQMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNLR 306
           +     +     I+ SK   PP      Y+ ++   I + L E+P  R
Sbjct: 213 YCDVEALRAMQLIIKSK---PPRLEERNYTPQLKEFIALCLDEDPQER 257

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 124/279 (44%), Gaps = 37/279 (13%)

Query: 39  LAEGGFAQIYVVKFVEYLN--EFESLGSKSAITVGDIACLKRV-IVNDEMGLNEMRNEVE 95
           LAEG      + K  E +   +F  +     +  G +  +K + + +D   + +++ E++
Sbjct: 12  LAEGEMDVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQ 71

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
            +  LK   NI +Y+ S     +       + ++ME C   SL   +      K+ E  I
Sbjct: 72  FLASLKQISNITRYYGSYLKDTS-------LWIIMEHCAGGSLRSLLR---PGKIDEKYI 121

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
             IM ++ + +  +H  +  +IHRDIK  NVL+    N KLCD G  +Q +   +  Q +
Sbjct: 122 GVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTM 179

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF----EITG 271
           A          TP + APE+I    Y   + K DIW+LGI  Y++     P+     +  
Sbjct: 180 A---------GTPYWMAPEVIMEGVYY--DTKVDIWSLGITTYEIATGNPPYCDVEALRA 228

Query: 272 QMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNLR 306
              I+ SK   PP      YS+ +   I + L E+P  R
Sbjct: 229 MQLIIKSK---PPRLEDRSYSTSLKEFIALCLDEDPKER 264

>Kwal_33.13112
          Length = 505

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 112/233 (48%), Gaps = 26/233 (11%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +  E+  + +L++ P +  Y+ +             + ++ME C   S  D +    
Sbjct: 76  IDVLAQEIYFLSELRA-PFVTTYYKTYVE-------DVSMWIVMEFCGGGSCADLLKHLP 127

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + +L E+++  I+ +V  G+  +H   Q  IHRD+K  N+L+      KL D G      
Sbjct: 128 EHRLPENKVAYIIREVLYGLEYLH--SQRKIHRDVKAANILLTDEGEVKLGDFG------ 179

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
              +S Q +A + +N +V  TP + APE+I   R    +EK+DIW+LGI   +LL    P
Sbjct: 180 ---VSGQIMATLKRNTFV-GTPYWMAPEIIA--RDNGYDEKADIWSLGITAMELLTGQPP 233

Query: 267 FEITGQMAILHS-KYDFPP---NKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
           +     M +L +     PP    +++S   + I + L ++P LRP    ++ H
Sbjct: 234 YAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLLSH 286

>Scas_707.36
          Length = 915

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 106/222 (47%), Gaps = 39/222 (17%)

Query: 88  NEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQR 145
           N+++ E+ +MKK   K    +++  D  +SR+        + L++E C    +L     +
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSRK--------IYLVLEYCEKGPILWCPRDQ 193

Query: 146 LKT------KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           L+       +LS     +I  DV +G+  +H   Q +IHRDIK  N+L+D N   K+ D 
Sbjct: 194 LEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKNGVVKISDF 251

Query: 200 GSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI--------------DLYRYLPIN 245
           G +   +  + +N D   +T+ +    TP + APE+               +L+    I+
Sbjct: 252 GVSLAANGNIDTNDDELELTKTV---GTPVFYAPEICLGAAAMERFNLDKDELFNGSCIS 308

Query: 246 EKSDIWALGIFLYKLLF----YTTPFEITGQMAILHSKYDFP 283
            K DIWALGI LY LLF    + + FE+     I++ K  FP
Sbjct: 309 FKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP 350

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 104/227 (45%), Gaps = 28/227 (12%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           + +++ E++ +  LK  PNI +Y+    S   D K    + ++ME C   SL   +    
Sbjct: 65  VEDVQKEIQFLASLKQVPNITRYY---GSYLYDTK----LWVIMEYCAGGSLRTLLR--- 114

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
             K+ E  +  I+  + I +  +H  +  +IHRDIK  NVL+    + KLCD G  +Q +
Sbjct: 115 PGKIDEKYLGVIVRKLLIALVYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVAAQLT 172

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                 Q +A          TP + APE+I    Y   N K+DIW+LGI  Y++     P
Sbjct: 173 AANHKRQTMA---------GTPYWMAPEVIMEGVYY--NTKADIWSLGITAYEIATGNPP 221

Query: 267 F-EITGQMAILHSKYDFPP----NKYSSKIINLIIIMLAENPNLRPN 308
           + ++    A+       PP      YS  +   I + L E+P  RP 
Sbjct: 222 YCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPT 268

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 146/317 (46%), Gaps = 55/317 (17%)

Query: 21  PNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVI 80
           P GQ I     + +++  L EG F ++ +   V       S G K A+ + +    K+V+
Sbjct: 31  PIGQRIG----KYQVIKTLGEGSFGKVKLAHHV-------STGQKVALKIIN----KKVL 75

Query: 81  VNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLD 140
              +M    +  E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L D
Sbjct: 76  AKSDMQ-GRIEREISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFD 125

Query: 141 YMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
           Y+ QR   K+SE+E  +    +   +   H     ++HRD+K EN+L+D + N K+ D G
Sbjct: 126 YIVQR--DKMSENEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG 181

Query: 201 STSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFL 257
                    +SN    +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ L
Sbjct: 182 ---------LSN----IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVIL 226

Query: 258 YKLLFYTTPFEITGQMAIL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVV 313
           Y +L    PF+      +     +  Y   P   S    NLI  ML  NP  R  I +++
Sbjct: 227 YVMLCRRLPFDDESIPVLFKNISNGVYSI-PKFLSQGAANLIKRMLIVNPLNRITIHEIM 285

Query: 314 YHICSIMNLP---VPIE 327
                 ++LP   VP++
Sbjct: 286 EDEWFKVDLPDYLVPVD 302

>Scas_660.28
          Length = 623

 Score = 79.0 bits (193), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 121/248 (48%), Gaps = 45/248 (18%)

Query: 26  ISVGAH--RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVND 83
           +S G+H    +IV  L EG F +   VK   ++    + G K A+ + +    K+V+   
Sbjct: 37  LSDGSHIGNYQIVKTLGEGSFGK---VKLAYHM----TTGQKVALKIIN----KKVLAKS 85

Query: 84  EMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
           +M    +  E+  ++ L+  P+I++ +D   S+        E++++ME   N+ L DY+ 
Sbjct: 86  DMQ-GRIEREISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVMEYAGNE-LFDYIV 135

Query: 144 QRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
           QR   K+SE E  +    +   +   H     ++HRD+K EN+L+D + N K+ D G   
Sbjct: 136 QR--DKMSEDEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--- 188

Query: 204 QCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKL 260
                 +SN    +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ LY +
Sbjct: 189 ------LSN----IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVILYVM 236

Query: 261 LFYTTPFE 268
           L    PF+
Sbjct: 237 LCRRLPFD 244

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 134/288 (46%), Gaps = 43/288 (14%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVND-EMGLNEMRN 92
           EI+  +  G F  +Y  +                +T  +I  +K V + D +  ++ +  
Sbjct: 21  EILQCIGRGNFGDVYKAR---------------DLTSNEIVAIKVVNLEDTDEPIDLLAQ 65

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           E+  + +L+S P I  Y       +T       + ++ME C   S  + +    + K++E
Sbjct: 66  EIFFLSELRS-PYITNY-------KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTE 117

Query: 153 SEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSN 212
            +   I+ +V IG+  +H   Q  IHRDIK  N+L+  N + KL D G + Q    MM  
Sbjct: 118 EQCAFIVSEVLIGLDYLH--SQRKIHRDIKSANILLTDNGHVKLGDFGVSGQ----MMVT 171

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQ 272
           +      ++ +V  TP + APE+ID  +    NE +DIW+LGI + +LL    P +    
Sbjct: 172 R-----KRDTFV-GTPFWMAPEVIDRNKQ-GYNEMADIWSLGITVIELLMGHPPLDKYDA 224

Query: 273 MAILHS--KYDFPP---NKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
           M  L +  K D PP    ++SS   + +   L ++P+ RP   +++ H
Sbjct: 225 MKALMAIPKRD-PPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKH 271

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 128/273 (46%), Gaps = 44/273 (16%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL + PN+++ +D   + +       ++ +++E      L + + QR    L E+E 
Sbjct: 80  IIMKLLNHPNVLRLYDVWETAQ-------DLYMVLEYVEKGELFNLLVQR--GPLPENEA 130

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
           ++    + IGIS  H L   ++HRD+K EN+L+D   N KL D G  +      + ++D 
Sbjct: 131 VRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA------LESKDK 182

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF-EITGQ-- 272
            + T       +P Y APE++    Y     +SD+W+ G+ LY LL    PF E  G   
Sbjct: 183 LLETSC----GSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFDEEDGNIR 236

Query: 273 ---MAILHSKYDFP-PNKYSSKIINLIIIMLAENPNLRPNIFQVVYHIC----------- 317
              + +   KY+ P  ++ S +  +LI+ +L   P  R    +++ H             
Sbjct: 237 NLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSK 296

Query: 318 SIMNLPVPIEDRYGLGPYNFDLYTKFQSKVQTI 350
           SI NLP   ED Y L P + +  T  Q+ +Q +
Sbjct: 297 SIRNLPR--EDTY-LNPLDHNDGTIDQAILQNL 326

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 123/261 (47%), Gaps = 44/261 (16%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL + PN+++ +D   + +       ++ +++E      L + + +R    L E+E 
Sbjct: 78  IIMKLLNHPNVLRLYDVWETSK-------DLYMVLEYVEKGELFNLLVER--GPLPENEA 128

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
           ++    + IGIS  H L   ++HRD+K EN+L+D   N KL D G  +      + ++D 
Sbjct: 129 VRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA------LESKDK 180

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF-EITGQ-- 272
            + T       +P Y APE++    Y     +SD+W+ G+ LY LL    PF E  G   
Sbjct: 181 LLETS----CGSPHYAAPEIVSGLPYHGF--ESDVWSCGVILYALLTGRLPFDEEDGNIR 234

Query: 273 ---MAILHSKYDFP-PNKYSSKIINLIIIMLAENPNLRPNIFQVVYHIC----------- 317
              + +   K++ P  ++ SS+  +LI  +L  +P  R    +++ H             
Sbjct: 235 NLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSK 294

Query: 318 SIMNLPVPIEDRYGLGPYNFD 338
           SI NLP   ED Y L P + +
Sbjct: 295 SIRNLPR--EDTY-LNPLSLE 312

>Scas_598.6
          Length = 790

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 114/240 (47%), Gaps = 32/240 (13%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYL-NEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRN 92
           +++    +G    +Y+ + +     EF+         VGD   +K++I++ +     + N
Sbjct: 503 QMIEKAGQGASGSVYLAERIAIPPGEFDETPE-----VGDKVAIKQMILSKQPRKELIVN 557

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK--- 149
           E+ VMK  +   NIV + ++      D      + ++ME     SL D +     T    
Sbjct: 558 EILVMKDSRHK-NIVNFLEAYLKTEDD------LWVVMEFMEGGSLTDIIENSPATGSSS 610

Query: 150 --LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP 207
             L+E +I  I+ +   G+  +H  D+ +IHRDIK +NVL+D N   K+ D G  ++   
Sbjct: 611 SPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDNNARVKITDFGFCAK--- 665

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
             +++Q     ++   +  TP + APE++    Y   +EK D+W+LGI   ++L    P+
Sbjct: 666 --LTDQ----RSKRATMVGTPYWMAPEVVKQREY---DEKVDVWSLGIMTIEMLESEPPY 716

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 117/245 (47%), Gaps = 45/245 (18%)

Query: 29  GAH--RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMG 86
           GAH    +IV  L EG F ++        L    + G K A+ + +    K+V+   +M 
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVK-------LAYHTTTGQKVALKIIN----KKVLAKSDMQ 97

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
              +  E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR 
Sbjct: 98  -GRIEREISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR- 146

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
             K+SE E  +    +   +   H     ++HRD+K EN+L+D + N K+ D G      
Sbjct: 147 -DKMSEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG------ 197

Query: 207 PPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFY 263
              +SN    +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ LY +L  
Sbjct: 198 ---LSN----IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVILYVMLCR 248

Query: 264 TTPFE 268
             PF+
Sbjct: 249 RLPFD 253

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 81/286 (28%), Positives = 125/286 (43%), Gaps = 42/286 (14%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNE 93
           EI   L +G F ++Y VK  E           + +     A  K+ IV   +   + R E
Sbjct: 101 EIGKILGKGKFGKVYCVKHRE-----------TGLICALKAMEKKEIVQYTIQ-KQFRRE 148

Query: 94  VEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSES 153
           VE+    K   N+ Q +      +        V LLME      L  ++       L+E+
Sbjct: 149 VEIQGSFKHK-NLTQLYGFFYDEK-------RVYLLMEYVYYGELYKFLKN--NGPLNET 198

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
                +Y ++  +  MH   + ++HRDIK EN+L+  NN  KL D G +       + N+
Sbjct: 199 LASYFVYQMANALDYMH--SKNILHRDIKPENILIGFNNTIKLTDFGWS-------VYNE 249

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF-EITGQ 272
           D     +   +  T  Y +PE+I    Y   N K D+WALG+  Y+LL  + PF E T +
Sbjct: 250 D---GQKRKTLCGTIDYLSPELIKSREY---NNKVDVWALGVLTYELLVGSPPFEEDTKE 303

Query: 273 MA---ILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
           M    IL     FP N  S +  +LI+ +L   P+ R  + +V  H
Sbjct: 304 MTYRRILRCDLKFPLN-VSPQARDLIVRLLQFEPSKRIPLSEVKSH 348

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 103/228 (45%), Gaps = 35/228 (15%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL + PNI+  ++   ++        E+ L++E      L DY+  R   KL E E 
Sbjct: 116 IIMKLITHPNIMALYEVWENKS-------ELYLVLEYVEGGELFDYLIAR--GKLPEQEA 166

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN-NFKLCDMGSTSQCSPPMMSNQD 214
           +     +  G+S  H  +  + HRD+K EN+L+D  N   K+ D G              
Sbjct: 167 IHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIADFGMA------------ 212

Query: 215 IAMMTQNIYVHTT---PQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
            A+ T N  + T+   P Y +PE++   +Y      SD+W+ GI L+ LL    PF    
Sbjct: 213 -ALETTNRLLETSCGSPHYASPEIVMGQKYH--GSPSDVWSCGIILFALLTGHLPFNDDN 269

Query: 272 QMAIL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
              +L    H +Y  P N  S +  +LI  +L  +P  R  + +++ H
Sbjct: 270 VRKLLLKVQHGRYQMPSN-VSKEAKDLISKILVVDPEKRITVDKILEH 316

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 101/203 (49%), Gaps = 26/203 (12%)

Query: 70  VGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLL 129
           VGD   +K+++++ +     + NE+ VMK  +   NIV + +  A  RTD     ++ ++
Sbjct: 587 VGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHK-NIVNFLE--AYLRTDD----DLWVV 639

Query: 130 MELCPNKSLLDYM-----NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           ME     SL D +     N    + L+E +I  I+ +   G+  +H  D+ +IHRDIK +
Sbjct: 640 MEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSD 697

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           NVL+D     K+ D G  ++ +            ++   +  TP + APE++    Y   
Sbjct: 698 NVLLDTRARVKITDFGFCARLT---------DKRSKRATMVGTPYWMAPEVVKQREY--- 745

Query: 245 NEKSDIWALGIFLYKLLFYTTPF 267
           +EK D+W+LGI   ++L    P+
Sbjct: 746 DEKIDVWSLGIMTIEMLEGEPPY 768

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 75.5 bits (184), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 81/317 (25%), Positives = 144/317 (45%), Gaps = 53/317 (16%)

Query: 20  YPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV 79
           +  GQ I     + +I+  L EG F ++ +   +       S G K A+ + +    K+V
Sbjct: 26  HAQGQHIG----KYQIIKTLGEGSFGKVKLAYHI-------STGQKVALKIIN----KKV 70

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL 139
           +   +M    +  E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L 
Sbjct: 71  LAKSDMQ-GRIEREISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVIEYAGNE-LF 120

Query: 140 DYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           DY+ QR   K+ E E  +    +   +   H     ++HRD+K EN+L+D + N K+ D 
Sbjct: 121 DYIVQR--DKMPEQEARRFFQQIISAVDYCH--RHKIVHRDLKPENLLLDEHLNVKIADF 176

Query: 200 GSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIF 256
           G         +SN    +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ 
Sbjct: 177 G---------LSN----IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVI 221

Query: 257 LYKLLFYTTPFE---ITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVV 313
           LY +L    PF+   I      + +     PN  S    +LI  ML  NP  R  + +++
Sbjct: 222 LYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIM 281

Query: 314 YHICSIMNLP---VPIE 327
                 ++LP   VP E
Sbjct: 282 QDEWFKVDLPDYLVPAE 298

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 115/238 (48%), Gaps = 43/238 (18%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNE 93
           +IV  L EG F ++ +   V       + G K A+ + +    K+V+   +M    +  E
Sbjct: 40  QIVKTLGEGSFGKVKLAYHV-------TTGQKVALKIIN----KKVLAKSDMQ-GRIERE 87

Query: 94  VEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSES 153
           +  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K+SE 
Sbjct: 88  ISYLRLLRH-PHIIKLYDVIKSKD-------EIIMVIEYAGNE-LFDYIVQR--NKMSEQ 136

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           E  +    +   +   H     ++HRD+K EN+L+D + N K+ D G         +SN 
Sbjct: 137 EARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG---------LSN- 184

Query: 214 DIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
              +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ LY +L    PF+
Sbjct: 185 ---IMTDGNFLKTSCGSPNYAAPEVISGKLY--AGPEVDVWSCGVILYVMLCRRLPFD 237

>Kwal_47.18233
          Length = 598

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 117/240 (48%), Gaps = 43/240 (17%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           + +I+  L EG F ++ +   V       + G K A+ + +    K+V+   +M    + 
Sbjct: 30  KYQIIKTLGEGSFGKVKLAYHV-------TTGQKVALKIIN----KKVLAKSDMQ-GRIE 77

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
            E+  ++ L+  P+I++ +D   S+        E+++++E   N+ L DY+ QR   K+S
Sbjct: 78  REISYLRLLRH-PHIIKLYDVVKSKD-------EIVMVIEYAGNE-LFDYIVQR--DKMS 126

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E+E  +    +   +   H     ++HRD+K EN+L+D + N K+ D G         +S
Sbjct: 127 ENEARRFFQQIISAVEYCHR--HKIVHRDLKPENLLLDEHLNVKIADFG---------LS 175

Query: 212 NQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
           N    +MT   ++ T   +P Y APE+I    Y     + D+W+ G+ LY +L    PF+
Sbjct: 176 N----IMTDGNFLRTSCGSPNYAAPEVISGKLY--AGPEVDVWSSGVILYVMLCRRLPFD 229

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 99/203 (48%), Gaps = 26/203 (12%)

Query: 70  VGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLL 129
           +GD   +K++I++ +     + NE+ VMK  +   NIV + ++      D      + ++
Sbjct: 538 IGDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVV 590

Query: 130 MELCPNKSLLDYMNQRLKTKLSES-----EILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           ME     SL D +   + +  SES     +I  I+ +   G+  +H  D+ +IHRDIK +
Sbjct: 591 MEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSD 648

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           NVL+D +   K+ D G  ++ +            ++   +  TP + APE++    Y   
Sbjct: 649 NVLLDTHGRVKITDFGFCAKLT---------DKRSKRATMVGTPYWMAPEVVKQREY--- 696

Query: 245 NEKSDIWALGIFLYKLLFYTTPF 267
           +EK D+W+LGI   ++L    P+
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPY 719

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 111/227 (48%), Gaps = 30/227 (13%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL + PN+++ FD         +   ++ L++E      L + + +R    L E+E 
Sbjct: 81  IIMKLLNHPNVLRLFDV-------WETNSDLYLVLEYAEKGELFNMLVER--GPLPENEA 131

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
           ++    + IGIS  H L   ++HRD+K EN+L+D   N K+ D G  +      + ++D 
Sbjct: 132 VRAFRQIIIGISYCHSLG--VVHRDLKPENLLLDNKLNIKIADFGMAA------LESEDK 183

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF-EITGQ-- 272
            + T       +P Y APE+I    Y   +  SD+W+ G+ L+ LL    PF E  G   
Sbjct: 184 LLETS----CGSPHYAAPEIISGLPYEGFS--SDVWSCGVILFALLTGRLPFDEEDGNIR 237

Query: 273 ---MAILHSKYDFP-PNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
              + +   +++ P  ++ + +  +L+  +L  +P+ R  I +++ H
Sbjct: 238 NLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKH 284

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 107/231 (46%), Gaps = 25/231 (10%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           E   ++KL +SP++V+ F +     +       +  L+E  PN   L  M    K   S 
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESS-------LYFLLEYAPNGDFLSLM----KKYGSL 275

Query: 153 SEILKIMYDVSIGISNMHYL-DQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPP--M 209
            E     Y   I I  + YL    +IHRDIK EN+L+D     KL D G+    +P    
Sbjct: 276 DETCARYYAAQI-IDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNS 334

Query: 210 MSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
           +S  +  + T++     T +Y +PE++ D +     + + DIWA G  L++++    PF+
Sbjct: 335 VSKPEYDLSTRSKSFVGTAEYVSPELLNDSF----TDYRCDIWAFGCILFQMIAGKPPFK 390

Query: 269 ITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
            T +      ++  +Y F P  +   I +L+  +L +N + R  I Q+  H
Sbjct: 391 ATNEYLTFQKVMKVQYAFTPG-FPLIIRDLVKKILVKNLDRRLTISQIKEH 440

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VM   K   NIV Y DS  S       G ++ ++ME      L D +   +   L+
Sbjct: 611 NEIMVMSSSKHQ-NIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LT 659

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +V  G+  +H   + ++HRDIK +NVL+  N + KL D G  +Q +  ++ 
Sbjct: 660 EGQIGAVCREVLQGLEFLH--SKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIK 717

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
              +           TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 718 RTTMV---------GTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>Kwal_26.7154
          Length = 1213

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 18/171 (10%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            +KT ++E E + I   ++ GI N+H  D  ++HRDIK ENV+VD N   K+ D GS +  
Sbjct: 1055 MKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYV 1112

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+G+ LY +++  
Sbjct: 1113 KSGPF-----------DVFVGTI-DYAAPEVLGGEPYE--GKPQDIWAIGVLLYTIIYKE 1158

Query: 265  TPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
             PF    ++     + +    + S   I LI  +L  + + RP+I ++  H
Sbjct: 1159 NPFYNIDEILDADLRVN-SSERISDDCIALIRKILNRSVSKRPSIDEICNH 1208

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 114/241 (47%), Gaps = 33/241 (13%)

Query: 35  IVSYLAEGGFAQIYVVKFVE---YLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           +V    +G    +Y+ + ++   Y +E E+  ++    +G+   +K++I++ +     + 
Sbjct: 590 MVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQ----LGNKVAIKQMILSKQPRKELIV 645

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM-----NQRL 146
           NE+ VMK  K + NIV + ++      D      + ++ME     SL D +         
Sbjct: 646 NEILVMKDSKHN-NIVNFLEAYLKTEDD------LWVVMEYMEGGSLTDIIENSPTGSSG 698

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           ++ L+E +I  I+ +   G+  +H  D+ +IHRDIK +NVL+D     K+ D G    C+
Sbjct: 699 QSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSDNVLLDTRGRVKITDFGF---CA 753

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                    A M        TP + APE++    Y   +EK D+W+LGI   ++L    P
Sbjct: 754 KLTDKRSKRATMV------GTPYWMAPEVVKQREY---DEKVDVWSLGIMTIEMLESEPP 804

Query: 267 F 267
           +
Sbjct: 805 Y 805

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 90/192 (46%), Gaps = 21/192 (10%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K    ++  +  +H  +  ++HRD+KIEN++
Sbjct: 157 MLFEYVSGGQLLDYIIQH--GSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENIM 212

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           + ++   ++ D G ++   P     + +     ++Y      + APE++  + Y     +
Sbjct: 213 ISSSGEIRIIDFGLSNMYDP----KKQLHTFCGSLY------FAAPELLKAHPY--TGPE 260

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFP----PNKYSSKIINLIIIMLAENP 303
            DIW+ G+ LY L+    PF+     ++LH K        P   S  +I+L+  ML  +P
Sbjct: 261 VDIWSFGVVLYVLVCGKVPFD-DENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVVDP 319

Query: 304 NLRPNIFQVVYH 315
             R  + QVV+H
Sbjct: 320 YKRATLKQVVHH 331

>Kwal_26.7355
          Length = 1446

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 142/328 (43%), Gaps = 67/328 (20%)

Query: 16   NEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIAC 75
            N+ K  NG+       + E++    +G F  +++      LN          +T G++  
Sbjct: 1132 NKSKNSNGEYKEFAWIKGEMI---GKGSFGSVFL-----GLN----------VTTGEMIA 1173

Query: 76   LKRVIV-----NDEMGLN---EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE-- 125
            +K+V V      DE  L+    +R+EV  +K L  + NIVQY             GFE  
Sbjct: 1174 VKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT-NIVQYL------------GFENK 1220

Query: 126  ---VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIK 182
                 L +E     S+   +  RL  K  E+ I  +   V  G+S +H   + ++HRD+K
Sbjct: 1221 NYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLH--SKKILHRDMK 1276

Query: 183  IENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYL 242
             +N+L+D +   K+ D G  S+ S  + SN D+ M         T  + APEM+D  +  
Sbjct: 1277 ADNLLLDVDGICKISDFG-ISKKSNNIYSNSDMTM-------RGTVFWMAPEMVDTKQGY 1328

Query: 243  PINEKSDIWALGIFLYKLLFYTTPF---EITGQMAILHSKYDFPP-NKYSSKIIN----- 293
              + K DIW+LG  + ++     P+   E+   M  +      PP  + + KII+     
Sbjct: 1329 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKE 1386

Query: 294  LIIIMLAENPNLRPNIFQVVYHICSIMN 321
             +      NP  RP   +++ H   I++
Sbjct: 1387 FLDACFEINPEKRPTADELLSHPFCIVD 1414

>Sklu_2323.3 YPL209C, Contig c2323 5241-6443
          Length = 400

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 113/241 (46%), Gaps = 34/241 (14%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKT 148
           + R EVE+   L+  PN+ Q +        D K    V LLME   N  L     + L+ 
Sbjct: 184 QFRREVEIQASLRH-PNLTQLYGYFY----DDK---RVYLLMEYLVNGELY----RHLRV 231

Query: 149 KLSESEILKIMY--DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
               ++IL   Y   ++  ++ MH  D+ ++HRDIK EN+L+   N  KL D G +    
Sbjct: 232 NGPFNDILASYYVNQMADALNYMH--DRNVLHRDIKPENILIGFQNTLKLTDFGWS---- 285

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
             ++S       T    +  T  Y +PE++   +Y   +EK D+WALG+  Y+LL  T P
Sbjct: 286 --VISTTGAKRKT----LCGTLDYLSPELV---KYREYDEKVDVWALGVLAYELLVGTPP 336

Query: 267 FEITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNL 322
           FE   +      I+     F P++ S    +LI  +L  +P+ R ++  V+ H   + N 
Sbjct: 337 FEEASKELTYKRIVRRDLRF-PDQMSIDARDLIGRLLENDPSTRISLKDVLSHPWIVKNK 395

Query: 323 P 323
           P
Sbjct: 396 P 396

>Kwal_23.5290
          Length = 819

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 98/203 (48%), Gaps = 26/203 (12%)

Query: 70  VGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLL 129
           +GD   +K++I++ +     + NE+ VMK  +   NIV + ++      D      + ++
Sbjct: 564 IGDKVAIKQMILSKQPRKELIVNEILVMKDSQHK-NIVNFLEAYLKTEDD------LWVV 616

Query: 130 MELCPNKSLLDYM-----NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           ME     SL D +     N    + L+E +I  I+ +   G+  +H  D+ +IHRDIK +
Sbjct: 617 MEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH--DKHIIHRDIKSD 674

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           NVL+D     K+ D G  ++ +            ++   +  TP + APE++    Y   
Sbjct: 675 NVLLDNRARVKITDFGFCAKLT---------DKRSKRATMVGTPYWMAPEVVKQREY--- 722

Query: 245 NEKSDIWALGIFLYKLLFYTTPF 267
           +EK D+W+LGI   ++L    P+
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPY 745

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VM++ K S NIV + DS  ++        ++ ++ME     SL D +   L   LS
Sbjct: 664 NEILVMRESKHS-NIVNFIDSYLAK-------GDLWIVMEYMEGGSLTDVVTHCL---LS 712

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + ++HRDIK +N+L+    N KL D G  +Q       
Sbjct: 713 EGQIGAVCRETLKGLQFLH--SKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQI------ 764

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
           N++    T  +    TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 765 NENNLKRTTMV---GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 94/195 (48%), Gaps = 15/195 (7%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           +  L+E  PN   L  M +R  T LSE E  K  Y   I  +  H   Q +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVM-KRFGT-LSE-ECTK-YYGAQILDAIHHLHKQGIIHRDVKPEN 331

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPI 244
           +L+D     KL D G T++       N+   + T++     T +Y +PE++ D Y    +
Sbjct: 332 ILLDKTMKIKLTDFG-TAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLNDNY----V 386

Query: 245 NEKSDIWALGIFLYKLLFYTTPFEITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLA 300
           + + DIWA G  L++++    PF+ T +      ++  +Y F    +   + +LI  +L 
Sbjct: 387 DSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAG-FPMILRDLIKQLLV 445

Query: 301 ENPNLRPNIFQVVYH 315
           + P  R  I Q+  H
Sbjct: 446 KKPEQRLTILQIEKH 460

>Kwal_23.6325
          Length = 1542

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 125/272 (45%), Gaps = 29/272 (10%)

Query: 59   FESLGSKSAITVGDIACLKRVIVNDEMGLNE----MRNEVEVMKKLKSSPNIVQYFDSNA 114
            F ++ S   +  G+I  +K + + D   + +    ++ E+ V++ L + PN+VQY+    
Sbjct: 1260 FGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEML-NHPNVVQYYGVEV 1318

Query: 115  SRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQ 174
             R        +V L ME C   SL     Q L+    E E++  +Y + + +  + YL Q
Sbjct: 1319 HRD-------KVNLFMEYCEGGSL----AQLLEHGRIEDEMVTQIYALQM-LEGLAYLHQ 1366

Query: 175  P-LIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQY 230
              ++HRDIK EN+L+D N   K  D G+    +       ++    +   V++   TP Y
Sbjct: 1367 SSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMY 1426

Query: 231  RAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP-FEITGQMAIL-HSKYDFPP---- 284
             +PE I   +        DIW+LG  + +++    P F +  + AI+ H      P    
Sbjct: 1427 MSPESITGAKKGKFG-SGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPT 1485

Query: 285  -NKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
              + S + I+ ++  L ++PN R    +++ H
Sbjct: 1486 KEELSPQGIDFLLRCLKQDPNKRSTAMELLLH 1517

>Kwal_26.7788
          Length = 1267

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 118/270 (43%), Gaps = 48/270 (17%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL S PN++  ++   ++        E+ L++E      L DY+  R   +L E E 
Sbjct: 109 IIMKLISHPNVMGLYEVWENK-------LELFLVLEYVDGGELFDYLVSR--GRLPEKEA 159

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN-FKLCDMGSTSQCSPPMMSNQD 214
           +     +  G +  H  +  + HRD+K EN+L+D  N   K+ D G              
Sbjct: 160 IHYFRQIIEGTAYCHGFN--ICHRDLKPENLLLDKKNKRIKIADFGMA------------ 205

Query: 215 IAMMTQNIYVHTT---PQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
            A+ T N  + T+   P Y +PE++    Y      SD+W+ GI L+ LL    PF    
Sbjct: 206 -ALQTSNKLLETSCGSPHYASPEIVMGKNY--NGGPSDVWSCGIILFALLTGHLPFNDDN 262

Query: 272 QMAIL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLPVPIE 327
              +L      KY   P   SS   +LI  +L  +P+ R +I +++ H         P+ 
Sbjct: 263 IKRLLLKVQAGKYQM-PQSVSSGAQDLISRILVVDPDKRISINEILAH---------PLL 312

Query: 328 DRYG--LGPYNFDLYTKFQSK--VQTIQNQ 353
            +YG      N DL+    SK  + TI+++
Sbjct: 313 AKYGNKRSKSNSDLHILSHSKPQISTIKSE 342

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 105/230 (45%), Gaps = 36/230 (15%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL + PN+++ +D         +   ++ L++E      L + + +R    L E E 
Sbjct: 83  IIMKLLNHPNVLRLYDV-------WETNTDLYLVLEYAEKGELFNLLVER--GPLPEHEA 133

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
           ++    + IG+S  H L   ++HRD+K EN+L+D   N K+ D G               
Sbjct: 134 IRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMA------------- 178

Query: 216 AMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE---- 268
           A+ T+   + T   +P Y APE++    Y      SD+W+ G+ L+ LL    PF+    
Sbjct: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGF--ASDVWSCGVILFALLTGRLPFDEEDG 236

Query: 269 --ITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
              T  + +   +++ P  ++ S +  +LI  +L  +P  R     ++ H
Sbjct: 237 NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286

>Scas_564.7
          Length = 1210

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 92/193 (47%), Gaps = 23/193 (11%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K    ++  +  +H  +  ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYIIQH--GSLREHHARKFARGIASALEYIHANN--IVHRDLKIENIM 318

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           +  +   K+ D G ++         + +     ++Y      + APE++  + Y     +
Sbjct: 319 ISTSGEIKIIDFGLSNVFD----RKKQLHTFCGSLY------FAAPELLKAHPY--TGPE 366

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILH-----SKYDFPPNKYSSKIINLIIIMLAEN 302
            D+W+ G+ LY L+    PF+     ++LH      K D+ PN  S ++I+L+  ML  +
Sbjct: 367 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDY-PNHLSIEVISLLSKMLVVD 424

Query: 303 PNLRPNIFQVVYH 315
           P  R ++ QVV H
Sbjct: 425 PLRRASLKQVVEH 437

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 119/276 (43%), Gaps = 58/276 (21%)

Query: 88  NEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL----DY 141
           ++++ E+ +MKK   K    +++  D   SR+        + L++E C    +     D 
Sbjct: 194 DKIKREIAIMKKCHHKHVVKLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 245

Query: 142 MNQRLK--TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           +    K  + LS     +I+  V +G+  +HY  Q +IHRDIK  N+L+      K+ D 
Sbjct: 246 LETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVKISDF 303

Query: 200 GSTSQCSPPMMSNQDIAMMTQNIY-VHTTPQYRAPEMI--------------DLYRYLPI 244
           G +   S   +   D  +    +     TP + APE+               +L++   I
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 245 NEKSDIWALGIFLYKLLF----YTTPFEITGQMAILHSKYDFPPNKYSSKIIN------- 293
           + K DIWALG+ LY L+F    + + FE+     I++    FP  KYS  + N       
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFP--KYSDMLKNNQVLQMT 421

Query: 294 ----------LIIIMLAENPNLRPNIFQVVYH--IC 317
                     L+  +L +NP  R NI ++  H  +C
Sbjct: 422 EEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFVC 457

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 110/256 (42%), Gaps = 37/256 (14%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           V+ KL S PN++   +   ++        E+ L++E      L DY+    K KLSE E 
Sbjct: 178 VIMKLISHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVS--KGKLSEPEA 228

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN-FKLCDMGSTSQCSPPMMSNQD 214
           +     +  G+S  H  +  + HRD+K EN+L+D  N   K+ D G  +   P  +    
Sbjct: 229 VHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLLETS 286

Query: 215 IAMMTQNIYVHTTPQYRAPEMI--DLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQ 272
                       +P Y +PE++    Y   P    SD+W+ GI L+ LL    PF     
Sbjct: 287 CG----------SPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNI 332

Query: 273 MAIL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH--ICSIMNLPVPI 326
             +L      ++  PP   ++   +LI  +L  NP  R  I +++ H  I    N P  I
Sbjct: 333 KKLLLKVQAGRFQLPP-YLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHI 391

Query: 327 E--DRYGLGPYNFDLY 340
              +  G G  N DL+
Sbjct: 392 RKLNLLGRGKSNSDLH 407

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 109/232 (46%), Gaps = 33/232 (14%)

Query: 90  MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK 149
           +  E+  + +LKS P I  Y    A+   D      + ++ME C   S  D + +     
Sbjct: 61  LAQEIFFLAELKS-PLITNYI---ATMLED----VSMWIVMEYCGGGSCSDLLKRSYVNG 112

Query: 150 LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
           L E ++  I+++V++G+  +H  +Q  IHRDIK  N+L++     KL D G         
Sbjct: 113 LPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAANILLNEEGMVKLGDFG--------- 161

Query: 210 MSNQDIAMMTQNIYVHTTPQYRAPEMI----DLYRYLPINEKSDIWALGIFLYKLLFYTT 265
           +S    + + ++ +V  TP + APE++    D Y     NEK+DIW+LGI  Y+LL    
Sbjct: 162 VSGHIRSTLKRDTFV-GTPYWMAPEVVCCEVDGY-----NEKADIWSLGITTYELLKGLP 215

Query: 266 PFEITGQMAILHSKYDFPPNK----YSSKIINLIIIMLAENPNLRPNIFQVV 313
           P      M ++ +     P K    +S    + +   L + P  RP+ + ++
Sbjct: 216 PLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLL 267

>Kwal_47.17263
          Length = 1127

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 126/302 (41%), Gaps = 55/302 (18%)

Query: 86  GLNEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
           G ++++ E+ +MKK   +    +V+  D + SR+        + L++E C    +     
Sbjct: 154 GSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRK--------IYLVLEYCSKGEVKWCPG 205

Query: 144 QRLKTKLSESEIL------KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLC 197
            +L+T+     +L      +I   V +G+  +HY  Q +IHRDIK  N+L+  +   K+ 
Sbjct: 206 DQLETEARGPPLLTFQRAREIFRGVVLGLEYLHY--QGIIHRDIKPANLLISESGTVKIS 263

Query: 198 DMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLY----RYLP---------- 243
           D G +   S        +  + +      TP + APE+   +    R+ P          
Sbjct: 264 DFGVSFAASKSGAGYGSLDEL-ELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSI 322

Query: 244 INEKSDIWALGIFLYKLLFYTTPF----------EITGQMAILHSKYDFPPNKYSSKIIN 293
           I+   DIWA+G+ L+ LLF   PF          +I  Q  +L +  +   N   SKI N
Sbjct: 323 ISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGI-SKISN 381

Query: 294 ---------LIIIMLAENPNLRPNIFQVVYH--ICSIMNLPVPIEDRYGLGPYNFDLYTK 342
                    L+  +L +NP  R  I ++  H  +C      V  ++  G    N     K
Sbjct: 382 QEEYEAAKDLLGRLLTKNPFKRIKIAEIKKHPFVCWDFEHDVTSDNNSGCSAGNSSEKLK 441

Query: 343 FQ 344
           FQ
Sbjct: 442 FQ 443

>Sklu_1603.2 YPR054W, Contig c1603 1858-3324 reverse complement
          Length = 488

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 84/183 (45%), Gaps = 23/183 (12%)

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSN--ASRRTDGKPGFEVLLLMELCPNKS 137
           I + E+ L     E++ M   K   NI+   D +  + +  DG           L   + 
Sbjct: 158 IFHREVLLKRAIRELKFMNYFKGHKNIINLLDLDIVSEKPYDG-----------LYCYQE 206

Query: 138 LLDYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194
           L+DY   R+     +LSE  I   +Y +  G+  +H  D  +IHRD+K  N+L   + N 
Sbjct: 207 LIDYDLARVIHSSVQLSEFHIKSFLYQILCGLKYIHSAD--VIHRDLKPGNILCTIHGNL 264

Query: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254
           K+CD G     SP     + ++ +T  +    T  YRAPE+I  ++    ++  D+WA+G
Sbjct: 265 KICDFGLARGVSPQFFQGRTVSHITNYV---ATRWYRAPELILSHK--NYSKAIDMWAVG 319

Query: 255 IFL 257
             L
Sbjct: 320 CIL 322

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 95/191 (49%), Gaps = 25/191 (13%)

Query: 84  EMGLNE--MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
           +MGL++  +  EV +  K    PN+++  D N S+         + +++E+     L D 
Sbjct: 54  KMGLSDKDITKEVVLQSKCSKHPNVLRLIDCNVSKEY-------MWIILEMADGGDLFDK 106

Query: 142 MNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGS 201
           +   +     +S++ +  +   +   N  +++  + HRDIK EN+L+D N N KL D G 
Sbjct: 107 IEPDVGV---DSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENILLDKNGNLKLADFGL 163

Query: 202 TSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYR---YLPINEKSDIWALGIFLY 258
            SQ        +D   +  ++    +P Y APE+  LY    Y    +++DIW++GI L+
Sbjct: 164 ASQ-----FRRKD-GTLRVSMDQRGSPPYMAPEV--LYSEEGYYA--DRTDIWSIGILLF 213

Query: 259 KLLFYTTPFEI 269
            LL   TP+E+
Sbjct: 214 VLLTGQTPWEL 224

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 112/261 (42%), Gaps = 44/261 (16%)

Query: 21  PNGQMISVGAHRVEIVSY-----LAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIAC 75
           P   M S G   V    Y     L EG F ++ +           S G +    V     
Sbjct: 27  PRNSMSSRGKKHVTFGPYIVGSTLGEGEFGKVKLG-----WTRTPSTGPEQRPAVSKQVA 81

Query: 76  LK-----RVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLM 130
           +K      ++ N E  +   R E+  +K L + PN+V+  +   + +  G       +++
Sbjct: 82  IKLIRRDTIVKNSEKEIKIYR-EINALKHL-THPNVVRLEEVLQNSKYIG-------IVL 132

Query: 131 ELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDA 190
           E         Y+ +  K +L ES   ++   +  G++ MH   + L+HRD+K+EN+L+D 
Sbjct: 133 EYASGGEFYKYIQR--KRRLKESTACRLFAQLISGVTYMH--SKNLVHRDLKLENLLLDK 188

Query: 191 NNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEK 247
           N N  + D G  ++  P             N Y+ T   +P Y APE++   R   +  K
Sbjct: 189 NENLVITDFGFVNEFLP------------DNEYMKTSCGSPCYAAPELVISTRPY-VARK 235

Query: 248 SDIWALGIFLYKLLFYTTPFE 268
           +D+W+ GI LY +L    P++
Sbjct: 236 ADVWSCGIILYAMLAGYLPWD 256

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 92/203 (45%), Gaps = 33/203 (16%)

Query: 88  NEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL----DY 141
           ++++ E+ +MKK   K    +++  D   SR+        + L++E C    +     D 
Sbjct: 187 DKIKREIAIMKKCHHKHVVQLIEVLDDLKSRK--------IYLVLEYCSRGEVKWCPPDC 238

Query: 142 MNQRLK--TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           M    K  + LS  E  +I+  V +G+  +HY  Q +IHRDIK  N+L+  +   K+ D 
Sbjct: 239 MESDAKGPSLLSFQETREILRGVVLGLEYLHY--QGIIHRDIKPANLLISGDGTVKISDF 296

Query: 200 G-STSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI--------------DLYRYLPI 244
           G S +  S     + +     +      TP + APEM               +L+R   I
Sbjct: 297 GVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCI 356

Query: 245 NEKSDIWALGIFLYKLLFYTTPF 267
           +   DIWA+G+ LY LLF   PF
Sbjct: 357 SFMIDIWAVGVTLYCLLFGMLPF 379

>Scas_685.24
          Length = 515

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 100/229 (43%), Gaps = 33/229 (14%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           L  +  E+  + +LKS P I+ Y  +     +       + ++ME C   S  D +    
Sbjct: 62  LEVLAQEIFFLAELKS-PYIINYITTLLEDAS-------MWIVMEYCGGGSCSDLLKYYF 113

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
              L E ++  I  ++  G+  +H  +Q  IHRDIK  N+L+    + KL D G + Q  
Sbjct: 114 NNGLPEKKVAYITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLK 171

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEM----IDLYRYLPINEKSDIWALGIFLYKLLF 262
             +     +           TP + APE+    I+ Y     +EK DIW+LGI +++LL 
Sbjct: 172 STLRRGTIVG----------TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLK 216

Query: 263 YTTPFEITGQMAILH--SKYDFP--PNKYSSKIINLIIIMLAENPNLRP 307
              P      + +L   S+   P     YS    + + + L +NPN RP
Sbjct: 217 GVPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERP 265

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 97/204 (47%), Gaps = 24/204 (11%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           E+EVMK+     N+V+ ++       +     +V L++E C    +      +++ K   
Sbjct: 104 EIEVMKRCHHE-NVVELYEI-----LNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVG 157

Query: 153 SEIL------KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG---STS 203
             IL      K++ DV  G+  +H   Q + HRDIK  N+L+ +N   K+ D G   ST+
Sbjct: 158 PSILTFQQSRKVVLDVVSGLEYLH--SQGITHRDIKPSNLLISSNGTVKISDFGVAMSTA 215

Query: 204 QCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFY 263
             S  + S+ +  + ++ +    TP + APE+    +    +   DIW+LG+ +Y LLF 
Sbjct: 216 TGSTNIQSSHEQLLKSRAL---GTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFG 272

Query: 264 TTPFEITGQM----AILHSKYDFP 283
             PF     +    +I++   +FP
Sbjct: 273 KLPFNANSGLELFDSIINKPLEFP 296

>YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specific
           protein kinase of the MAP family required for completion
           of sporulation [1167 bp, 388 aa]
          Length = 388

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 108/261 (41%), Gaps = 36/261 (13%)

Query: 5   NSRSM---TSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFES 61
           N+R++   ++L +P +      + IS+  +  EI+ +L +G +  +  VKF       + 
Sbjct: 8   NTRAINVASNLGAPQQRTIFAKERISIPGYY-EIIQFLGKGAYGTVCSVKF-------KG 59

Query: 62  LGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSN--ASRRTD 119
               + I V  I+     I N E+ L     E++ M   K   NIV   D     S   D
Sbjct: 60  RSPAARIAVKKIS----NIFNKEILLKRAIRELKFMNFFKGHKNIVNLIDLEIVTSSPYD 115

Query: 120 GKPGFEVLLLMELCPNKSLLDYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPL 176
           G   ++            L+DY   ++     +LSE  I   +Y +  G+  +H  D  +
Sbjct: 116 GLYCYQ-----------ELIDYDLAKVIHSSVQLSEFHIKYFLYQILCGLKYIHSAD--V 162

Query: 177 IHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI 236
           IHRD+K  N+L   N   K+CD G                      YV  T  YRAPE+ 
Sbjct: 163 IHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYV-ATRWYRAPEL- 220

Query: 237 DLYRYLPINEKSDIWALGIFL 257
            L    P ++  DIWA+G  L
Sbjct: 221 -LLSNQPYSKSVDIWAVGCIL 240

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 124/274 (45%), Gaps = 34/274 (12%)

Query: 70  VGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLL 129
           +GD   +K+++++ +     + NE+ VM   +   NIV + ++      D      + ++
Sbjct: 606 IGDKVAIKQMVLSKQPRKELIVNEIMVMNDSRHE-NIVNFLEAYLKTEDD------LWVV 658

Query: 130 MELCPNKSLLDYM-----NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           ME     SL D +     N    + LSE +I  I+ +   G+  +H  D+ +IHRDIK +
Sbjct: 659 MEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLH--DKNIIHRDIKSD 716

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           NVL+D     K+ D G  ++     +++Q     T    +  TP + APE++    Y   
Sbjct: 717 NVLLDTKARVKITDFGFCAK-----LTDQRSKRAT----MVGTPYWMAPEVVKQKEY--- 764

Query: 245 NEKSDIWALGIFLYKLLFYTTPF--EITGQMAILHSKYDFP----PNKYSSKIINLIIIM 298
           + K D+W+LGI   ++L    P+  E   +   L +    P    P   S +I   + + 
Sbjct: 765 DAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVC 824

Query: 299 LAENPNLRPNIFQVVYHICSIMNLPVPIEDRYGL 332
           L  +   R +  ++++H  S  N+    ED   L
Sbjct: 825 LCVDVKYRASTEELLHH--SFFNIACEPEDLTSL 856

>Scas_668.22
          Length = 893

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 87/176 (49%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VMK  +  PNIV + DS      DG    ++ ++ME     SL D +   +   L+
Sbjct: 655 NEILVMKGSRH-PNIVNFIDSYL---LDG----DLWVIMEYMEGGSLTDVVTHCI---LT 703

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + ++HRDIK +N+L+  + + KL D G  +Q +     
Sbjct: 704 EGQIGAVCRETLSGLQFLH--SKGVLHRDIKSDNILLSISGDIKLTDFGFCAQIN----- 756

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                +  +   +  TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 757 ----EINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 805

>Scas_627.7
          Length = 349

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 112/239 (46%), Gaps = 30/239 (12%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKT 148
           + R EVE+   L + PN+ + +      +        V LLME      L  Y   R   
Sbjct: 135 QFRREVEIQTSL-NHPNLTKLYGHFHDEK-------RVYLLMEYLVYGEL--YKLLRSHG 184

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPP 208
             ++    + ++ ++  ++ +H  D+ +IHRD+K EN+L+  NN  KL D G  S  +P 
Sbjct: 185 PFNDVIASRFVFQIADALNYLH--DKQIIHRDLKPENILIGFNNVIKLTDFG-WSIINPR 241

Query: 209 MMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF- 267
            +  + +           T  Y +PEMI    Y   ++K D+WALG+  Y+L+  + PF 
Sbjct: 242 GVKRKTLC---------GTIDYLSPEMIRSREY---DDKVDVWALGVLTYELIVGSPPFE 289

Query: 268 EITGQMA---ILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLP 323
           E T ++    IL +   FP    S  + +LI  +L  NP+ R ++  V+ H   I N P
Sbjct: 290 EDTKELTYKRILKNDIKFPET-VSHDVKDLISKLLKYNPSERISMRDVMKHPWIIRNKP 347

>Scas_602.11
          Length = 1186

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 86/341 (25%), Positives = 136/341 (39%), Gaps = 87/341 (25%)

Query: 88  NEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQR 145
           + ++ E+ +MKKL  K    +++  D   SR+        + L++E C    +       
Sbjct: 226 DRIKREIAIMKKLHHKHVVKLIEVLDDLKSRK--------IYLVLEYCAQGEIKWCPKDC 277

Query: 146 LKTK------LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           L+T+      LS     +I+  V +G+  +HY  Q +IHRDIK  N+LVD     K+ D 
Sbjct: 278 LETEAKGPPLLSFQSAREIIRGVILGLEYLHY--QGIIHRDIKPANLLVDEEGTVKISDF 335

Query: 200 G----------STSQCS------PPMMSNQDI-AMMTQN------------IYVHTTPQY 230
           G          ST+  S      P  +S     +M T N                 TP +
Sbjct: 336 GVSLASRSSGNSTANSSSVLGGTPRNLSRSSTESMNTTNNNDDESIDEVELAKTAGTPAF 395

Query: 231 RAPEMI--------------DLYRYLPINEKSDIWALGIFLYKLLFYTTPF--------- 267
            APE+               ++++   I+   DIWALGI  Y LLF   PF         
Sbjct: 396 FAPEICLGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPFISDFELELF 455

Query: 268 -EITGQMAILHSKYDFPPNKYSS--------KIINLIIIMLAENPNLRPNIFQVVYHICS 318
            +I G+     S  +   N+ S+           N++  +L +NP+ R +I ++ YH   
Sbjct: 456 EKIVGEPLTFPSYEELQANRVSNVCSIEEYEAAKNVLQRLLEKNPSKRCSILELKYH--- 512

Query: 319 IMNLPVPIEDRYGLGPYNFDLYT-KFQSKVQTIQNQINYLQ 358
               P    D       N DL T K + K     NQ++ L+
Sbjct: 513 ----PFICWDFDHFAELNEDLITSKLKEKEIFQANQVDSLE 549

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 86/176 (48%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VMK  K + NIV + DS   R        ++ ++ME     SL D +   +   L+
Sbjct: 742 NEILVMKGSKHN-NIVNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 790

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + +IHRDIK +N+L+  N + KL D G  +Q +     
Sbjct: 791 EGQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQIN----- 843

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                +  +   +  TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 844 ----EVNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 892

>Scas_693.17
          Length = 1049

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 92/205 (44%), Gaps = 27/205 (13%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L ES        +   +  +H     ++HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQH--GSLKESRARTFTRQICSALKYLH--SHNIVHRDLKIENIM 232

Query: 188 VDANNNFKLCDMGSTS---QCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           +  + N KL D G ++   +C+        +     ++Y      + APE++    Y  I
Sbjct: 233 ISKDGNIKLIDFGLSNLYDKCN-------KLKTYCGSLY------FAAPELLKATPY--I 277

Query: 245 NEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYD----FPPNKYSSKIINLIIIMLA 300
             + D+W+ G+ LY L+    PF+      +LH K      F P   S ++I+L+  ML 
Sbjct: 278 GPEIDVWSFGVVLYVLVCGKVPFDDENS-NVLHEKIKQGKVFYPQFLSIEVISLLSKMLV 336

Query: 301 ENPNLRPNIFQVVYHICSIMNLPVP 325
            +P  R  + QV+ H   + +   P
Sbjct: 337 VDPFKRATLDQVMNHHWMVRDCDGP 361

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 67.0 bits (162), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 46/125 (36%), Positives = 65/125 (52%), Gaps = 21/125 (16%)

Query: 146 LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
           LKT ++E E   I   V+ GI ++H  D  ++HRDIK EN++VD     KL D GS +  
Sbjct: 85  LKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAYV 142

Query: 206 -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI--DLYRYLPINEKSDIWALGIFLYKLLF 262
            S P            +++V T   Y APE++  D Y   P     DIWA+G+ LY ++F
Sbjct: 143 KSGPF-----------DVFVGTI-DYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIF 186

Query: 263 YTTPF 267
              PF
Sbjct: 187 KENPF 191

>Kwal_56.23717
          Length = 858

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 92/193 (47%), Gaps = 23/193 (11%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K    ++  +  +H  +  ++HRD+KIEN++
Sbjct: 10  MLFEYVSGGQLLDYIIQH--GSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENIM 65

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           +  +   K+ D G ++  +P     + +     ++Y      + APE++    Y     +
Sbjct: 66  ISTSGEIKIIDFGLSNMYNP----KKQLHTFCGSLY------FAAPELLKACPY--TGPE 113

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILH-----SKYDFPPNKYSSKIINLIIIMLAEN 302
            D+W+ G+ L+ L+    PF+     ++LH      K ++ P   S ++I+L+  ML  +
Sbjct: 114 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEY-PQHLSIEVISLLSKMLVVD 171

Query: 303 PNLRPNIFQVVYH 315
           P  R ++ QVV H
Sbjct: 172 PTKRASLKQVVNH 184

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 122/269 (45%), Gaps = 30/269 (11%)

Query: 59   FESLGSKSAITVGDIACLKRVIVNDEMGLNE----MRNEVEVMKKLKSSPNIVQYFDSNA 114
            F S+ S   +  GDI  +K +  ND   + +    +R+E+ V++ L + PN+VQY+    
Sbjct: 1202 FGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NHPNVVQYYGVEV 1260

Query: 115  SRRTDGKPGFEVLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSI--GISNMHY 171
             R         V + ME C   SL   + + R+     E E++  +Y + +  G++ +H 
Sbjct: 1261 HRD-------RVNIFMEYCEGGSLASLLAHGRI-----EDEMVTQVYSLQMLEGLAYLH- 1307

Query: 172  LDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYR 231
             +  + HRDIK EN+L+D N   K  D G+    +       ++    +   +  TP Y 
Sbjct: 1308 -ESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYM 1366

Query: 232  APEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE-ITGQMAILHSKYD-----FPP- 284
            +PE I    Y       DIW+LG  + +++    P+  +  Q AI++         FP  
Sbjct: 1367 SPEAISGTGYGKFG-SDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVAAGQIPMFPSK 1425

Query: 285  NKYSSKIINLIIIMLAENPNLRPNIFQVV 313
            N+ S   I  +   L ++PN R    +++
Sbjct: 1426 NEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 126/285 (44%), Gaps = 44/285 (15%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G    E++  L +G F Q+Y VK             K    +  +  L K+VIV  +E+ 
Sbjct: 408 GPQDFEVLRLLGKGTFGQVYQVK------------KKDTQRIYAMKVLSKKVIVKKNEIA 455

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
                  + V    KSSP IV         +   +   ++ L+ +      L  ++ +  
Sbjct: 456 HTIGERNILVTTASKSSPFIV-------GLKFSFQTPTDLYLVTDYMSGGELFWHLQK-- 506

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + + SE      + ++ + + ++H  D  +++RD+K EN+L+DAN N  LCD G      
Sbjct: 507 EGRFSEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFG------ 558

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
              +S  D+   T N +  TT +Y APE ++D   Y  +    D W+LG+ ++++    +
Sbjct: 559 ---LSKADLKDRT-NTFCGTT-EYLAPELLLDETGYTKM---VDFWSLGVLIFEMCCGWS 610

Query: 266 PF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           PF  E   +M   I   K  FP +  S +  + +  +L  NP  R
Sbjct: 611 PFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 96/202 (47%), Gaps = 24/202 (11%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           + +++E         Y+ +  K +L ES   ++   +  G++ MHY  + L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYIQR--KRRLKESSACRLFAQLISGVNYMHY--KGLVHRDLKLEN 180

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           +L+D + N  + D G  ++        +D  +M  +     +P Y APE++   +     
Sbjct: 181 LLLDKHENLVITDFGFVNEFF------EDNELMKTSC---GSPCYAAPELVVSTKAYEA- 230

Query: 246 EKSDIWALGIFLYKLLFYTTPFEI-----TG-QMAILHSKYDFPPNKYSSKII----NLI 295
            K+D+W+ G+ LY +L    P++      TG  +A L+      P K+   I     +L+
Sbjct: 231 RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTPLKFPEYITPIPRDLL 290

Query: 296 IIMLAENPNLRPNIFQVVYHIC 317
             +L  NP  R N+  +  H+ 
Sbjct: 291 RRILVPNPRRRINLQTIKRHVW 312

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VMK  K  PNIV + DS   +        ++ ++ME     SL D +   +   L+
Sbjct: 664 NEILVMKGSKH-PNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 712

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + ++HRDIK +N+L+    + KL D G  +Q +     
Sbjct: 713 EGQIGAVCRETLSGLEFLH--SKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQIN----- 765

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                +  +   +  TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 766 ----ELNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 814

>Kwal_26.7861
          Length = 955

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VMK  K + NIV + DS   R        ++ ++ME     SL D +   +   L+
Sbjct: 711 NEILVMKASKHA-NIVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LT 759

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + +IHRDIK +NVL+  +   KL D G  +Q +     
Sbjct: 760 EGQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQIN----- 812

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                +  +   +  TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 813 ----EINLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 861

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 85/176 (48%), Gaps = 25/176 (14%)

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLS 151
           NE+ VMK  + + NIV + DS   +        ++ ++ME     SL D +   +   L+
Sbjct: 727 NEILVMKGSRHN-NIVNFIDSYLLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 775

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           E +I  +  +   G+  +H   + +IHRDIK +N+L+  + N KL D G  +Q +   + 
Sbjct: 776 EGQIAAVSRETLRGLHFLH--SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQINETNLK 833

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
              +           TP + APE++    Y P   K DIW+LGI + +++    P+
Sbjct: 834 RTTMV---------GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>Scas_548.6
          Length = 1382

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 82/169 (48%), Gaps = 20/169 (11%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
             KT ++E E   I   +  GI ++H  DQ ++HRDIK ENV+VD+    K+ D GS +  
Sbjct: 1224 FKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYV 1281

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+GI LY ++F  
Sbjct: 1282 KSGPF-----------DVFVGTI-DYAAPEVLSGEPYE--GKPQDIWAIGILLYTIVFKE 1327

Query: 265  TPFEITGQMAILHSKYDF-PPNKYSSKIINLIIIMLAENPNLRPNIFQV 312
             PF    +  IL  +  F   N  S   I LI  +L  +   RP I ++
Sbjct: 1328 NPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEI 1374

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 106/232 (45%), Gaps = 27/232 (11%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           E   +++L +S  IV+ F +     +       +  L+E  PN   L  M    K   S 
Sbjct: 230 EKNALQRLNNSRGIVKLFFTFQDESS-------LYFLLEYAPNGDFLSVM----KKYGSL 278

Query: 153 SEILKIMYDVSI--GISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM- 209
           SE     Y   I  GI  +H   + +IHRDIK EN+L+D +   K+ D G+     P   
Sbjct: 279 SEDCTRYYSAQIIDGIKYLH--SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNE 336

Query: 210 -MSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
              N +  ++T++     T +Y +PE++ D Y    ++ + DIWA G  +++++    PF
Sbjct: 337 DEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPF 392

Query: 268 EITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
           + T +      ++  +Y F    +   + +L+  +L + P  R  I Q+  H
Sbjct: 393 KATNEYLTFQKVMKVQYAFTAG-FPVVVRDLVKRILLKVPEQRLTIPQIEKH 443

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 101/219 (46%), Gaps = 25/219 (11%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K    V+  +  +H  +  ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYIIQH--GSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 264

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           +  +   K+ D G ++       + + +     ++Y      + APE++  + Y     +
Sbjct: 265 ISNSGEIKIIDFGLSNVYD----TRKQLHTFCGSLY------FAAPELLKAHPY--TGPE 312

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFP----PNKYSSKIINLIIIMLAENP 303
            D+W+ G+ LY L+    PF+     ++LH K        P   S ++++L+  ML  +P
Sbjct: 313 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKRGKVEYPQHLSIEVMSLLSKMLVVDP 371

Query: 304 NLRPNIFQVVYH--ICSIMNLPVP--IEDRYGLGPYNFD 338
           + R ++ QVV H  +    + P P  + +R  L P   D
Sbjct: 372 SRRASLKQVVEHPWMTKGYDTPAPSYVPNRIPLTPEMLD 410

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 64/123 (52%), Gaps = 17/123 (13%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
             KT ++E E   I   V  GI ++H  DQ ++HRDIK ENV+VD+    K+ D GS +  
Sbjct: 1198 FKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYV 1255

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+GI LY ++F  
Sbjct: 1256 KSGPF-----------DVFVGTI-DYAAPEVLGGNPYE--GQPQDIWAIGILLYTVVFKE 1301

Query: 265  TPF 267
             PF
Sbjct: 1302 NPF 1304

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 124/285 (43%), Gaps = 44/285 (15%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G    E++  L +G F Q+Y V+             K  + +  +  L K+VIV  +E+ 
Sbjct: 321 GPQDFEVLRLLGKGTFGQVYQVR------------KKDTMRIYAMKVLSKKVIVKKNEIA 368

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
                  + V    KSSP IV         +   +   ++ L+ +      L  ++ +  
Sbjct: 369 HTIGERNILVRTASKSSPFIV-------GLKFSFQTPTDLYLVTDFMSGGELFWHLQK-- 419

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + + +E      + ++ + +  +H  D  +++RD+K EN+L+DAN N  LCD G      
Sbjct: 420 EGRFTEDRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG------ 471

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPINEKSDIWALGIFLYKLLFYTT 265
              +S  D+   T N +  TT +Y APE++ D   Y    +  D W+LG+ ++++    +
Sbjct: 472 ---LSKADLKDRT-NTFCGTT-EYLAPELLMDETGY---TKMVDFWSLGVLIFEMCCGWS 523

Query: 266 PFEITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           PF  +        I   K  FP +  S +  + +  +L  NP  R
Sbjct: 524 PFFASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 568

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 81/166 (48%), Gaps = 20/166 (12%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
             KT ++E E   +   V  G+ ++H  DQ ++HRDIK EN++VD+    K+ D GS +  
Sbjct: 1178 FKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYV 1235

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+GI LY ++F  
Sbjct: 1236 KSGPF-----------DVFVGTI-DYAAPEVLGGSPYE--GKPQDIWAIGILLYTIVFKE 1281

Query: 265  TPFEITGQMAILHSKYDFPPNKY-SSKIINLIIIMLAENPNLRPNI 309
             PF    +  IL  +  F  ++  S +   LI  +L  N   RP I
Sbjct: 1282 NPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 118/247 (47%), Gaps = 29/247 (11%)

Query: 73  IACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMEL 132
           +  +K V+  ++  LN++  E+ ++K L  + NIV+Y           +  +E+ +L+E 
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-------HGFIRKSYELYILLEY 101

Query: 133 CPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN 192
           C N SL   ++ R  T LSE+E    +    +G+  +H   + +IHRDIK  N+L+ A+N
Sbjct: 102 CANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLH--GEGVIHRDIKAANILLSADN 158

Query: 193 NFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWA 252
             KL D G ++  +   ++            +  T  + APE++        +  SDIW+
Sbjct: 159 TVKLADFGVSTIVNSSALT------------LAGTLNWMAPEILG---NRGASTLSDIWS 203

Query: 253 LGIFLYKLLFYTTPFEITGQMAILHSKYD---FPPNKYSSKIINLIIIMLAENPNLRPNI 309
           LG  + ++L    P+       I ++  +   +PP+ +S  + + +     +N   RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTA 263

Query: 310 FQVVYHI 316
            Q++ H+
Sbjct: 264 DQLLKHV 270

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 102/228 (44%), Gaps = 35/228 (15%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           ++ KL S PN++  ++   ++        E+ L++E      L DY+    K KL ESE 
Sbjct: 126 IIMKLISHPNVMGLYEVWENKS-------ELYLVLEYVEGGELFDYLVS--KGKLPESEA 176

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN-NFKLCDMGSTSQCSPPMMSNQD 214
           +     +   ++  H  +  + HRD+K EN+L+D    + K+ D G              
Sbjct: 177 IHYFKQIVQAVAYCHGFN--ICHRDLKPENLLLDKKKRSIKIADFGMA------------ 222

Query: 215 IAMMTQNIYVHTT---PQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
            A+ T +  + T+   P Y +PE++   +Y      SD+W+ GI L+ LL    PF    
Sbjct: 223 -ALETSDKLLETSCGSPHYASPEIVLGRKYH--GSPSDVWSCGIILFALLTGHLPFNDDN 279

Query: 272 QMAIL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
              +L      KY   P   S +  +LI  +L  +PN R  I Q++ H
Sbjct: 280 VKKLLLKVQSGKYQM-PQWLSVEAKDLISRILVVDPNRRITIDQILQH 326

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 120/259 (46%), Gaps = 43/259 (16%)

Query: 73  IACLKR-VIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           I  +KR  I ND     ++  E+  +K L S PNIV+  +   + R  G       +++E
Sbjct: 79  IKLIKRDSISNDYRKEVKIYREINALKHL-SHPNIVKLEEVLQNSRYIG-------IVLE 130

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYL-DQPLIHRDIKIENVLVDA 190
                    Y+ +  K +L E    ++   +   IS +HY+  + L+HRD+K+EN+L+D 
Sbjct: 131 YACGGEFYKYIQK--KRRLKEMNACRLFSQL---ISGVHYIHSKGLVHRDLKLENLLLDK 185

Query: 191 NNNFKLCDMGSTSQ-CSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI---DLYRYLPINE 246
           N N  + D G  ++ CS      ++  M T       +P Y APE++   + Y       
Sbjct: 186 NENLVITDFGFVNEFCS------RNELMKTSC----GSPCYAAPELVISAEPYE----AR 231

Query: 247 KSDIWALGIFLYKLLFYTTPFEIT------GQMAILHSKYDFPPNKYSSKII----NLII 296
           K+DIW+ G+ LY +L    P++          +  L++  +  P K+   I+    +L+ 
Sbjct: 232 KADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPRDLLR 291

Query: 297 IMLAENPNLRPNIFQVVYH 315
            ML  +P  R N+ Q+  H
Sbjct: 292 RMLVSDPKKRINLKQIKKH 310

>Scas_703.5
          Length = 749

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 126/285 (44%), Gaps = 44/285 (15%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G +  E++  L +G F Q+Y VK             K    +  +  L K+VIV  +E+ 
Sbjct: 340 GPNDFEVLRLLGKGTFGQVYQVK------------KKDTKRIYAMKVLSKKVIVKKNEVA 387

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
                  + V    K+SP IV         +   +   ++ L+ +      L  ++ +  
Sbjct: 388 HTIGERNILVTTATKASPFIV-------GLKFSFQTPTDLYLVTDFMSGGELFWHLQK-- 438

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + + +E      + ++ + +  +H  D  +++RD+K EN+L+DAN N  LCD G      
Sbjct: 439 EGRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG------ 490

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
              +S  D+   T N +  TT +Y APE ++D   Y  +    D W+LG+ ++++    +
Sbjct: 491 ---LSKADLKDRT-NTFCGTT-EYLAPELLLDEAGYTKM---VDFWSLGVLIFEMCCGWS 542

Query: 266 PF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           PF  E   +M   I   K  FP +  S +  + +  +L  NP  R
Sbjct: 543 PFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 587

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 88/193 (45%), Gaps = 23/193 (11%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQP-LIHRDIKIENV 186
           +  E      LLDY+ Q     L E+   K+   +   +S + YL    ++HRD+KIEN+
Sbjct: 168 MFFEFISGGQLLDYIIQH--GSLKENHARKVSRGI---LSALQYLHANNIVHRDLKIENI 222

Query: 187 LVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE 246
           ++      KL D G ++   P     + +     ++Y      + APE++  + YL    
Sbjct: 223 MLSKTGEIKLIDFGLSNMYDP----RKSLQTFCGSLY------FAAPELLKAHPYL--GP 270

Query: 247 KSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFP----PNKYSSKIINLIIIMLAEN 302
           + D+W+ G+ LY L+    PF+     A LH K        P   S  +I+L+  +L  +
Sbjct: 271 EVDVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSIDVISLLSKILVVD 329

Query: 303 PNLRPNIFQVVYH 315
           P  R  + QVV H
Sbjct: 330 PQKRATLQQVVNH 342

>Kwal_56.22693
          Length = 984

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 95/197 (48%), Gaps = 19/197 (9%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSI--GISNMHYLDQPLIHRDIKI 183
           +  L+E  PN   L      +K   S S+   + Y   I   I  +H+  + ++HRDIK 
Sbjct: 232 LYFLLEYAPNGDFLSV----IKKFGSLSQECAVYYSAQILDAIDYLHH--KGIVHRDIKP 285

Query: 184 ENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYL 242
           EN+L+D +   KL D G T++      + Q   ++ ++     T +Y +PE++ D Y   
Sbjct: 286 ENILLDKDMKVKLTDFG-TARILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY--- 341

Query: 243 PINEKSDIWALGIFLYKLLFYTTPFEITGQ----MAILHSKYDFPPNKYSSKIINLIIIM 298
            ++ K DIWA G  L++++    PF+ T +      ++  +Y F    +   I +LI  +
Sbjct: 342 -VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPLVIRDLIKKI 399

Query: 299 LAENPNLRPNIFQVVYH 315
           L ++P  R +  Q+  H
Sbjct: 400 LVKSPEQRLDASQIKKH 416

>Sklu_2366.5 YBR274W, Contig c2366 12866-14266 reverse complement
          Length = 466

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 107/250 (42%), Gaps = 48/250 (19%)

Query: 85  MGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ 144
           M  N++  EV +  +     NI++  D N S+         + + ME+     L D +  
Sbjct: 1   MSENDVSKEVIIHSRCSKHSNILKVIDCNISKDY-------LWIAMEMADGGDLFDKIEP 53

Query: 145 RLKTKLSESEILKIMYDVSI-GISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
            +     ++E+ +  +   +  I ++H +   + HRDIK EN+L+D N N KL D G  S
Sbjct: 54  DIGV---DAEVAQFYFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLAS 109

Query: 204 QC-----SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLY 258
           Q      +  +  +Q             +P Y APE+I    Y    + +DIW+ GI ++
Sbjct: 110 QFRRKDGTKRLARDQ-----------RGSPPYMAPEIIYSSEYYA--DTTDIWSCGILVF 156

Query: 259 KLLFYTTPFEITGQMAILHSKYDF-------------PPNKYSSKIINLIIIMLAENPNL 305
            LL   TP+E+  +       Y+F             P  K     +NL+  +L  NP+ 
Sbjct: 157 VLLTGETPWELPSE-----DDYNFREFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSK 211

Query: 306 RPNIFQVVYH 315
           R  I Q+  H
Sbjct: 212 RATILQLTSH 221

>Sklu_2073.3 YER129W, Contig c2073 2194-5742
          Length = 1182

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 95/212 (44%), Gaps = 33/212 (15%)

Query: 88  NEMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQR 145
           ++++ E+ +MKK   +    +++  D   SR+        + L++E C    +      +
Sbjct: 168 DKIKREIAIMKKCHHEHVVKLIEVLDDFKSRK--------IYLVLEYCSKGEIKWCPGDQ 219

Query: 146 LKTKLSESEIL------KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
           L+TK     +L      +++  V +G+  +HY  Q +IHRDIK  N+LV      K+ D 
Sbjct: 220 LETKARGPPLLTFQRAREVLRGVVLGLEYLHY--QGIIHRDIKPANLLVSETGTVKISDF 277

Query: 200 GSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI----DLYRYLPINEKS------- 248
           G +   S     N  I  + +      TP + APE+      L ++ P  + +       
Sbjct: 278 GVSLAASTTEDGNGFIDEL-ELAKTAGTPAFFAPEICLGHDALEKFNPDKKATKKGLCIS 336

Query: 249 ---DIWALGIFLYKLLFYTTPFEITGQMAILH 277
              DIWALG+ L+ LLF   PF    ++ + H
Sbjct: 337 FMIDIWALGVTLHCLLFGQLPFISEFELELFH 368

>Scas_493.2
          Length = 1117

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 116/262 (44%), Gaps = 50/262 (19%)

Query: 90  MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK 149
           +  E+ +MK L+ + N++  +D   +          + +++E      L + + +  K  
Sbjct: 81  IEREIIIMKLLRHA-NVLSLYDVWETNSN-------LYMILEYAEKGELFNLLVE--KGP 130

Query: 150 LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
           L E E ++    + IGIS  H L   ++HRD+K EN+L+D   N K+ D G         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMA------- 181

Query: 210 MSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                 A+ T++  + T   +P Y APE++    Y     +SD+W+ G+ L+ LL    P
Sbjct: 182 ------ALETEDKLLETSCGSPHYAAPEIVSGIPYHGF--ESDVWSCGVILFALLTGRLP 233

Query: 267 F-EITGQ-----MAILHSKYDFP-PNKYSSKIINLIIIMLAENPNLRPNIFQVVYHIC-- 317
           F E  G      + +   +++ P  ++ S    +LI  +L  +P  R    +++ H    
Sbjct: 234 FDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293

Query: 318 ---------SIMNLPVPIEDRY 330
                    SI NLP   ED Y
Sbjct: 294 KYPSIKDSKSIKNLPR--EDTY 313

>Scas_458.1
          Length = 367

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 139/345 (40%), Gaps = 75/345 (21%)

Query: 25  MISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIV--N 82
           +IS+ A   +I   L +   +  Y+V+ ++    FE+         G +  LKR+     
Sbjct: 22  IISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFEN---------GPLFVLKRIYCPFG 72

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP-------- 134
           D   ++   NE+   KK   + +I+   D    ++ DG    +VL      P        
Sbjct: 73  DIESVSAAMNEISYYKKFAGNSHIISCLDYQLHQKYDGSKQIDVLF-----PFYHYGSVQ 127

Query: 135 ---NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMH-----------------YLD- 173
              N+ LL   +  L T + E + +KIM  +  G+  +H                 Y + 
Sbjct: 128 DDINRHLLS-SSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSEN 186

Query: 174 QPLIHRDIKIE--------------------NVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
            PL+  D+ +E                     +L+    N  + D+ S  + +  + +  
Sbjct: 187 APLLLNDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEI 246

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM 273
            +    Q I  H T Q+ APE++ L     I  K DIW+LG  LY ++F  +PFE   Q+
Sbjct: 247 QLNRFQQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQL 306

Query: 274 -------AILHSKYDFPPNK--YSSKIINLIIIMLAENPNLRPNI 309
                   I   KY  P  K  YS +II+++   L  +P+ RP++
Sbjct: 307 NGGVVKYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSL 351

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 126/285 (44%), Gaps = 44/285 (15%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G    E++  L +G F Q+Y VK             K    +  +  L K+VIV  +E+ 
Sbjct: 336 GPQDFEVLRLLGKGTFGQVYQVK------------KKDTKRIYAMKVLSKKVIVKKNEIA 383

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
                  + V    K+SP IV         +   +   ++ L+ +      L  ++ +  
Sbjct: 384 HTIGERNILVTTSSKASPFIV-------GLKFSFQTPTDLYLVTDYMSGGELFWHLQR-- 434

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + + +E      + ++ + + ++H  D  +++RD+K EN+L+DAN N  LCD G      
Sbjct: 435 EGRFTEDRAKFYIAELVLALEHLH--DNDIVYRDLKPENILLDANGNIALCDFG------ 486

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
              +S  D+   T N +  TT +Y APE ++D   Y    +  D W+LG+ ++++    +
Sbjct: 487 ---LSKADLKDRT-NTFCGTT-EYLAPELLLDESGY---TKMVDFWSLGVLIFEMCCGWS 538

Query: 266 PF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           PF  E   +M   I   K  FP +  S +  + +  +L  NP  R
Sbjct: 539 PFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRNPKHR 583

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 75/150 (50%), Gaps = 22/150 (14%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V++ +  +H+    +I+RD+K EN+L+D N + K+ D G   +              T 
Sbjct: 157 EVTLALEYLHF--HNIIYRDLKPENILLDRNGHIKITDFGFAKEVE------------TV 202

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM----AIL 276
              +  TP Y APE+I      P N+  D W+LG+ +Y++L   TPF  T  M     IL
Sbjct: 203 TWTLCGTPDYIAPEVIAT---KPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKIL 259

Query: 277 HSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           H K  + P  ++S +I+L+  +L  +   R
Sbjct: 260 HGKVVY-PQFFNSDVIDLLSKLLTADLTRR 288

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 128/298 (42%), Gaps = 50/298 (16%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLN---EM 90
           E+   L +G F ++Y V+             KS    G I  LK +  N+ +  N   ++
Sbjct: 101 EVGRKLGKGKFGKVYCVRH-----------KKS----GFICALKAIEKNEILQFNLLKQL 145

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKL 150
           + EV++   +   PNI++ +      +        V LLME   N  L     + LK   
Sbjct: 146 KREVDIQLGM-DHPNIIKLYAHFHDEK-------RVYLLMEHSINGELY----KSLKNNG 193

Query: 151 SESEILKIMYDVSIGISNMHYLDQP-LIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
             +++L   Y   I    +HY+ +  +IHRD+K ENVL+  +N  KL D G  S  +P  
Sbjct: 194 PFNDVLASHYIYQIA-DALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFG-WSILNPEG 251

Query: 210 MSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI 269
              + +           T  Y +PEMI    Y   +E+ D+WALG+  Y+L+    PFE 
Sbjct: 252 SKRKTLC---------GTIDYLSPEMITPREY---DEQVDVWALGVLAYELVVGVPPFEE 299

Query: 270 TGQ----MAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLP 323
             +      IL    +FP +  S    +LI  +L  +   R ++  V  H   + N P
Sbjct: 300 NSKELTYKRILKCDLNFPES-ISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILKNKP 356

>Scas_643.20
          Length = 1082

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 108/248 (43%), Gaps = 56/248 (22%)

Query: 35   IVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEM---GLNEMR 91
            ++  L EG + ++ +    E          K  I V  +   +R++V+  +    L  + 
Sbjct: 824  VLQQLGEGAYGKVKLCIHKE----------KRTIVVIKMIFKERILVDTWVRDRKLGTIP 873

Query: 92   NEVEVMKKLKSSP--NIVQYFDSNASRR-------TDGKPGFEVLLLMELCPNKSLLDYM 142
            +E+++M  L   P  NIV   D               G+ G           +  L D +
Sbjct: 874  SEIQIMATLNKKPHKNIVALLDFFEDEEYYYMETPAHGETG-----------SIDLFDLI 922

Query: 143  NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202
               LK  ++E E   I   V  G+ ++H  DQ ++HRDIK ENV+VD+  + KL D GS 
Sbjct: 923  --ELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGSA 978

Query: 203  SQC-SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI--DLYRYLPINEKSDIWALGIFLYK 259
            +   S P            +++V T   Y APE++   +Y   P     DIWA+GI LY 
Sbjct: 979  AYTKSGPF-----------DVFVGTI-DYAAPEVLGGSVYDGKP----QDIWAIGILLYT 1022

Query: 260  LLFYTTPF 267
            ++F   PF
Sbjct: 1023 IIFKENPF 1030

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/320 (24%), Positives = 136/320 (42%), Gaps = 65/320 (20%)

Query: 22  NGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIV 81
           N  +I+V   + E +  L  GG +++Y VK           GS + +       LKRV  
Sbjct: 429 NRNIITVNDSQYEKIELLGRGGSSRVYKVK-----------GSGNRV-----YALKRVSF 472

Query: 82  N--DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL 139
           +  D+  ++  + E+E+++KLK    ++Q  D       DG     +L L+  C +  L 
Sbjct: 473 DAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMG---DG-----LLYLIMECGDHDLS 524

Query: 140 DYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDM 199
             +NQR    L  + +     ++ + I  +H  D  ++H D+K  N ++      K+ D 
Sbjct: 525 QILNQRSGMPLDFNFVRFYTKEMLLCIKVVH--DAGIVHSDLKPANFVL-VKGILKIIDF 581

Query: 200 GSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY------------LPI 244
           G  +           +   T NIY  T   TP Y APE +    Y              +
Sbjct: 582 GIANA----------VPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKV 631

Query: 245 NEKSDIWALGIFLYKLLFYTTPF-EITGQ---MAILHSKYDFPPNKYSS---KI----IN 293
              SD+W+ G  +Y++++   P+    GQ   +AI++     P  +++S   KI    I 
Sbjct: 632 GRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIE 691

Query: 294 LIIIMLAENPNLRPNIFQVV 313
           L+   L  NP+ R  + +V+
Sbjct: 692 LMKACLYRNPDKRWTVDKVL 711

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 109/258 (42%), Gaps = 37/258 (14%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           V+ KL S  N++  F+   ++        E+ L++E      L DY+    K KL E E 
Sbjct: 166 VIMKLISHTNVMALFEVWENKS-------ELYLVLEYVDGGELFDYLVS--KGKLPEREA 216

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN-NFKLCDMGSTSQCSPPMMSNQD 214
           +     +  G+S  H  +  + HRD+K EN+L+D  N   K+ D G  +   P  +    
Sbjct: 217 IHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTS 274

Query: 215 IAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMA 274
                       +P Y +PE++    Y      SD+W+ GI L+ LL    PF       
Sbjct: 275 CG----------SPHYASPEIVMGRPYH--GGPSDVWSCGIVLFALLTGHLPFNDDNIKK 322

Query: 275 IL----HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH--ICSIMNLPVPI-- 326
           +L      KY  P N  SS+  +LI  +L  +P  R    +++ H  I    +LPV    
Sbjct: 323 LLLKVQSGKYQMPSN-LSSEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPVNKVL 381

Query: 327 ----EDRYGLGPYNFDLY 340
               +D    G  N DL+
Sbjct: 382 RKMRKDNMARGKSNSDLH 399

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 134/328 (40%), Gaps = 67/328 (20%)

Query: 16   NEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIAC 75
            N+ K   G+       + E++    +G F  +Y+      LN          +T G++  
Sbjct: 1161 NKAKNSKGEYKEFAWMKGEMI---GKGSFGAVYLC-----LN----------VTTGEMMA 1202

Query: 76   LKRVIVNDEMGLNE--------MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE-- 125
            +K+V V      NE        +R+EV  +K L    NIVQY             GFE  
Sbjct: 1203 VKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHL-NIVQYL------------GFENK 1249

Query: 126  ---VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIK 182
                 L +E     S+   +  R+  +  E  I  +   V  G++ +H   + ++HRD+K
Sbjct: 1250 NNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMK 1305

Query: 183  IENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYL 242
             +N+L+D +   K+ D G  S+ S  + SN D+ M         T  + APEM+D  +  
Sbjct: 1306 ADNLLLDQDGICKISDFG-ISRKSKDIYSNSDMTM-------RGTVFWMAPEMVDTKQGY 1357

Query: 243  PINEKSDIWALGIFLYKLLFYTTPF---EITGQMAILHSKYDFPPNKYSSKII------N 293
              + K DIW+LG  + ++     P+   E+   M  +      PP    +  +      N
Sbjct: 1358 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRN 1415

Query: 294  LIIIMLAENPNLRPNIFQVVYHICSIMN 321
             +      NP  RP   +++ H  S +N
Sbjct: 1416 FLDACFEINPEKRPTANELLSHPFSEVN 1443

>Scas_675.2
          Length = 527

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 91/187 (48%), Gaps = 22/187 (11%)

Query: 86  GLNE--MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
           GL E  +  EV +  +   +PN+++  D N ++         + ++ME+     L D + 
Sbjct: 56  GLTEKDISREVLLHSRCSKNPNVLRLIDCNIAKDY-------MWMIMEMADGGDLFDKIE 108

Query: 144 QRLKTKLSESEILKIMYDVSI-GISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202
             +     +SE+ +  +   +  IS +H  +  + HRDIK EN+L+D N N KL D G +
Sbjct: 109 PDVGV---DSEVAQFYFQQLVRAISYLHE-ECGVAHRDIKPENILLDKNGNLKLADFGLS 164

Query: 203 SQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLF 262
           SQ       +  + + T       +P Y APE++    Y      +DIW++GI L+ LL 
Sbjct: 165 SQYR---RKDGTLRISTDQ---RGSPPYMAPEILHSRGYYA--HSTDIWSIGILLFVLLT 216

Query: 263 YTTPFEI 269
             TP+E+
Sbjct: 217 GETPWEL 223

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 89/193 (46%), Gaps = 23/193 (11%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K    ++  +  +H  +  ++HRD+KIEN++
Sbjct: 200 MLFEYVSGGQLLDYIIQH--GSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENIM 255

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           + ++   K+ D G     S      + +     ++Y      + APE++    Y     +
Sbjct: 256 ISSSGEIKIIDFG----LSNIFDYRKQLHTFCGSLY------FAAPELLKAQPY--TGPE 303

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILH-----SKYDFPPNKYSSKIINLIIIMLAEN 302
            DIW+ GI LY L+    PF+     +ILH      K D+ P+  S ++I+L+  M+  +
Sbjct: 304 VDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDY-PSHLSIEVISLLTRMIVVD 361

Query: 303 PNLRPNIFQVVYH 315
           P  R  +  VV H
Sbjct: 362 PLRRATLKNVVEH 374

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 124/285 (43%), Gaps = 44/285 (15%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G    E++  L +G F Q+Y V+             K    +  +  L K+VIV  +E+ 
Sbjct: 300 GPQDFEVLRLLGKGTFGQVYQVR------------KKDTKRIYAMKVLSKKVIVKKNEIA 347

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
                  + V    KS P IV         +   +   ++ L+ +      L  ++ +  
Sbjct: 348 HTIGERNILVRTASKSCPFIV-------GLKFSFQTPTDLYLVTDFLSGGELFWHLQK-- 398

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           + + +E      + ++ + +  +H  D  +++RD+K EN+L+DAN N  LCD G      
Sbjct: 399 EGRFTEERAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFG------ 450

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
              +S  D+   T N +  TT +Y APE ++D   Y  +    D W+LG+ ++++    +
Sbjct: 451 ---LSKADLKDRT-NTFCGTT-EYLAPELLLDETGYTKM---VDFWSLGVLIFEMCCGWS 502

Query: 266 PF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           PF  E   +M   I   K  FP +  S +  + +  +L  NP  R
Sbjct: 503 PFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHR 547

>ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH]
           (692321..693913) [1593 bp, 530 aa]
          Length = 530

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 99/206 (48%), Gaps = 34/206 (16%)

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMEL--CPNKS 137
           + N E+  N++  E+ +MK +K   NIV ++ +  +   +     E+++LME   C +  
Sbjct: 228 VENSELVKNQLMRELTIMKNVKEQKNIVGFYGAYYTAIKN----HEIIILMEYMDCGSLD 283

Query: 138 LLDYMNQRLKTK-----------LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENV 186
            +    +R  ++            +E  + KI Y V  G+S + Y D  +IHRDIK  N+
Sbjct: 284 KISSTYRRYCSRNKVPMNASTSWFTELSLSKISYAVLNGLSYL-YQDYKIIHRDIKPSNI 342

Query: 187 LVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE 246
           L+++    K+CD G     S  M+ +        + +V T+  Y +PE I    Y   N 
Sbjct: 343 LINSKGFVKICDFG----VSKKMIDS------IADTFVGTS-TYMSPERIQGSCY---NT 388

Query: 247 KSDIWALGIFLYKLLFYTTPFEITGQ 272
           K D+W+LG+ + +L+  T  F + G 
Sbjct: 389 KGDVWSLGLMIIELV--TGEFPLGGH 412

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 96/208 (46%), Gaps = 27/208 (12%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           ++ME C N SLL+ +  R  ++L+E     I+  V   +  +H  ++ LIHRD+K  N+L
Sbjct: 91  IVMEYCSNGSLLNLL--RYYSRLTEQTTCFIILQVCHALEYLH--EKRLIHRDLKAANIL 146

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           ++ +   +L D+G T Q      ++        N +V  TP + APE+I    Y   + K
Sbjct: 147 LNDDGEVRLADLGVTGQLK---FNSTRHGGKNLNTFV-GTPFWMAPEIIKNQSY---DGK 199

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINL---------IIIM 298
            DIW+LGI   +LL    P      M  L      P     S + N+         I   
Sbjct: 200 CDIWSLGITTLELLNGKPPMSHLDSMKALMR---IPKLNADSILRNMDISPLGKDFIRSC 256

Query: 299 LAENPNLRPNIFQVVYH----ICSIMNL 322
           L ++PN RP   Q++ H     CSI N+
Sbjct: 257 LQQDPNQRPTCKQLLQHKWLKKCSITNI 284

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 64/123 (52%), Gaps = 17/123 (13%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
             K+ ++E E   I   +  GI ++H  DQ ++HRDIK ENV+VD+    KL D GS +  
Sbjct: 1048 FKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYV 1105

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+GI LY L++  
Sbjct: 1106 KSGPF-----------DVFVGTI-DYAAPEVLGGNPYE--GKSQDIWAIGILLYTLIYKE 1151

Query: 265  TPF 267
             PF
Sbjct: 1152 NPF 1154

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 100/219 (45%), Gaps = 18/219 (8%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           +  L+E  PN  LL  M  R    ++E         +   +  MH  D+ +IHRD+K EN
Sbjct: 229 LYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALGFMH--DKGVIHRDLKPEN 284

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPI 244
           +L+D +   KL D G+          +    ++T++     T +Y +PE++ D Y    +
Sbjct: 285 ILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPELLNDNY----V 340

Query: 245 NEKSDIWALGIFLYKLLFYTTPFEITGQ----MAILHSKYDFPPNKYSSKIINLIIIMLA 300
           + + DIWA G  L++++    PF+   +      ++  ++ F    +   + +L+  +L 
Sbjct: 341 DFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAG-FPMTVRDLVKNILI 399

Query: 301 ENPNLRPNIFQVVYH----ICSIMNLPVPIEDRYGLGPY 335
           +NP  R  I Q+  H      +  N  V  +D   LGPY
Sbjct: 400 KNPERRLLINQIKAHQFFADVNFGNGSVWDKDPPELGPY 438

>Scas_477.5
          Length = 703

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 95/188 (50%), Gaps = 24/188 (12%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +++E+ ++K+L    NIV Y+ S+       + G  + + +E  P  S+   +N   
Sbjct: 485 VDALQHEMNLLKELHHE-NIVTYYGSS-------QEGPNLNIFLEYVPGGSVSSMLNNY- 535

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                ES I+  +  V IG++ +H  ++ +IHRDIK  N+L+D     K+ D G + + S
Sbjct: 536 -GPFEESLIVNFIRQVLIGVAYLH--NKNIIHRDIKGANILIDTKGCVKITDFGISKKLS 592

Query: 207 PPMMSNQDI-AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
           P  +S QD  A +  ++Y      + APE++   +     EK+DIW+ G  + ++     
Sbjct: 593 P--LSKQDKRASLQGSVY------WMAPEVV---KQTATTEKADIWSTGCVVIEMFTGKH 641

Query: 266 PFEITGQM 273
           PF    QM
Sbjct: 642 PFPDFSQM 649

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 40/190 (21%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           EV++  K+    NI + +D            F+  ++ME C    L + +   +  + ++
Sbjct: 116 EVDIQTKIGKHKNITELYDF-----------FDSYIIMEYCSGGDLYEAIKDDMVPRKTK 164

Query: 153 SEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSN 212
           + +  I+  +   +  +H   + + HRDIK EN+L+  N N KL D G         ++ 
Sbjct: 165 N-VTNIINQILDAVEYVH--SRGIYHRDIKPENILIAGNWNIKLTDWG---------LAT 212

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMI----------DLYRYLPINEKSDIWALGIFLYKLLF 262
            D   M +N+    + +Y APE+           D Y       K DIWA+GI +  ++F
Sbjct: 213 TDKTSMERNV---GSERYMAPELFESNLDREERTDAYDC----AKVDIWAIGIVMLNIVF 265

Query: 263 YTTPFEITGQ 272
           +  PF +  Q
Sbjct: 266 HKNPFTVANQ 275

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 112/253 (44%), Gaps = 39/253 (15%)

Query: 37   SYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV--IVNDEMGLNEMRNEV 94
            S++  G F Q+Y    +E     E L  K  I + D   +K++  ++ +EM + EM N  
Sbjct: 1038 SFIGGGTFGQVYSAINLE---NGEILAVKE-IKIHDTTTMKKIFPLIKEEMTVLEMLNH- 1092

Query: 95   EVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ-RLKTKLSES 153
                     PNIVQY+     R        +V + ME C   SL   ++  R+     E 
Sbjct: 1093 ---------PNIVQYYGVEVHRD-------KVNIFMEYCEGGSLASLLDHGRI-----ED 1131

Query: 154  EILKIMYDVSIGISNMHYLDQP-LIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM--- 209
            E++  +Y   + +  + YL Q  ++HRDIK EN+L+D N   K  D G+           
Sbjct: 1132 EMVTQVYTFEL-LEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRT 1190

Query: 210  ---MSNQDIAMMTQNI-YVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
                + QD  + T+++  +  TP Y APE I            D+WALG  + ++     
Sbjct: 1191 VRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRR 1250

Query: 266  PFE-ITGQMAILH 277
            P+  +  + AI++
Sbjct: 1251 PWSNLDNEWAIMY 1263

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 23/173 (13%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           V+ KL S PN++  +D   +          + L++E      L + +       L E E 
Sbjct: 79  VIMKLLSHPNVLSLYDVWETNNN-------LYLILEYAEKGELFNLLVDH--GPLPEREA 129

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
           +     + IGIS  H L   ++HRD+K EN+L+D+  N K+ D G  +     + ++ D+
Sbjct: 130 INCFRQIIIGISYCHALG--IVHRDLKPENLLLDSFYNIKIADFGMAA-----LQTDADL 182

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
              +       +P Y APE++    Y      SD+W+ G+ L+ LL    PF+
Sbjct: 183 LETSCG-----SPHYAAPEIVSGLPYEGF--ASDVWSCGVILFALLTGRLPFD 228

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 94/206 (45%), Gaps = 21/206 (10%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSI--GISNMHYLDQPLIHRDIKI 183
           +  L+E  PN   L      +K   + +E   I Y   I   I +MH     +IHRDIK 
Sbjct: 193 LYFLLEYAPNGDFLSL----IKKFGTLNEECTIYYSAQIIDAIGSMH--SHGIIHRDIKP 246

Query: 184 ENVLVDANNNFKLCDMGSTSQCSPPMMSNQD--IAMMTQNIYVHTTPQYRAPEMI-DLYR 240
           EN+L+D N   KL D G+          N      ++T++     T +Y +PE++ D Y 
Sbjct: 247 ENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY- 305

Query: 241 YLPINEKSDIWALGIFLYKLLFYTTPFEITGQM----AILHSKYDFPPNKYSSKIINLII 296
               + K DIWA G  +Y+++    PF+ T +      ++  ++ F    + + I +L+ 
Sbjct: 306 ---TDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAG-FPTIIRDLVK 361

Query: 297 IMLAENPNLRPNIFQVVYHICSIMNL 322
            +L + P  R  I Q+  H C   N+
Sbjct: 362 NILVKQPEKRLTIPQIKEH-CLFENI 386

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 126/302 (41%), Gaps = 65/302 (21%)

Query: 39   LAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIV-----NDEMGLN---EM 90
            + +G F  +Y+      LN          +T G++  +K+V V      DE  ++    +
Sbjct: 1044 IGKGSFGAVYLA-----LN----------VTTGEMLAVKQVTVPEFSSQDESAISMVEAL 1088

Query: 91   RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE-----VLLLMELCPNKSLLDYMNQR 145
            ++EV  +K L    NIVQY             GFE       L +E     S+   +  R
Sbjct: 1089 KSEVSTLKDLNHV-NIVQYL------------GFEEKNGIYSLFLEYVAGGSVGSLI--R 1133

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            +  +  +  I  +   V  G++ +H   + ++HRD+K +N+L+D +   K+ D G  S+ 
Sbjct: 1134 MYGRFDDQLIRHLTKQVLEGLAYLH--SKGILHRDMKADNLLLDNDGVCKISDFG-ISRK 1190

Query: 206  SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
            S  + SN D+ M         T  + APEM+D       + K DIW+LG  + ++     
Sbjct: 1191 SNNIYSNSDMTM-------RGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKR 1241

Query: 266  P---FEITGQMAILHSKYDFPPNKYSSKII------NLIIIMLAENPNLRPNIFQVVYH- 315
            P   FE+   M  +      PP    +K +      + +      +P +RP    +V H 
Sbjct: 1242 PWSNFEVVAAMFQIGKSKTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTADSLVGHP 1301

Query: 316  IC 317
             C
Sbjct: 1302 FC 1303

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 90/192 (46%), Gaps = 21/192 (10%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     + E +  K    ++  +  +H  +  ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYIIQH--GSIREHQARKFARGIASALIYLHANN--IVHRDLKIENIM 276

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           +  ++  K+ D G ++       S + +     ++Y      + APE++    Y     +
Sbjct: 277 ISDSSEIKIIDFGLSNIYD----SRKQLHTFCGSLY------FAAPELLKANPY--TGPE 324

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFP----PNKYSSKIINLIIIMLAENP 303
            D+W+ G+ L+ L+    PF+     ++LH K        P   S ++I+L+  ML  +P
Sbjct: 325 VDVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDP 383

Query: 304 NLRPNIFQVVYH 315
             R  + QVV H
Sbjct: 384 KRRATLKQVVEH 395

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 111/254 (43%), Gaps = 46/254 (18%)

Query: 37   SYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNE----MRN 92
            S++  G F  +Y               S   +  GDI  +K + + D   + +    ++ 
Sbjct: 1263 SFIGSGSFGTVY---------------SAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKE 1307

Query: 93   EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ-RLKTKLS 151
            E+ VM+ L + PNIVQY+     R        +V + ME C   SL   +   R+     
Sbjct: 1308 EMRVMEIL-NHPNIVQYYGVEVHRD-------KVNIFMEFCEGSSLASLLEHGRI----- 1354

Query: 152  ESEILKIMYDVSI--GISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
            E E++  +Y + +  G++ +H     ++HRDIK EN+L+D N   K  D G+    +   
Sbjct: 1355 EDEMVTQVYTLQLLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKN- 1411

Query: 210  MSNQDIAMMTQNIYVH-----TTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
              ++ I++   N          TP Y APE +    +       DIW+LG  + +++   
Sbjct: 1412 -GSKRISLDANNKSTGGKDMIGTPMYMAPETVTGQGHGKFG-SDDIWSLGCVVLEMVTGR 1469

Query: 265  TPFE-ITGQMAILH 277
             P+  +  + AI++
Sbjct: 1470 RPWANLDNEWAIMY 1483

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 89/192 (46%), Gaps = 21/192 (10%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
           +L E      LLDY+ Q     L E    K +  ++  +  +H  +  ++HRD+KIEN++
Sbjct: 199 MLFEYVSGGQLLDYIIQH--GSLRERHARKFVRGIASALQYLHLNN--IVHRDLKIENIM 254

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
           +  +   K+ D G ++       + + +     ++Y      + APE++    Y  I  +
Sbjct: 255 ISTSGEIKIIDFGLSNLYD----NKKQLHTFCGSLY------FAAPELLKANPY--IGPE 302

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFP----PNKYSSKIINLIIIMLAENP 303
            DIW+ G+ +Y L+    PF+     ++LH K        P   S + I+L+  ML  +P
Sbjct: 303 VDIWSFGVVIYVLVCGKVPFD-DENASVLHEKIKKGKVEYPQHLSIECISLLSKMLVVDP 361

Query: 304 NLRPNIFQVVYH 315
             R ++ QV  H
Sbjct: 362 LKRASLKQVCNH 373

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 94/201 (46%), Gaps = 20/201 (9%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           +  L+E  P+   L  + +     L+E+        +   + ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLIKKY--GSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHT-----TPQYRAPEMI-DLY 239
           +L+D N   KL D G T++  P   SN        ++Y  +     T +Y +PE++ D Y
Sbjct: 255 ILLDKNMKVKLTDFG-TAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY 313

Query: 240 RYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM----AILHSKYDFPPNKYSSKIINLI 295
                + + DIWA G  LY++L    PF+   +      ++  +Y F    +   + +L+
Sbjct: 314 ----TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG-FPQIVKDLV 368

Query: 296 IIMLAENPNLRPNIFQVVYHI 316
             +L  +PN R  I Q+  H+
Sbjct: 369 KKLLVRDPNDRLTIKQIKAHL 389

>Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement
          Length = 521

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 103/234 (44%), Gaps = 32/234 (13%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           R +++  +  G +  +   +F E + E      K           KR +           
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFTEAVEETTVAIKKVTNVFSKTLLCKRSL----------- 70

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY-MNQRLKTK- 149
            E+++++  +   NI   +D +     DG   F  L L E      L++  M+Q +K+  
Sbjct: 71  RELKLLRHFRGHKNITCLYDMDIVFGIDGS--FNGLYLYE-----ELMECDMHQIIKSGQ 123

Query: 150 -LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP- 207
            LS++     +Y +  G+  +H  D  ++HRD+K  N+LV+A+   K+CD G     S  
Sbjct: 124 PLSDAHYQSFIYQILCGLKYIHSAD--VLHRDLKPGNLLVNADCQLKICDFGLARGYSEN 181

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
           P+ +NQ    +T+ +    T  YRAPE+  +  Y       D+W+ G  L +LL
Sbjct: 182 PVENNQ---FLTEYV---ATRWYRAPEI--MLSYQGYTRAIDVWSCGCILAELL 227

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 120/286 (41%), Gaps = 67/286 (23%)

Query: 89  EMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++R E+ +MKK   +    +++  D   SR+        + L++E C    +      +L
Sbjct: 161 KIRREIAIMKKCDHEHVVKLIEVLDDMKSRK--------IYLVLEYCSKGEVKWCPGDQL 212

Query: 147 KTKLSESEIL------KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
           +       +L      +I+  V +G+  +HY  Q +IHRDIK  N+L+  ++  K+ D G
Sbjct: 213 EAAARGPPLLTFQRTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSEHDIVKISDFG 270

Query: 201 ---STSQCSPPMMSNQDIAMMTQNIYVHT-----------TPQYRAPEMI---DLYRYLP 243
              ++S    P   +   + +   +               TP + APE+    D Y  L 
Sbjct: 271 VSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYEKLN 330

Query: 244 INEKS------------DIWALGIFLYKLLFYTTPFEITGQM----AILHSKYDFPPNKY 287
           I+ +S            DIWALG+ LY LLF   PF    +M     I++   +FP  ++
Sbjct: 331 IDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPRLEF 390

Query: 288 -SSKIINLIII-------------MLAENPNLRPNIFQVVYH--IC 317
             S  +++I               +L +NP  R NI  +  H  +C
Sbjct: 391 MQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIVDIKAHPFVC 436

>Kwal_47.16761
          Length = 744

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 125/288 (43%), Gaps = 50/288 (17%)

Query: 29  GAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVN-DEMG 86
           G    E++  L +G F Q+Y V+             K    +  +  L K+VIV  +E+ 
Sbjct: 330 GPQDFEVLRLLGKGTFGQVYQVR------------KKDTKRIYAMKVLSKKVIVKKNEIA 377

Query: 87  LNEMRNEVEVMKKLKSSPNIVQY---FDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
                  + V    KS P IV     F + A          ++ L+ +      L  ++ 
Sbjct: 378 HTIGERNILVRTASKSCPFIVGLKFSFQTPA----------DLYLVTDFMSGGELFWHLQ 427

Query: 144 QRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
           +  + + +E      + ++ + +  +H  D  +++RD+K EN+L+DAN N  LCD G   
Sbjct: 428 K--EGRFAEDRARFYIAELVLALEYLHEND--IVYRDLKPENILLDANGNIALCDFG--- 480

Query: 204 QCSPPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLLF 262
                 +S  D+   T N +  TT +Y APE ++D   Y  +    D W+LG+ ++++  
Sbjct: 481 ------LSKADLKDRT-NTFCGTT-EYLAPELLLDESGYTKM---VDFWSLGVLIFEMCC 529

Query: 263 YTTPF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
             +PF  E   +M   I   K  FP +  S +  + +  +L  NP  R
Sbjct: 530 GWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHR 577

>Kwal_27.12559
          Length = 414

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 79/183 (43%), Gaps = 22/183 (12%)

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSN--ASRRTDGKPGFEVLLLMELCPNKS 137
           I N E+ L     E++ +   K   NIV   D    + +  DG           L   + 
Sbjct: 103 IFNREILLKRAIRELKFLNFFKGHKNIVSLVDLEIVSEKPYDG-----------LYCYQE 151

Query: 138 LLDYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194
           L+DY   R+     + SE  I   +Y +  G+  +H  D  +IHRD+K  N+L     N 
Sbjct: 152 LVDYDLARVIHSTVQFSEFHIKHFLYQILCGLKYIHSAD--VIHRDLKPGNILCSIGGNL 209

Query: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALG 254
           K+CD G     +P     +   +   + YV  T  YRAPE+I  +R     +  DIWA+G
Sbjct: 210 KICDFGLARGIAPQYFEQKSDEIHITS-YV-ATRWYRAPELILSHRRY--TKAIDIWAVG 265

Query: 255 IFL 257
             L
Sbjct: 266 CIL 268

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 64/123 (52%), Gaps = 17/123 (13%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            LKT ++E E   +   V+ GI ++H  D  ++HRDIK ENV+VD     KL D GS +  
Sbjct: 1071 LKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYV 1128

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWA+G+ LY +++  
Sbjct: 1129 KSGPF-----------DVFVGTI-DYAAPEVLGGEPYE--GKPQDIWAIGVLLYTIIYKE 1174

Query: 265  TPF 267
             PF
Sbjct: 1175 NPF 1177

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 105/234 (44%), Gaps = 32/234 (13%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           R +++  +  G +  +   +F E  +E      K           KR +           
Sbjct: 24  RFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSL----------- 72

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY-MNQRLKTK- 149
            E+++++  +   NI   +D +   + DG   F  L L E      L++  M+Q +K+  
Sbjct: 73  RELKLLRHFRGHKNITCLYDMDIVFQPDGM--FNGLYLYE-----ELMECDMHQIVKSGQ 125

Query: 150 -LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP- 207
            L+++     +Y +  G+  +H  D  ++HRD+K  N+LV+A+   K+CD G     S  
Sbjct: 126 PLTDAHYQSFIYQILCGLKYIHSAD--VLHRDLKPGNLLVNADCQLKICDFGLARGYSEN 183

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
           P+ +NQ    +T+ +    T  YRAPE+  +  Y    +  D+W+ G  L +LL
Sbjct: 184 PVENNQ---FLTEYV---ATRWYRAPEI--MLSYQGYTKAIDVWSCGCILAELL 229

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 122/287 (42%), Gaps = 57/287 (19%)

Query: 21  PNGQMISVG---AHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLK 77
           P   ++S G    H  +I+  L  G F ++++V+ V         G   AI V      K
Sbjct: 55  PQKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHN-------GRYYAIKV----LKK 103

Query: 78  RVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKS 137
           + +V  +M   E  N+   M KL   P +++ + +    R        + ++M+      
Sbjct: 104 QQVV--KMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARN-------IFMVMDYIEGGE 154

Query: 138 LLDYM--NQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN 192
           L   +  +QR      K   +E++       + +  +H     +I+RD+K EN+L+D N 
Sbjct: 155 LFSLLRKSQRFPNPVAKFYAAEVI-------LALEYLH--AHNIIYRDLKPENILLDRNG 205

Query: 193 NFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWA 252
           + K+ D G   +              T    +  TP Y APE+I      P N+  D W+
Sbjct: 206 HIKITDFGFAKEVQ------------TVTWTLCGTPDYIAPEVITT---KPYNKSVDWWS 250

Query: 253 LGIFLYKLLFYTTPFEITGQM----AILHSKYDFPPNKYSSKIINLI 295
           LG+ +Y++L   TPF  T  M     IL  K  +PP  +   +++L+
Sbjct: 251 LGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPY-FHPDVVDLL 296

>KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces
           cerevisiae YDL028c MPS1 serine/threonine/tyrosine
           protein kinase, hypothetical start
          Length = 793

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 105/256 (41%), Gaps = 51/256 (19%)

Query: 26  ISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN--D 83
           I+V     E V  L +GG  ++Y VK  ++                 +  LKRV  +  D
Sbjct: 465 ITVNGTAYEKVELLGKGGSGKVYKVKSSDH----------------KVYALKRVSFDEFD 508

Query: 84  EMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
           E  ++  + E+E++KKL++   +V+  D +         G  VL L+  C    L   + 
Sbjct: 509 ESSIDGFKGEIELLKKLENKQRVVKLIDYHM--------GQGVLFLLMECGEHDLSQVLT 560

Query: 144 QRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
           QR K    ++E ++  +   I    + + D  ++H D+K  N  V      K+ D G  +
Sbjct: 561 QRSKIPF-DTEFVRYHFQEMIKCVKVVH-DADIVHSDLKPAN-FVFVKGMLKIIDFGIAN 617

Query: 204 QCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY---------LPINEKSDIW 251
                      +   T NIY      TP Y APE +    +           + + SD+W
Sbjct: 618 A----------VPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVW 667

Query: 252 ALGIFLYKLLFYTTPF 267
           + G  LY++++   P+
Sbjct: 668 SCGCILYQMVYGKPPY 683

>Scas_711.25
          Length = 1515

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 112/262 (42%), Gaps = 58/262 (22%)

Query: 39   LAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIV-----NDEM---GLNEM 90
            + +G F  +Y+      LN          +T G++  +K+V V      DE     +  +
Sbjct: 1220 IGKGSFGAVYLC-----LN----------VTTGEMMAVKQVEVPKYSSQDEAIISTVEAL 1264

Query: 91   RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE-----VLLLMELCPNKSLLDYMNQR 145
            R+EV  +K L    NIVQY             GFE       L +E     S+   +  R
Sbjct: 1265 RSEVSTLKDLDHL-NIVQYL------------GFENKDNIYSLFLEYVAGGSVGSLI--R 1309

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            +  +  E  I  +   V  G++ +H   + ++HRD+K +N+L+D +   K+ D G  S+ 
Sbjct: 1310 MYGRFDEPLIRHLNTQVLRGLAYLH--SRGILHRDMKADNLLLDQDGVCKISDFG-ISRK 1366

Query: 206  SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
            S  + SN D+ M         T  + APEM+D  +    + K DIW+LG  + ++     
Sbjct: 1367 SKDIYSNSDMTM-------RGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKR 1417

Query: 266  P---FEITGQMAILHSKYDFPP 284
            P   +E+   M  +      PP
Sbjct: 1418 PWSNYEVVAAMFKIGKSKSAPP 1439

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 84/169 (49%), Gaps = 20/169 (11%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
             K  + E E   +   V   I ++H  DQ ++HRDIK ENV+VD++   KL D GS +  
Sbjct: 943  FKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYI 1000

Query: 206  -SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
             S P            +++V T   Y APE++    Y    +  DIWALG+ LY +++  
Sbjct: 1001 KSGPF-----------DVFVGTM-DYAAPEVLGGSSYK--GKPQDIWALGVLLYTIIYKE 1046

Query: 265  TPFEITGQMAILHSKYDFPPNKY-SSKIINLIIIMLAENPNLRPNIFQV 312
             P+    +  IL  +  F  +++ S + I+LI  +L    + RP I ++
Sbjct: 1047 NPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

>Kwal_55.20326
          Length = 750

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 111/233 (47%), Gaps = 25/233 (10%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +++E+ ++K+L+   NIV Y+ S+       + G  + + +E  P  S+   +N   
Sbjct: 531 VDALQHEMGLLKELQHE-NIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLNSY- 581

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                E  I      + IG+S +H  D  +IHRDIK  N+L+D     K+ D G + + S
Sbjct: 582 -GPFEEPLIRNFTRQILIGLSYLHRKD--IIHRDIKGANILIDIKGCVKITDFGISKKLS 638

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
           P        A +  ++Y      + APE++   + +   +K+DIW++G  + ++     P
Sbjct: 639 PLNQQQNKRASLQGSVY------WMAPEVV---KQVVTTKKADIWSVGCVIIEMFTGKHP 689

Query: 267 FEITGQM-AILHSKYD-FP--PNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
           F    QM AI     + FP  P+  S++  + ++     +   RP+  +++ H
Sbjct: 690 FPDFSQMQAIFKIGTNTFPDSPSWSSNEAKDFLLKTFELDYRKRPDSIELLQH 742

>Kwal_26.8709
          Length = 829

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%), Gaps = 14/143 (9%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           + +++E         Y+ +  K +L E    ++   +  G+  MH   + L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQK--KRRLKEGPACRLFAQLISGVYYMH--SKGLVHRDLKLEN 175

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           +L+D N N  + D G  ++  P     ++  M T       +P Y APE++   R     
Sbjct: 176 LLLDKNENLLITDFGFVNEFLP-----ENELMKTSC----GSPCYAAPELVVTARPYEA- 225

Query: 246 EKSDIWALGIFLYKLLFYTTPFE 268
            K+D+W+ G+ LY +L    P++
Sbjct: 226 RKADVWSCGVILYAMLAGYLPWD 248

>Scas_616.10
          Length = 1461

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 24/173 (13%)

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
           V+ KL S PN++  ++   ++        E+ L++E      L DY+    K KLSE E 
Sbjct: 188 VIMKLISHPNVMALYEVWENKS-------ELYLVLEYVDGGELFDYLVS--KGKLSEKEA 238

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN-NFKLCDMGSTSQCSPPMMSNQD 214
           +     +  G+S  H  +  + HRD+K EN+L+D  N + K+ D G  +   P  +    
Sbjct: 239 VHYFKQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAALELPNKLLQTS 296

Query: 215 IAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                       +P Y +PE++    Y      SD+W+ GI L+ LL    PF
Sbjct: 297 CG----------SPHYASPEIVMGKSYH--GGPSDVWSCGIILFALLTGHLPF 337

>Kwal_23.5668
          Length = 1689

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 91/195 (46%), Gaps = 19/195 (9%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           + + ME C N++L D ++        E E  ++  ++   +S +H   Q +IHRD+K  N
Sbjct: 812 LFIQMEYCENRTLFDLIHTENLCAQKE-EYWRLFREILDALSYIH--SQGIIHRDLKPMN 868

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI- 244
           + +D + N K+ D G        +    D+  M  +I   +T    +     LY    + 
Sbjct: 869 IFIDESRNIKIGDFGLAKNVHKSV----DLLRMDSHISTASTEDLTSAIGTALYVATEVL 924

Query: 245 ------NEKSDIWALGIFLYKLLF-YTTPFEITGQM-AILHSKYDFPPNKYSSKII---N 293
                 NEK D+++LGI  +++++ + T  E    +  I  S  DFP +  SSK+     
Sbjct: 925 TGSGNYNEKIDMYSLGIIFFEMVYSFNTGMERVNDIKKIRTSAIDFPSDFDSSKLAVEKK 984

Query: 294 LIIIMLAENPNLRPN 308
           +I  +L  +PN RPN
Sbjct: 985 IITQLLDHDPNRRPN 999

>Scas_502.2
          Length = 1116

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 98/218 (44%), Gaps = 32/218 (14%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSI--GISNMHYLDQPLIHRDIKI 183
           +  L+E  PN  LL  M    K   S +E     Y   I   I  MH   + +IHRDIK 
Sbjct: 248 LYFLLEYAPNGDLLSLM----KKFGSLNEECCCYYGAQIIDAIKFMH--SKGIIHRDIKP 301

Query: 184 ENVLVDANNNFKLCDMGSTSQC--SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYR 240
           EN+L+D +   K+ D G+       PP  S     ++T++     T +Y +PE++ D Y 
Sbjct: 302 ENILLDKDMKVKITDFGTAKILDNKPPGTS---YDLLTRSKSFVGTAEYVSPELLNDNY- 357

Query: 241 YLPINEKSDIWALGIFLYKLLFYTTPFEITGQ----MAILHSKYDFPPNKYSSKIINLII 296
               + +SDIWA G  +++++    PF+ T +      ++  +Y F    + + + +L+ 
Sbjct: 358 ---TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPTVVRDLVK 413

Query: 297 IMLAENPNLRPNIFQVVYH---------ICSIMNLPVP 325
            +L + P  R  I  +  H           SI N P P
Sbjct: 414 RILIKAPEQRLTIEAIEKHHFFRSKNFQDSSIWNDPAP 451

>Scas_544.6
          Length = 489

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 97/201 (48%), Gaps = 32/201 (15%)

Query: 82  NDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSL--- 138
           N+E+ +N++  E+ +MK +K   NI+ ++ +  +   +     E+++LME     SL   
Sbjct: 193 NNEIVVNQLIRELTIMKSIKPHKNIISFYAAFYTHHQNN----EIVILMEYMDCGSLDRI 248

Query: 139 ---------LDYMNQRLKTKLSESEIL-KIMYDVSIGISNMHYLDQPLIHRDIKIENVLV 188
                       ++ R K   ++S IL +I Y V  G+ N  Y +  +IHRDIK  NVL+
Sbjct: 249 FSTYKRFVARGVLDPREKNWFNDSLILSRISYAVLNGL-NYLYENYKIIHRDIKPSNVLI 307

Query: 189 DANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKS 248
           ++    KLCD G + +          +     + +V T+  Y +PE I    Y   + K 
Sbjct: 308 NSKGLVKLCDFGVSKK----------LINSIADTFVGTS-TYMSPERIQGNVY---STKG 353

Query: 249 DIWALGIFLYKLLFYTTPFEI 269
           D+W+LG+ + +L+    P  +
Sbjct: 354 DVWSLGLMIIELVTGQFPLGV 374

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 113/264 (42%), Gaps = 37/264 (14%)

Query: 69  TVGDIACLKRVIVNDEMGLN---EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE 125
           + G I  LK +   + +  N   + R EVE+   L + PN+ + +      +        
Sbjct: 125 STGYICALKVMEKEEIIKYNLQKQFRREVEIQTSL-NHPNLTKSYGYFHDEK-------R 176

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           V LLME   N  +  Y   RL    ++      +Y ++  +  MH   + +IHRDIK EN
Sbjct: 177 VYLLMEYLVNGEM--YKLLRLHGPFNDILASDYIYQIANALDYMH--KKNIIHRDIKPEN 232

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           +L+  NN  KL D G  S  +PP    + +           T  Y +PEM++   Y   +
Sbjct: 233 ILIGFNNVIKLTDFG-WSIINPPENRRKTVC---------GTIDYLSPEMVESREY---D 279

Query: 246 EKSDIWALGIFLYKLLFYTTPFE------ITGQMAILHSKYDFPPNKYSSKIINLIIIML 299
              D WALG+  ++LL    PFE         ++A L  K    P+  S    +LI+ +L
Sbjct: 280 HTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKM---PSNISQDAQDLILKLL 336

Query: 300 AENPNLRPNIFQVVYHICSIMNLP 323
             +P  R  +  V  H   + N P
Sbjct: 337 KYDPKDRMRLGDVKMHPWILRNKP 360

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 126/292 (43%), Gaps = 50/292 (17%)

Query: 2   ERPNSRSMTSLNSPNEEKYPNGQMISVGA---HRVEIVSYLAEGGFAQIYVVKFVEYLNE 58
           E+P    +T  N    +++     ++VG+      +I+  L  G F ++++++       
Sbjct: 53  EKPKQPHVTYYNEEQYKQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIR------- 105

Query: 59  FESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRT 118
                S+       +  LK+ IV   +   E  N+  +M  + + P I++ + +    + 
Sbjct: 106 -----SRHNGRYYAMKVLKKEIVV-RLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQ- 158

Query: 119 DGKPGFEVLLLMELCPNKSLLDYM--NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPL 176
                 ++ ++M+      L   +  +QR    +++        +V + +  +H  D  +
Sbjct: 159 ------QIFMIMDYIEGGELFSLLRKSQRFPNPVAKF----YAAEVCLALEYLHSKD--I 206

Query: 177 IHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI 236
           I+RD+K EN+L+D N + K+ D G             D+        +  TP Y APE++
Sbjct: 207 IYRDLKPENILLDKNGHIKITDFGFAKYVP-------DVTYT-----LCGTPDYIAPEVV 254

Query: 237 DLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQM----AILHSKYDFPP 284
                 P N+  D W+ GI +Y++L   TPF  +  M     IL+++  FPP
Sbjct: 255 ST---KPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPP 303

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 112/261 (42%), Gaps = 44/261 (16%)

Query: 73  IACLKRVIVN-DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           I  +K V +  DE    ++  E+EV+ K +S P+IV ++    +   +G     V + ME
Sbjct: 357 IMAMKEVRLELDESKFTQILMELEVLHKCQS-PHIVDFY---GAFFIEGA----VYMCME 408

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVD-A 190
                SL    +Q     + E ++  I   V  G+  +  +   +IHRD+K  N+L   A
Sbjct: 409 YMDGGSLDKCYDQDCIGGIDEPQLAYITEAVICGLKELKDVHN-IIHRDVKPTNILCSAA 467

Query: 191 NNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-----DLYRYLPIN 245
               KLCD G +         N   +M   NI   +   Y APE I     D   Y    
Sbjct: 468 QGTIKLCDFGVS--------GNLVASMAKTNIGCQS---YMAPERIKSLNPDKSTY---T 513

Query: 246 EKSDIWALGIFLYKLLFYTTPF------EITGQMAILHSKYDFPP-----NKYSSKIINL 294
            +SDIW+LG+ + ++     P+       I  Q++ +    D PP      K+S+   + 
Sbjct: 514 VQSDIWSLGLSILEMALGAYPYPPETYDNIFSQLSAI---VDGPPPKLPQAKFSADAQDF 570

Query: 295 IIIMLAENPNLRPNIFQVVYH 315
           + + L + P  RPN   ++ H
Sbjct: 571 VSMCLQKVPERRPNYAALLEH 591

>YDL159W (STE7) [712] chr4 (172482..174029)
           Serine/threonine/tyrosine protein kinase of MAP kinase
           kinase (MAPKK or MEK) family, component of pheromone
           response, filamentous growth, and STE vegetative growth
           pathways [1548 bp, 515 aa]
          Length = 515

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 98/202 (48%), Gaps = 32/202 (15%)

Query: 82  NDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
           N+   +N++  E+ ++K +K   NI+ ++ +  ++  +     E+++LME     SL   
Sbjct: 227 NNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINN----EIIILMEYSDCGSLDKI 282

Query: 142 MN------QR-----LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDA 190
           ++      QR      KT  +E  I KI Y V  G+ ++ Y    +IHRDIK  NVL+++
Sbjct: 283 LSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHL-YRQYKIIHRDIKPSNVLINS 341

Query: 191 NNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDI 250
               KLCD G + +          +     + +V T+  Y +PE I    Y   + K D+
Sbjct: 342 KGQIKLCDFGVSKK----------LINSIADTFVGTST-YMSPERIQGNVY---SIKGDV 387

Query: 251 WALGIFLYKLLFYTTPFEITGQ 272
           W+LG+ + +L+  T  F + G 
Sbjct: 388 WSLGLMIIELV--TGEFPLGGH 407

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 129/317 (40%), Gaps = 57/317 (17%)

Query: 16   NEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIAC 75
            N+ K   G+       + E++    +G F  +Y+      LN          IT G++  
Sbjct: 1137 NKSKNARGEYKEFAWMKGEMI---GKGSFGAVYLS-----LN----------ITTGEMMA 1178

Query: 76   LKRVIVNDEMGLNEM--------RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVL 127
            +K+V V      NE+        ++EV  +K L    NIVQY  S          G    
Sbjct: 1179 VKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DHLNIVQYLGSEIR-------GNIYS 1230

Query: 128  LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
            L +E     S+   +  RL  +  E  I  +   V  G+  +H   + ++HRD+K +N+L
Sbjct: 1231 LFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLH--SKGILHRDMKADNLL 1286

Query: 188  VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247
            +D +   K+ D G  S+ S  + SN D+ M         T  + APEM+D  +    + K
Sbjct: 1287 LDEDGICKISDFG-ISKKSKNIYSNSDMTM-------RGTVFWMAPEMVDTKQ--GYSAK 1336

Query: 248  SDIWALGIFLYKLLFYTTPF---EITGQMAILHSKYDFPP------NKYSSKIINLIIIM 298
             DIW+LG  + ++     P+   E+   M  +      PP         SSK  + +   
Sbjct: 1337 VDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKDFLSKC 1396

Query: 299  LAENPNLRPNIFQVVYH 315
               +P  RP    ++ H
Sbjct: 1397 FEIDPEKRPTADDLLEH 1413

>Kwal_56.24091
          Length = 381

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 90/202 (44%), Gaps = 28/202 (13%)

Query: 70  VGDIACLKRVIVNDEMGLN---EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEV 126
            G I  LK +  ++ +  N   + R EVE+   LK  PN+ + +      +        V
Sbjct: 145 TGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKH-PNLTRLYGYFHDEK-------RV 196

Query: 127 LLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENV 186
            LLME   N  L  Y + R     ++      ++ ++  ++ MH   + ++HRDIK EN+
Sbjct: 197 YLLMEYLVNGEL--YKHLRSHGPFNDITASHFVHQMADALNYMH--SKNILHRDIKPENI 252

Query: 187 LVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE 246
           L+   N  KL D G     S   + N     +        T  Y +PE+I    Y   + 
Sbjct: 253 LLGFQNTLKLTDFG----WSVSNVGNSKRKTLC------GTMDYLSPELIKSREY---DN 299

Query: 247 KSDIWALGIFLYKLLFYTTPFE 268
           K D+WALG+  Y+LL  + PFE
Sbjct: 300 KVDVWALGVLTYELLVGSPPFE 321

>Scas_700.34
          Length = 864

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 123/270 (45%), Gaps = 39/270 (14%)

Query: 4   PNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLG 63
           P +R  T  N P E++    + ++ G +   I S L EG F +   VK     N   S  
Sbjct: 25  PPARDDTPRNIPLEKR----KHVTFGPY--IIGSTLGEGEFGK---VKLGWPKNSLPS-- 73

Query: 64  SKSAITVGDIACLKRV----IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTD 119
           S S I V     +K +    I  D     ++  E+  +K L + PNIV+  +   + +  
Sbjct: 74  SSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALKHL-THPNIVKLEEVLQNSKYI 132

Query: 120 GKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYL-DQPLIH 178
           G       +++E         Y+ +  K +L E    ++   +   I+ +HY+  + L+H
Sbjct: 133 G-------IVLEYASGGEFYKYIQR--KKRLKEGPACRLFAQL---INGVHYIHSKGLVH 180

Query: 179 RDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDL 238
           RD+K+EN+L+D + N  + D G  S+      S+ ++   +       +P Y APE++  
Sbjct: 181 RDLKLENLLLDKHENLIITDFGFVSE----FYSHGELMKTSCG-----SPCYAAPELVVS 231

Query: 239 YRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
            +     +K+DIW+ G+ LY +L    P++
Sbjct: 232 TKPYEA-KKADIWSCGVILYAMLAGYLPWD 260

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 77/179 (43%), Gaps = 23/179 (12%)

Query: 90  MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK 149
           + NE  ++++L +  NI Q  D      T        + ++E C    L D++    +  
Sbjct: 55  VHNEYAILRRLGTHRNICQLLDFYEDADT-------YVFVLEYCAYGDLYDFIKAIRERP 107

Query: 150 LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
                    ++ +   IS  H  D  + HRDIK ENVL+D     KL D G +       
Sbjct: 108 TMRINFHSFLFQLCSAISYCHSKD--VSHRDIKPENVLMDDRGQVKLTDFGLSQ------ 159

Query: 210 MSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
                I  ++++ Y   T +Y APE     R       +D W+LGI ++ L+F + PFE
Sbjct: 160 -----IGSVSKD-YCIGTEKYLAPET--FLREYHNTFATDYWSLGITIFCLMFGSCPFE 210

>Scas_651.18
          Length = 371

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 121/275 (44%), Gaps = 48/275 (17%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNE 93
           +I+  L  G F ++++++   +   F +L     +    I  LK+V         E  N+
Sbjct: 60  QILRTLGTGSFGRVHLIR-SNHNGRFYAL---KVLKKHTIVKLKQV---------EHTND 106

Query: 94  VEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM--NQRLKTKLS 151
             +M  + S P +V+ + +            +V ++M+      L   +  +QR    ++
Sbjct: 107 ERLMLSVVSHPFLVRMWGTFQDFE-------QVFMIMDYIEGGELFSLLRKSQRFPNPVA 159

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           +        +V + +  +H +D  +I+RD+K EN+L+D N + K+ D G           
Sbjct: 160 KF----YAAEVCLALEYLHSMD--IIYRDLKPENILLDKNGHIKITDFGFAKYVP----- 208

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
             DI        +  TP Y APE++      P N+  D W+ GI +Y++L   TPF  + 
Sbjct: 209 --DITYT-----LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDSN 258

Query: 272 QMA----ILHSKYDFPPNKYSSKIINLIIIMLAEN 302
            M     IL+ K  F PN +   + +L+  ++ +N
Sbjct: 259 TMKTYENILNCKLKF-PNFFHDDVKDLLSKLITKN 292

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 97/199 (48%), Gaps = 35/199 (17%)

Query: 75  CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCP 134
            LKR +  +E+ +  + +E+ +++KL   PNIV++ D   SR        +  ++ +L  
Sbjct: 87  LLKRALKGNELQM--LYDELSILQKL-DHPNIVKFKDWFESRE-------KFYIVTQLAT 136

Query: 135 NKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL-VDANNN 193
              L D + +  K K +E++ +KI+  +   +  MH   Q ++HRD+K ENVL +D ++ 
Sbjct: 137 GGELFDRILK--KGKFTETDAVKIVVQMLTAVEYMH--SQNVVHRDLKPENVLYLDPSDE 192

Query: 194 FKLC--DMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQ---YRAPEMIDLYRYLPINEKS 248
            +L   D G   Q S            +++  +H       Y APE++    +    +  
Sbjct: 193 SQLVISDFGIAKQLS------------SESQLIHRAAGSMGYVAPEVLTTSGH---GKPC 237

Query: 249 DIWALGIFLYKLLFYTTPF 267
           DIW+LG+  Y LL   +PF
Sbjct: 238 DIWSLGVITYTLLCGYSPF 256

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 89/187 (47%), Gaps = 21/187 (11%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +++E+ ++K+L    NIV Y+ S+       + G  + + +E  P  S+   +N   
Sbjct: 512 IDALQHEMNILKELHHE-NIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLNNY- 562

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                E  +      + IG++ +H   + +IHRDIK  N+L+D     K+ D G + + S
Sbjct: 563 -GPFDEPLVKNFTRQILIGLAYLH--KRNIIHRDIKGANILIDIKGGVKITDFGISKKLS 619

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
           P        A +  ++Y      + APE++   + +   EK+DIW++G  + ++     P
Sbjct: 620 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCVIVEMFTGKHP 670

Query: 267 FEITGQM 273
           F    QM
Sbjct: 671 FPDFSQM 677

>Sklu_2437.16 YOL100W, Contig c2437 35714-38929 reverse complement
          Length = 1071

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 88/194 (45%), Gaps = 14/194 (7%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           +  L+E  PN   L  M +     L+E         +   I  +H     ++HRDIK EN
Sbjct: 256 LYFLLEYAPNGDFLSVMKKF--GSLNEECCRYYGAQMLDAIDFIH--KNGVVHRDIKPEN 311

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPIN 245
           +L+D +   KL D G+         S  ++   +++     T +Y +PE+++      +N
Sbjct: 312 ILLDEHMKVKLTDFGTAKLLDRDEKSGYNLLKKSRSFV--GTAEYVSPELLNDN---CVN 366

Query: 246 EKSDIWALGIFLYKLLFYTTPFEITGQM----AILHSKYDFPPNKYSSKIINLIIIMLAE 301
            K DIWA G  LY+++    PF+ T +      ++  +Y F    +   I +L+  +L +
Sbjct: 367 YKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG-FPLVIRDLVKQLLVK 425

Query: 302 NPNLRPNIFQVVYH 315
           +P  R N  QV  H
Sbjct: 426 SPEARLNASQVKSH 439

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 33/191 (17%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKT 148
           E   EV++  K+    NI + +D            F+  ++ME C    L + +      
Sbjct: 103 EALYEVDIQSKIGKHKNITELYDY-----------FDSYIIMEYCSGGDLYEAIKADTIP 151

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLV-DANNNFKLCDMGSTSQCSP 207
           + +  ++  I+  +   +  +H   + + HRDIK EN+L+ D+N   KL D G       
Sbjct: 152 RKTR-QLTHIISQILDAVEFVH--SKGIYHRDIKPENILIADSNWTVKLTDWG------- 201

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDL-YRYLPINE-----KSDIWALGIFLYKLL 261
             ++  D   M +N+    + +Y APE+ +    Y   NE     K DIWA+GI L  ++
Sbjct: 202 --LATTDQTSMDRNV---GSERYMAPELFESNLDYDERNEPYECSKVDIWAIGIVLLNIV 256

Query: 262 FYTTPFEITGQ 272
           F+  PF +  Q
Sbjct: 257 FHKNPFSVANQ 267

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 121/284 (42%), Gaps = 45/284 (15%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV-IVNDEMGLNEM 90
           R  I + +  G F  +Y  K   +LNE              +  +K V + N E  +  +
Sbjct: 4   RFVIENCIGRGNFGDVYKAKDT-WLNE--------------VVAVKVVNLENSEEEVELL 48

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKL 150
             E+  + +LKS P +  Y  +             + + ME C   S+ D +     + L
Sbjct: 49  AQEIFFLAELKS-PYVTNYIATVVE-------DVSMWIAMEYCGGGSVGDLLKYHYTSGL 100

Query: 151 SESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMM 210
            E +   I  ++  G+S +H   Q  IHRDIK  N+L+      KL D G         +
Sbjct: 101 PEHKTRFITREILKGLSYLH--SQRKIHRDIKAANILLTDEGKVKLSDFG---------V 149

Query: 211 SNQDIAMMTQNIYVHTTPQYRAPEMI--DLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
           S + ++   ++ +V  TP + APE++  D   Y   +E++DIW+LGI + ++L  + P  
Sbjct: 150 SGKLLSSFRRDTFV-GTPYWMAPEIVAHDSEGY---DERADIWSLGITVIEMLRGSPPLS 205

Query: 269 ITGQMAILHSKYDFPPNK----YSSKIINLIIIMLAENPNLRPN 308
               M ++ +     P K    +S    + + + L +   +RP 
Sbjct: 206 KYDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLIKESAIRPT 249

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 110/235 (46%), Gaps = 34/235 (14%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACL-KRVIVNDEMGLNEM 90
           R +++  +  G +  +   +F+E + +  ++  K    V   A L KR +          
Sbjct: 22  RFQLIKEIGYGAYGIVCSARFMESVED-TTVAIKKVTNVFSKALLCKRSL---------- 70

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY-MNQRLKTK 149
             E+++++  +   NI   +D +     DG   F  L L E      L+++ M+Q +K+ 
Sbjct: 71  -RELKLLRHFRGHKNITCLYDMDIVLLPDG--SFNGLDLYE-----ELMEWDMHQIIKSG 122

Query: 150 --LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP 207
             L+++     +Y +  G+  +H  D  ++HRD+K  N+LV+A+   K+CD G     S 
Sbjct: 123 QPLTDAHYQSFVYQILCGLKYIHSAD--VLHRDLKPGNLLVNADCQLKICDFGLARGYSE 180

Query: 208 -PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
            P+ ++Q    +T+ +    T  YRAPE+  +  Y       D+W+ G  L +LL
Sbjct: 181 NPIENDQ---FLTEYV---ATRWYRAPEI--MLSYQGYTRAIDVWSCGCVLAELL 227

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 81/171 (47%), Gaps = 30/171 (17%)

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            LKT ++E E   +   V+ G+ ++H  +  ++HRDIK ENV+VD     K+ D GS +  
Sbjct: 1101 LKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY- 1157

Query: 206  SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI--DLYRYLPINEKSDIWALGIFLYKLLFY 263
                     +     +++V T   Y APE++  D Y   P     D+WA+G+ LY +++ 
Sbjct: 1158 ---------VKRGPFDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIYK 1203

Query: 264  TTPFE-----ITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNI 309
              PF      + G + I       P    S + + LI  +L  + N RP +
Sbjct: 1204 ENPFYNIDEILDGDLRI------SPAVVVSEECVALITRILNRSVNRRPTV 1248

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 87/194 (44%), Gaps = 38/194 (19%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKT 148
           E   EV++  K+    NIVQ +D            F+  ++ME C    L + +   L  
Sbjct: 122 EAMYEVDIQTKIGFHENIVQLYDF-----------FDSYIIMEYCSGGDLYEAIKDDLVP 170

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDA--NNNFKLCDMGSTSQCS 206
           K ++ EI  I+  +   I  +H  ++ + HRDIK EN+L+ +  +   KL D G      
Sbjct: 171 KKTK-EITHILTQILDAIEFVH--NKQIYHRDIKPENILITSLIDWKIKLTDWG------ 221

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE--------KSDIWALGIFLY 258
              ++  D     +N+    + +Y  PE+ +    L I+E        K D+W++GI   
Sbjct: 222 ---LATTDEKSYDRNV---GSERYMPPELFE--SNLDIDERKEPYDCSKVDLWSIGIVFL 273

Query: 259 KLLFYTTPFEITGQ 272
            ++FY  PF I  Q
Sbjct: 274 NVVFYKNPFRIADQ 287

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/278 (20%), Positives = 119/278 (42%), Gaps = 43/278 (15%)

Query: 35   IVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKR--VIVNDEMGLNEMRN 92
            ++  L +G F ++ + K            SK+  ++  I  LK+  +I N ++       
Sbjct: 850  LLKVLGKGNFGKVLLAK------------SKNTDSLCAIKVLKKDHIIKNHDIESARAEK 897

Query: 93   EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM-NQRLKTKLS 151
            +V ++      P +   +    S +T+ +    +   ME      L+ ++ NQRL  + +
Sbjct: 898  KVFLLATKAKHPFLTNLY---CSFQTENR----IYFAMEFIGGGDLMWHVQNQRLSVRRA 950

Query: 152  ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
            +       Y   + ++  ++ D  +++RD+K+EN+L+    + K+ D G    C   M  
Sbjct: 951  K------FYAAEVLLALKYFHDNGVVYRDLKLENILLTPEGHIKIADYGL---CKDEMWY 1001

Query: 212  NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
                +          TP++ APE++    Y    +  D WA G+ LY++L   +PF    
Sbjct: 1002 GNKTSTFC------GTPEFMAPEILKEQEY---TKSVDWWAFGVLLYQMLLCQSPFSGDD 1052

Query: 272  QMAILHSKY-DFP--PNKYSSKIINLIIIMLAENPNLR 306
            +  + ++   D P  P   +  I+ +   +L ++P  R
Sbjct: 1053 EDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPERR 1090

>Scas_720.94
          Length = 1683

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 111/260 (42%), Gaps = 46/260 (17%)

Query: 38   YLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV--IVNDEMGLNEMRNEVE 95
            ++  G F  +Y       L+  E L  K  I + D   +K++  +V +EM + EM N   
Sbjct: 1366 FIGGGTFGTVYSAV---NLDNGEILAVKE-IKIQDSKTMKKIFPLVKEEMTVLEMLNH-- 1419

Query: 96   VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
                    PNIVQY+     R        +V + ME C   S    M   L+    E E+
Sbjct: 1420 --------PNIVQYYGVEVHRD-------KVNIFMEYCEGGS----MASLLEHGRIEDEM 1460

Query: 156  LKIMYDVSIGISNMHYLDQP-LIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQD 214
            +  +Y + + +  + YL Q  ++HRDIK EN+L+D N   K  D G+  + +       +
Sbjct: 1461 VTQVYTLEL-LEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTN 1519

Query: 215  IAMMTQNIY-------------VHT---TPQYRAPEMIDLYRYLPINEKSDIWALGIFLY 258
            I   +++               VH    TP Y APE I  Y+        DIW+ G  + 
Sbjct: 1520 INSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVL 1579

Query: 259  KLLFYTTPFE-ITGQMAILH 277
            +++    P+  +  + AI++
Sbjct: 1580 EMITGRRPWANLDNEWAIIY 1599

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 123/302 (40%), Gaps = 46/302 (15%)

Query: 24  QMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVND 83
           Q I+VG    E +  L +G   ++Y+VK  +  N   +L   S   +     +KR++   
Sbjct: 488 QDITVGPQSFEKIRLLGQGDVGKVYLVK-EKRTNRLYALKIFSKSEMIKRKKIKRILAEQ 546

Query: 84  EMGLNEMRNEVEVMKKLKSS--PNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
           E+              L +S  P +V  + S  S          + L ME C        
Sbjct: 547 EI--------------LATSNHPFVVTLYHSFQSEDY-------LYLCMEYCMGGEFFRA 585

Query: 142 MNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGS 201
           +  R    +SE +      +V+  +  +H L    I+RD+K EN+L+  + +  L D   
Sbjct: 586 LQTRKSKCISEEDAKFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFDL 643

Query: 202 TSQCS----PPMMSNQ-----DIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSD 249
           + Q      P +  N      D  + +     ++   T +Y APE+I   R        D
Sbjct: 644 SIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVD 700

Query: 250 IWALGIFLYKLLFYTTPF--EITGQMA--ILHSKYDFP-PNKYSSKIINLIIIMLAENPN 304
            W LGI +Y++LF  TPF  E T +    IL     FP  N+ S    +LI  +L +N +
Sbjct: 701 WWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNNNEVSRNCKDLIKKLLIKNES 760

Query: 305 LR 306
            R
Sbjct: 761 KR 762

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 135/323 (41%), Gaps = 62/323 (19%)

Query: 23  GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82
           G+ +++ A R  +   +  G FA +Y             L   SA  V  I  + R  + 
Sbjct: 8   GRPVAIVAERYVVEKEIGRGSFAVVYK----------GHLADSSAGNVA-IKAVSRSKLR 56

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142
           ++  L  +  E+ ++KK+K  P+IV   +         + G +  L+ME C    L  ++
Sbjct: 57  NKKLLENLEIEIAILKKIKH-PHIVGLLECE-------RTGTDFYLMMEYCALGDLTFFI 108

Query: 143 NQRLKTKLSESEILKIMYDVSIGISNMH----------YLDQP-----------LIHRDI 181
            +R ++ + +  +++ +++     S  H          YL Q            L+HRDI
Sbjct: 109 KKR-RSLMDKHPLVRTLFEKYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDI 167

Query: 182 KIENVL-----VDANNNFKLCDMGSTSQCSPPMMSNQDI--AMMTQNIYVHTT----PQY 230
           K +N+L     VD N+  +    G     + P++   D   A    N  +  T    P Y
Sbjct: 168 KPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLY 227

Query: 231 RAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILH------SKYDFPP 284
            APE+++  +Y   N K+D+W++G  LY++     PF+ +  + +            FP 
Sbjct: 228 MAPEILNYQKY---NAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPK 284

Query: 285 N-KYSSKIINLIIIMLAENPNLR 306
           +    S +++LI  +L   P  R
Sbjct: 285 HAALESAMVDLICGLLTFEPAKR 307

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 70/139 (50%), Gaps = 22/139 (15%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V + +  +H  D  +I+RD+K EN+L+D N + KL D G             D+     
Sbjct: 182 EVCLALEYLHSKD--IIYRDLKPENILLDKNGHIKLTDFGFAKYVP-------DVTYT-- 230

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMA----IL 276
              +  TP Y APE++      P N+  D W+ GI +Y++L   TPF     M     IL
Sbjct: 231 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENIL 284

Query: 277 HSKYDFPPNKYSSKIINLI 295
           +++  FPP  +++K+ +L+
Sbjct: 285 NAEVKFPPF-FNAKVRDLL 302

>Sklu_1995.2 YLR362W, Contig c1995 1578-3767
          Length = 729

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 89/187 (47%), Gaps = 21/187 (11%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +++E+ ++K+L    NIV Y+ S+       + G  + + +E  P  S+   +N   
Sbjct: 510 IDALQHEMNLLKELHHE-NIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLNNY- 560

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                E  I      + IG++ +H   + +IHRDIK  NVL+D     K+ D G + + S
Sbjct: 561 -GPFEEPLIKNFTRQILIGLAYLHR--KNIIHRDIKGANVLIDIKGCVKITDFGISKKLS 617

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
           P        A +  ++Y      + APE++   + +   EK+DIW++G  + ++     P
Sbjct: 618 PLNKQQNKRASLQGSVY------WMAPEVV---KQVVTTEKADIWSVGCLVVEMFTGKHP 668

Query: 267 FEITGQM 273
           F    QM
Sbjct: 669 FPDFSQM 675

>Scas_629.16
          Length = 918

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 118/294 (40%), Gaps = 42/294 (14%)

Query: 26  ISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEM 85
           I+VG    E +  L +G   ++Y+V+  +  N   +L   S   +     +KR++     
Sbjct: 512 ITVGPQSFEKIKLLGQGDVGKVYLVR-EKKTNRLYALKIFSKSEMIKRKKIKRILA---- 566

Query: 86  GLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQR 145
                  E E++    + P +V  + S  S          +   ME C        +  R
Sbjct: 567 -------EQEILA-TSNHPFVVTLYHSFQSEDY-------LYFCMEYCMGGEFFRALQTR 611

Query: 146 LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
               +SE +      +V+  +  +H L    I+RD+K EN+L+  + +  L D   + Q 
Sbjct: 612 RTKCISEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQA 669

Query: 206 SP---PMMSNQ------DIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPINEKSDIWAL 253
                P+M         D  + +     ++   T +Y APE+I   R        D W L
Sbjct: 670 KDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVDWWTL 726

Query: 254 GIFLYKLLFYTTPFEITGQ----MAILHSKYDFP-PNKYSSKIINLIIIMLAEN 302
           GI +Y++LF  TPF+ +        IL +   FP  N  S    +LI  +L +N
Sbjct: 727 GILIYEMLFGFTPFKGSSSNETFSNILKNDVSFPNNNDISRNCKDLIKKLLCKN 780

>Kwal_56.24059
          Length = 353

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 126/295 (42%), Gaps = 51/295 (17%)

Query: 21  PNGQMISVGAHRV---EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLK 77
           P    +S G + +   +I+  L  G F ++++V+ V         G   AI V     LK
Sbjct: 28  PQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLVRSVHN-------GRYYAIKV-----LK 75

Query: 78  RVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKS 137
           +  V   M   E  N+   M KL   P +++ + +    R        + ++M+      
Sbjct: 76  KEQVI-RMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRN-------LFMVMDYIEGGE 127

Query: 138 LLDYM--NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFK 195
           L   +  +QR    +++    +++    + +  +H  D  +I+RD+K EN+L+D N + K
Sbjct: 128 LFSLLRKSQRFPNPVAKFYAAEVI----LALEYLHSHD--IIYRDLKPENILLDRNGHIK 181

Query: 196 LCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGI 255
           + D G   +              T    +  TP Y APE+I      P N+  D W+LGI
Sbjct: 182 ITDFGFAKEVD------------TVTWTLCGTPDYIAPEVIATK---PYNKSVDWWSLGI 226

Query: 256 FLYKLLFYTTPFEITGQM----AILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
            ++++L   TPF     M     IL  K  +PP  +   +++L+  ++  +   R
Sbjct: 227 LIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPF-FHPDVVDLLCKLITSDLTRR 280

>Scas_715.34
          Length = 1150

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 66/143 (46%), Gaps = 19/143 (13%)

Query: 126  VLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
            +   ME      L+ ++ NQRL  + ++       Y   + ++  ++ D  +I+RD+K+E
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 952

Query: 185  NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
            N+L+    + K+ D G    C   M  N   +          TP++ APE++    Y   
Sbjct: 953  NILLTPQGHIKIADYG---LCKDEMWYNNKTSTFC------GTPEFMAPEILKEQGY--- 1000

Query: 245  NEKSDIWALGIFLYKLLFYTTPF 267
                D WA G+ LY++L   +PF
Sbjct: 1001 TRAVDWWAFGVLLYQMLLCQSPF 1023

>YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinase
           kinase (MEK) serine/threonine protein kinase, involved
           in cell wall integrity (low-osmolarity) pathway [1521
           bp, 506 aa]
          Length = 506

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 83/178 (46%), Gaps = 24/178 (13%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLK--TKL 150
           E++  K  KS   IVQY+      ++       + + ME    KSL       LK   ++
Sbjct: 261 ELQFNKSFKSD-YIVQYYGMFTDEQSS-----SIYIAMEYMGGKSLEATYKNLLKRGGRI 314

Query: 151 SESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMM 210
           SE  I KI   V  G+S +H  ++ +IHRDIK +N+L++     KLCD G + +      
Sbjct: 315 SERVIGKIAESVLRGLSYLH--ERKVIHRDIKPQNILLNEKGEIKLCDFGVSGE------ 366

Query: 211 SNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
                A+ +  +    T  Y APE I   +  P +   D+W+LG+ L ++     PFE
Sbjct: 367 -----AVNSLAMTFTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAGGRFPFE 416

>Scas_688.14
          Length = 479

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 106/234 (45%), Gaps = 32/234 (13%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           R +++  +  G +  +   +F E + +          T   I  +  V     +    +R
Sbjct: 22  RFQLIKEIGHGAYGIVCSARFAEAVED----------TTVAIKKVTNVFSKSLLCKRSLR 71

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY-MNQRLKTK- 149
            E+++++  +   NI   +D +     DG   F  L L E      L++  M+Q +K+  
Sbjct: 72  -ELKLLRHFRGHKNITCLYDMDIVFYPDGT--FNGLYLYE-----ELMECDMHQIIKSSQ 123

Query: 150 -LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP- 207
            L+++     +Y +  G+  +H  D  ++HRD+K  N+LV+A+   K+CD G     S  
Sbjct: 124 PLTDAHYQSFIYQILCGLKYIHSAD--VLHRDLKPGNLLVNADCQLKICDFGLARGYSEN 181

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
           P+ +NQ    +T+ +    T  YRAPE+  +  Y    +  DIW+ G  L + L
Sbjct: 182 PVENNQ---FLTEYV---ATRWYRAPEI--MLSYQGYTKAIDIWSTGCILAEFL 227

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 83/193 (43%), Gaps = 37/193 (19%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKT 148
           E   EV++  K+    NI    D            F+  ++ME C    L + +      
Sbjct: 130 EAMYEVDIQTKIGRHQNIAALLDF-----------FDSYIIMEYCSGGDLYEAIKADAVP 178

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDA-NNNFKLCDMGSTSQCSP 207
           K ++S I  I+  +   I  +H  ++ + HRDIK EN+L+   +   KL D G       
Sbjct: 179 KKTKS-ITHIITQIMDAIEYVH--NKGIYHRDIKPENILISGIDWTIKLTDWG------- 228

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE--------KSDIWALGIFLYK 259
             ++  D   M +N+    + +Y +PE+ D    L I E        K D+WA+GI    
Sbjct: 229 --LATTDKTSMDRNV---GSERYMSPELFD--SNLDIKERKEPYDCAKVDLWAMGIVFLN 281

Query: 260 LLFYTTPFEITGQ 272
           ++F+  PF I  Q
Sbjct: 282 IVFHKNPFSIANQ 294

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 111/264 (42%), Gaps = 55/264 (20%)

Query: 31  HRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEM 90
           H  +I+  L  G F ++++V+ V         G   AI V      K  I+   M   E 
Sbjct: 60  HDFQIMRTLGTGSFGRVHLVRSVHN-------GRYYAIKV----LKKHQIIR--MKQIEH 106

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM--NQRLKT 148
            N+   M KL   P +++ + +    R        + ++M+      L   +  +QR   
Sbjct: 107 TNDERRMLKLVEHPFLIRMWGTFQDSRN-------LFMVMDYIEGGELFSLLRKSQRFPN 159

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPP 208
            +++        +V++ +  +H     +I+RD+K EN+L+D N + K+ D G   +    
Sbjct: 160 PVAKFYAA----EVTLALEYLH--SHNIIYRDLKPENILLDRNGHIKITDFGFAKE---- 209

Query: 209 MMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
                   ++T    +  TP Y APE+I      P N+  D W+LGI ++++L   TPF 
Sbjct: 210 --------VITVTWTLCGTPDYIAPEVITTK---PYNKSVDWWSLGILIFEMLAGYTPF- 257

Query: 269 ITGQMAILHSKYDFPPNKYSSKII 292
                      YD  P K   KI+
Sbjct: 258 -----------YDVTPMKTYEKIL 270

>Kwal_56.24584
          Length = 435

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (47%), Gaps = 32/196 (16%)

Query: 88  NEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN---- 143
           +++  E+ +M+ +K   NIV +F +  +  T      E+++LME     SL   M+    
Sbjct: 142 SQLIRELSIMQNVKPHDNIVGFFGAFYTASTSN----EIVILMEYMDCSSLDKIMSTYKA 197

Query: 144 ------QRL-KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKL 196
                 Q L +T   E  + KI Y V  G+S + Y +  +IHRDIK  NVL+++    K+
Sbjct: 198 FVARDMQSLTETWFPEFVLAKISYAVLNGLSYL-YRNYKIIHRDIKPSNVLINSKGFVKI 256

Query: 197 CDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIF 256
           CD G + +          +     + +V T+  Y +PE I    Y   + K D+W+LG+ 
Sbjct: 257 CDFGVSKK----------LINSIADTFVGTST-YMSPERIQGSVY---STKGDVWSLGLM 302

Query: 257 LYKLLFYTTPFEITGQ 272
           + +L+  T  F + G 
Sbjct: 303 IIELV--TGEFPLGGH 316

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 104/238 (43%), Gaps = 39/238 (16%)

Query: 73  IACLKRV--IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLM 130
           I  LK +  +  D+    ++  E++  K  KS   IV+Y+               + + M
Sbjct: 261 IFALKTITTLTTDQESQKQIFRELQFNKSCKSD-YIVRYYGMFTDEEHS-----SIYIAM 314

Query: 131 ELCPNKSLLDYMNQRLK--TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLV 188
           E    +SL       LK   ++ E  + KI   V  G+S +H   + +IHRDIK +N+L+
Sbjct: 315 EYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGLSYLH--QRKIIHRDIKPQNILL 372

Query: 189 DANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKS 248
           +     KLCD G + +       N      T   Y      Y APE I   +  P +  S
Sbjct: 373 NEAGQVKLCDFGVSGEA-----VNSLATTFTGTSY------YMAPERI---QGQPYSVTS 418

Query: 249 DIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           D+W+LG+ L ++     PF+ +G+ A      + PP       I L++++L   P L+
Sbjct: 419 DVWSLGLTLLEVAQAHFPFD-SGKFAA-----NMPP-------IELLMLILTFTPQLK 463

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 111/246 (45%), Gaps = 48/246 (19%)

Query: 56  LNEFESLGSKSAITVGDI-------ACLKRVIV---NDEMGLNEMRNEVEVMKKLKSSPN 105
           L +   LGS ++ TV  +          K+ IV   N+ +   ++  E+ +M+ +    N
Sbjct: 104 LVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAEHRN 163

Query: 106 IVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEIL--------- 156
           IV+++ ++           +V++LME   N   LD + +  K+ L    IL         
Sbjct: 164 IVEFYGAHNLSSDSINGSNDVVILMEYM-NCGSLDTITRTYKS-LQRRGILAANRSYPVQ 221

Query: 157 ----------KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                     +I Y V  G+S + Y +  +IHRDIK  NVL+++    KLCD G + +  
Sbjct: 222 EWFSKPVIISRIAYSVLNGLSYL-YENYKIIHRDIKPSNVLINSKGRIKLCDFGVSRKL- 279

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                N  IA    + +V T+  Y +PE I   +Y     K D+W+LG+ L +LL  T  
Sbjct: 280 -----NNSIA----DTFVGTST-YMSPERIQGNKY---TTKGDVWSLGLMLIELL--TGE 324

Query: 267 FEITGQ 272
           F + G 
Sbjct: 325 FPLGGH 330

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 80/184 (43%), Gaps = 25/184 (13%)

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNA--SRRTDGKPGFEVLLLMELCPNKS 137
           I   E+ L     E++ M   K   NIV   +      +  DG           L   + 
Sbjct: 110 IFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDG-----------LYCYQE 158

Query: 138 LLDYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF 194
           L+DY   R+     + SE  I    Y +  G+  +H  D  +IHRD+K  N+L   +   
Sbjct: 159 LIDYDLARVIHSNVQFSEFHIKHFTYQILCGVKYIHSAD--VIHRDLKPGNILCSISGQL 216

Query: 195 KLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLY-RYLPINEKSDIWAL 253
           K+CD G     S P+ +N   +    N YV  T  YRAPE+I  + RY   N+  D+WA+
Sbjct: 217 KICDFGLARGIS-PLFTNTKTSNHITN-YV-ATRWYRAPELILSHKRY---NKSIDMWAI 270

Query: 254 GIFL 257
           G  L
Sbjct: 271 GCIL 274

>Kwal_27.10004
          Length = 735

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 66/159 (41%), Gaps = 34/159 (21%)

Query: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187
            +ME C    L   +++    K    E  +    V  GI  +H   Q ++HRDIK ENVL
Sbjct: 361 FVMEYCTEGDLFSLISKPNWKKRPLKEKYEYWRQVVEGIKFIH--SQGVVHRDIKPENVL 418

Query: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTT----PQYRAPEMI------- 236
           +      K+ D G +         N+D   +T  + +  T    P Y APE++       
Sbjct: 419 ISKEGIAKMTDFGISD------WGNEDPDDLTSPVRLFDTYVGSPPYSAPEVVAFKDEDS 472

Query: 237 --------DLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                   D Y       K D WALG+ L+ L++  TPF
Sbjct: 473 TYQDRKPYDAY-------KMDCWALGVLLFTLVYQCTPF 504

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 98/221 (44%), Gaps = 41/221 (18%)

Query: 89  EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLK- 147
           ++  E++  K  KS   IV+YF      +        + + ME    KSL     + L  
Sbjct: 223 QLLRELQFNKSFKSE-YIVRYFGMFTDEQNS-----SIYIAMEYMGGKSLEAIYKELLSR 276

Query: 148 -TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
             ++SE  + KI   V  G+S +H  ++ +IHRDIK +N+L++ +   KLCD G + +  
Sbjct: 277 GGRISEKVLGKISEAVLRGLSYLH--EKKVIHRDIKPQNILLNEDGQVKLCDFGVSGE-- 332

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                    A+ +       T  Y APE I   +  P +   D+W+LG+ +         
Sbjct: 333 ---------AVNSLATTFTGTSYYMAPERI---QGQPYSVTCDVWSLGLTI--------- 371

Query: 267 FEITGQMAILHSKYDFPPNKYSSKI--INLIIIMLAENPNL 305
                 + +    + F P+K ++ I  I L+ ++L   P+L
Sbjct: 372 ------LEVAQGHFPFGPDKMATTIAPIELLTLILTFTPHL 406

>Scas_640.14*
          Length = 728

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 87/179 (48%), Gaps = 28/179 (15%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSE 152
           E+  +K L + PNIV+  +   + +  G       +++E         Y+ +  K +L E
Sbjct: 96  EINSLKHL-THPNIVRLEEVLQNSKYIG-------IVLEYASGGEFYKYVQR--KRRLKE 145

Query: 153 SEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSN 212
           +   ++   +  G+S MH   + ++HRD+K+EN+L+D + N  + D G  ++        
Sbjct: 146 ATACRLFAQLISGVSYMH--SKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYA----- 198

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMI---DLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
            D  +M  +     +P Y APE++   + Y+      K+DIW+ GI LY +L    P++
Sbjct: 199 -DNELMKTSC---GSPCYAAPELVITTEPYKA----RKADIWSCGIILYGMLAGYLPWD 249

>Scas_673.20*
          Length = 758

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 99/198 (50%), Gaps = 27/198 (13%)

Query: 66  SAITVG-DIA-CLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPG 123
           +A  +G DI+  +K++ +  +  L  +  E+ V+K+ +  PNI+ + +S     T     
Sbjct: 497 TAYEIGTDISVAIKQIDLKIQPRLQMIWTEMLVLKEYQH-PNIINFINSYLLHDT----- 550

Query: 124 FEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKI 183
             + ++ME     SL D ++    T   E ++  I  +   G++ +H   + ++HRDIK 
Sbjct: 551 --LWIVMEYMDGGSLADIVSFFTPT---EEQMATICRETLFGLNFLH--SRGIVHRDIKS 603

Query: 184 ENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLP 243
           +N+L+  N + K+ D G   Q +    SN      T+   +  TP + APE+I    Y P
Sbjct: 604 DNILLSMNGDIKITDFGFCGQLTE---SN------TKRTTMVGTPYWMAPEVIASKEYGP 654

Query: 244 INEKSDIWALGIFLYKLL 261
              K D+W+LGI + +++
Sbjct: 655 ---KVDVWSLGIMIIEMI 669

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 116/250 (46%), Gaps = 40/250 (16%)

Query: 74  ACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGF-----EVLL 128
             +K V   D+  L ++ +E++++K L +  NIV+Y             GF      + +
Sbjct: 48  VAIKEVNYQDDDELVDIMSEIDLLKNL-NHINIVKY------------HGFIQKQHNLYI 94

Query: 129 LMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLV 188
           ++E C   SL + +++     +SE E    +     G++ +H  +Q +IHRDIK  N+L+
Sbjct: 95  ILEYCAKGSLKNLISR--NRPMSEHEAKPYVRQTLNGLNYLH--EQGVIHRDIKAANILL 150

Query: 189 DANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKS 248
           D+ N  KL D G +++ +   M+            +  +  + APE+I        +  S
Sbjct: 151 DSENVVKLADFGVSTKVNNTAMT------------LAGSLNWMAPEIIG---NRGASTLS 195

Query: 249 DIWALGIFLYKLLFYTTPFEITGQMAILHSKYD---FPPNKYSSKIINLIIIMLAENPNL 305
           DIW+LG  + +LL    PF     M I ++  +   FPP+  SS   + +    A+N   
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 306 RPNIFQVVYH 315
           RP   Q++ H
Sbjct: 256 RPTAVQLLQH 265

>Kwal_27.10581
          Length = 1154

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 83/185 (44%), Gaps = 22/185 (11%)

Query: 126  VLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
            +   ME      L+ ++ NQRL  + ++       Y   + ++  ++ D  +I+RD+K+E
Sbjct: 903  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 956

Query: 185  NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
            N+L+    + K+ D G    C   M      +          TP++ APE++    Y   
Sbjct: 957  NILLTPEGHIKIADYG---LCKDEMWYGNKTSTFC------GTPEFMAPEILKEQEY--- 1004

Query: 245  NEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKY-DFP--PNKYSSKIINLIIIMLAE 301
             +  D WA G+ LY++L   +PF    +  + ++   D P  P   +  I+ +   +L +
Sbjct: 1005 TKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTK 1064

Query: 302  NPNLR 306
            +P  R
Sbjct: 1065 DPERR 1069

>Scas_640.16
          Length = 505

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 104/242 (42%), Gaps = 58/242 (23%)

Query: 93  EVEVMKKLKSSPNIVQYF----DSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLK- 147
           E++  K  KS   IV+Y+    D N+S          + + ME    KSL       L  
Sbjct: 257 ELQFNKSFKSD-YIVRYYGMFNDVNSS---------SIYIAMEYMGGKSLEAVYKNLLSR 306

Query: 148 -TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
             ++SE  + KI   V  G+S +H  +Q +IHRDIK +N+L +     KLCD G + +  
Sbjct: 307 GGRISEKVLGKISESVLRGLSYLH--EQKVIHRDIKPQNILFNEKGQVKLCDFGVSGE-- 362

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
                    A+ +       T  Y APE I   +  P +   DIW+LG+ +         
Sbjct: 363 ---------AVNSLATTFTGTSFYMAPERI---QGQPYSVTCDIWSLGLTI--------- 401

Query: 267 FEITGQMAILHSKYDFPPNKYSSKI--INLIIIMLAENPNLR--PNI-------FQVVYH 315
                 + +   ++ F  +K ++ I  I L++++L  NP L+  P +       F+   H
Sbjct: 402 ------LEVAQGRFPFGSDKITATIAPIELLVLILTFNPELKDEPELNITWSKAFKSFIH 455

Query: 316 IC 317
            C
Sbjct: 456 FC 457

>Kwal_33.13846
          Length = 375

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 21/132 (15%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V + +  +H   Q +I+RD+K ENVL+D N + K+ D G  ++  P +           
Sbjct: 171 EVCLALEYLH--AQDIIYRDLKPENVLLDKNGHVKITDFG-FAKFVPDVTYT-------- 219

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMA----IL 276
              +  TP Y APE++      P N+  D W+ GI ++++L   TPF  +  M     IL
Sbjct: 220 ---LCGTPDYIAPEVVSTK---PYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENIL 273

Query: 277 HSKYDFPPNKYS 288
           +++  FPP  +S
Sbjct: 274 NAELQFPPFFHS 285

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 84/185 (45%), Gaps = 22/185 (11%)

Query: 126  VLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
            +   ME      L+ ++ NQRL  + ++       Y   + ++  ++ D  +I+RD+K+E
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGVIYRDLKLE 953

Query: 185  NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
            N+L+    + K+ D G    C   M      +          TP++ APE++    Y   
Sbjct: 954  NILLTPEGHIKIADYG---LCKDEMWYGNRTSTFC------GTPEFMAPEILKEQEY--- 1001

Query: 245  NEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKY-DFP--PNKYSSKIINLIIIMLAE 301
             +  D WA G+ LY++L   +PF    +  + ++   D P  P   + +I+ +   +L +
Sbjct: 1002 TKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTK 1061

Query: 302  NPNLR 306
            +P  R
Sbjct: 1062 DPEKR 1066

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 94/195 (48%), Gaps = 21/195 (10%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           + + ME C N++L D ++          E  ++   +   +S +H   Q +IHRD+K  N
Sbjct: 784 LFIQMEYCENRTLYDLIHSE-NLNQQRDEYWRLFRQILEALSYIH--SQGIIHRDLKPMN 840

Query: 186 VLVDANNNFKLCDMGSTSQCSPPM----MSNQDIAMMTQNIYVHT-TPQYRAPEMIDLYR 240
           + +D + N K+ D G        +    + +Q++   + N+     T  Y A E++D   
Sbjct: 841 IFIDESRNVKIGDFGLAKNVHRSLDILKLDSQNLPGSSDNLTSAIGTAMYVATEVLDGTG 900

Query: 241 YLPINEKSDIWALGIFLYKLLF-YTTPFEITGQMAILHS-KYDFPPN------KYSSKII 292
           +   NEK D+++LGI  +++++ ++T  E    +  L S   +FPP+      K   KII
Sbjct: 901 HY--NEKIDMYSLGIIFFEMIYPFSTGMERVNILKKLRSVSIEFPPDFDDNKMKVEKKII 958

Query: 293 NLIIIMLAENPNLRP 307
            L+I     +PN RP
Sbjct: 959 RLLI---DHDPNKRP 970

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 101/217 (46%), Gaps = 39/217 (17%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK--- 149
           E++  K  KS   IV+Y+   A   T       + + ME    +SL D + + L +K   
Sbjct: 225 ELQFNKSCKSD-FIVRYYGMFACEETS-----TIFIAMEYMGGRSL-DSVYKHLLSKGGR 277

Query: 150 LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPM 209
           + E  + KI   V  G+  +H  ++ +IHRDIK +N+L +     KLCD G + +     
Sbjct: 278 IGEKVLGKIAESVLRGLFYLH--ERKIIHRDIKPQNILFNEIGQIKLCDFGVSGE----- 330

Query: 210 MSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI 269
                 A+ +       T  Y APE I   +  P +  SD+W+LG+ L ++    +PF+ 
Sbjct: 331 ------AVNSLATTFTGTSYYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGHSPFD- 380

Query: 270 TGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
           T ++A      + PP       I L++++L   P L+
Sbjct: 381 TDKLAA-----NMPP-------IELLMLILTFTPELK 405

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 87/200 (43%), Gaps = 27/200 (13%)

Query: 126 VLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
           +  +M+L P   LL  +  R +   SE+     M  +   +  +H +   +IHRD+K EN
Sbjct: 86  LYFVMDLAPGGELLQLL--RRQRVFSEAWARHYMCQLVDTVEYIHSMG--VIHRDLKPEN 141

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI----DLYRY 241
           VL+D      + D G+          +      T  +    T +Y +PE++      Y  
Sbjct: 142 VLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFV---GTAEYVSPELLLENKSYY-- 196

Query: 242 LPINEKSDIWALGIFLYKLLFYTTPF------EITGQMAILHSKYDFPPNKYSSKIINLI 295
                 SD+WALG  LY+ L  T PF      E   Q+  L   +  P N  ++ +++ I
Sbjct: 197 -----SSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAAGLVSKI 251

Query: 296 IIMLAENPNLRPNIFQVVYH 315
           +++   +P+ R  + Q+  H
Sbjct: 252 LVL---DPSQRYTLEQIKKH 268

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 88/199 (44%), Gaps = 32/199 (16%)

Query: 89  EMRNEVEVMKKL--KSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           +++ E+ +MKK   +    +++  D   SR+        + L++E C    +       +
Sbjct: 173 KIKREIAIMKKCHHEHVVKLIEVLDDAKSRK--------IYLVLEYCSKGEIKWCPGDVI 224

Query: 147 KTK------LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
           +TK      LS     +I   V +G+  +H+  Q +IHRDIK  N+L+  +   K+ D G
Sbjct: 225 ETKARGPPLLSFQRTREIFRGVLLGLEYLHF--QGIIHRDIKPANLLLSEDGIVKISDFG 282

Query: 201 STSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI---DLYRYLPINEKS--------- 248
            +   S    S+ D     +      TP + APE+    D  +   ++  S         
Sbjct: 283 VSLAFSSD--SSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPIISFPT 340

Query: 249 DIWALGIFLYKLLFYTTPF 267
           DIWA+GI L+ LLF   PF
Sbjct: 341 DIWAMGITLHCLLFGMLPF 359

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 103/237 (43%), Gaps = 38/237 (16%)

Query: 32  RVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRV--IVNDEMGLNE 89
           R E++  +  G +  +   +F E         +    TV     +K+V  I +  +    
Sbjct: 20  RFELIKEIGHGAYGIVCSARFTE---------ASEETTVA----IKKVTNIFSKTLLCKR 66

Query: 90  MRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLL--LMELCPNKSLLDYMNQRLK 147
              E+++++  +   NI   +D +     DG      L   LME C        M+Q +K
Sbjct: 67  SLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELME-CD-------MHQIIK 118

Query: 148 T--KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
           +   L+++      Y +  G+  +H  D  ++HRD+K  N+LV+A+   K+CD G     
Sbjct: 119 SGQALTDAHYQSFTYQILCGLKYIHSAD--VLHRDLKPGNLLVNADCQLKICDFGLARGY 176

Query: 206 SP-PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
           S  P  +NQ    +T+ +    T  YRAPE+  +  Y    +  DIW+ G  L + L
Sbjct: 177 SENPEENNQ---FLTEYV---ATRWYRAPEI--MLSYQGYTKAIDIWSTGCILAEFL 225

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 123/304 (40%), Gaps = 50/304 (16%)

Query: 24  QMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVND 83
           Q I VG    E +  L +G   ++++V+                     +  LK V+  D
Sbjct: 487 QDIMVGPQSFEKIRLLGQGDVGKVFLVR---------------EKKTNRVYALK-VLSKD 530

Query: 84  EM-GLNEMRNEVEVMKKLKSS--PNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLD 140
           EM   N+++  +   + L +S  P IV  + S  S          + L ME C       
Sbjct: 531 EMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDY-------LYLCMEYCMGGEFFR 583

Query: 141 YMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
            +  R    + E +      +V+  +  +H L    I+RD+K EN+L+  + +  L D  
Sbjct: 584 ALQTRKTKCICEDDARFYASEVTAALEYLHLLG--FIYRDLKPENILLHQSGHIMLSDFD 641

Query: 201 STSQCSPPMM-----SNQDIAMMTQ--------NIYVHTTPQYRAPEMIDLYRYLPINEK 247
            + Q     +     S Q   + T+        N +V  T +Y APE+I   R       
Sbjct: 642 LSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFV-GTEEYIAPEVI---RGNGHTAA 697

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQ----MAILHSKYDFPPNKYSSKII-NLIIIMLAEN 302
            D W LGI +Y++LF  TPF+          IL ++  FP N   S+   +LI  +L +N
Sbjct: 698 VDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKN 757

Query: 303 PNLR 306
            + R
Sbjct: 758 ESKR 761

>Kwal_33.14167
          Length = 838

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 125/315 (39%), Gaps = 62/315 (19%)

Query: 25  MISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN-- 82
           ++ V     E +  L  GG +++Y VK                     +  LKRV  +  
Sbjct: 507 VVYVNGTEYEKLELLGRGGTSKVYKVKNANN---------------NKVYALKRVSFDEF 551

Query: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM 142
           D+  ++  + E+E++KKL++ P +V+  D              VL ++  C +  L   +
Sbjct: 552 DDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDH--------GVLYVVMECGDHDLSQTL 603

Query: 143 NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGST 202
             R    L    +     ++   +  +H  D  ++H D+K  N  V      K+ D G  
Sbjct: 604 AHRSGMPLDVEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG-- 658

Query: 203 SQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY----------LPINEKSD 249
                  ++N  +   T NIY  T   TP Y APE +    Y            + + SD
Sbjct: 659 -------IANA-VPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAPEQSRWKVGKPSD 710

Query: 250 IWALGIFLYKLLFYTTPF-EITGQ---MAILHSKYDFP-PNKYSS------KIINLIIIM 298
           IW+ G  +Y++++   P+    GQ   +AI++ +     P K S+        I+ +   
Sbjct: 711 IWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKAC 770

Query: 299 LAENPNLRPNIFQVV 313
           L  NPN R  + +V 
Sbjct: 771 LERNPNKRWTVEEVA 785

>Scas_713.21
          Length = 641

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 136/331 (41%), Gaps = 63/331 (19%)

Query: 15  PNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIA 74
           P++    + Q   +    + IV  L +GG +++Y V+                   G   
Sbjct: 303 PSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD----------------RTGKYY 346

Query: 75  CLKRVIVN--DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMEL 132
            LK++++   DE    ++  E+E++K+L     +V+  +     R        V +LME 
Sbjct: 347 ALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRM-------VQVLME- 398

Query: 133 CPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANN 192
           C N  L   +++R+      + +  +  ++   I  +H  D  ++H D+K  N +     
Sbjct: 399 CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH--DSDIVHSDLKPANFIF-VKG 455

Query: 193 NFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY-------- 241
             KL D G  ++          IA  T N+Y +T   TP Y APE +    Y        
Sbjct: 456 TLKLIDFGIANK----------IADNTLNVYRNTQMGTPNYMAPETLISQNYSNNNNNLL 505

Query: 242 LPINEKSDIWALGIFLYKLLFYTTPF-EITGQ---MAILHS--KYDFP-----PNKYSSK 290
             I + SDIW+ G  LY++ +   P+    G    +AI++   + D+P       K    
Sbjct: 506 WKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQS 565

Query: 291 IINLIIIMLAENPNLRPNIFQVVYHICSIMN 321
           ++ LI   L  +P LR    ++ +  CS  N
Sbjct: 566 LVALIKTCLNRDPQLRATTDEIQH--CSFFN 594

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 101/229 (44%), Gaps = 36/229 (15%)

Query: 99  KLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKI 158
           KL S PNIV+  +   + +  G       ++++         Y+ +  K +L E    ++
Sbjct: 103 KLLSHPNIVRLEEVLQNSKYIG-------IVLQYASGGEFYKYIQK--KRRLKEPPACRL 153

Query: 159 MYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMM 218
              +  G+  +HY  + L HRD+K+EN+L+D + N  + D G  ++         D+   
Sbjct: 154 FAQLISGVHYIHY--KGLAHRDLKLENLLLDEHENLIITDFGFVNE-----FHKNDLMRT 206

Query: 219 TQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQ------ 272
           +       +P Y APE++   +     +K+D+W+ G+ LY +L    P++   +      
Sbjct: 207 SCG-----SPCYAAPELVVSSKPYSA-QKADVWSCGVILYAMLAGYLPWDDDPENPEGED 260

Query: 273 -----MAILHSKYDFPPNKYSSKII-NLIIIMLAENPNLRPNIFQVVYH 315
                  I H+   FP  +Y   I  +L+  +L  NP +R  +  +  H
Sbjct: 261 IAKLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQH 307

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 106/226 (46%), Gaps = 33/226 (14%)

Query: 94  VEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSES 153
           ++++K LK   NIV+Y     S         E+ +L+E C   SL D +    K  LSE+
Sbjct: 65  IDLLKNLKHE-NIVKYHGFIQSSH-------ELYILLEYCIRGSLRDLIK---KEALSEA 113

Query: 154 EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQ 213
           +    +     G+  +H  DQ +IHRDIK  N+L+  N   KL D G +++ +       
Sbjct: 114 KAKTYVRQTLRGLQYLH--DQGVIHRDIKAANLLLTENGVVKLADFGVSTRVN------- 164

Query: 214 DIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF----EI 269
           ++AM         +P + APE++ L +    +  SDIW+LG  + +LL    PF      
Sbjct: 165 NMAMTYAG-----SPNWMAPEVM-LGK--GASTVSDIWSLGATVVELLTGNPPFYNLVNE 216

Query: 270 TGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYH 315
               AI++  Y +PP   S++    + +   +N   RP   Q++ H
Sbjct: 217 AACYAIVNDVY-YPPEHLSAECKAFMELCFQKNMFKRPQAHQLLQH 261

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 95/202 (47%), Gaps = 33/202 (16%)

Query: 73  IACLKR-VIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           I  +KR  I  D     ++  E+  +K L S PNIV+  +   + +  G       +++E
Sbjct: 96  IKLIKRDFITKDPSKETKIYREINALKHL-SHPNIVKLEEVLQNSKYIG-------IVLE 147

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYL-DQPLIHRDIKIENVLVDA 190
                    ++ +  K +L E+   ++   +   IS +HY+  + L+HRD+K+EN+L+D 
Sbjct: 148 YAAGGEFYKFIQR--KRRLKENHACRLFSQL---ISAVHYIHSKGLVHRDLKLENLLLDN 202

Query: 191 NNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRYLPIN-E 246
             N  + D G  ++             + QN  + T   +P Y APE++   R  P +  
Sbjct: 203 EENLIITDFGFVNE------------FLRQNGMMKTSCGSPCYAAPELVVSNR--PYDAR 248

Query: 247 KSDIWALGIFLYKLLFYTTPFE 268
           K+D W+ GI L+ +L    P++
Sbjct: 249 KADTWSCGIILFAMLAGYLPWD 270

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 77/182 (42%), Gaps = 20/182 (10%)

Query: 80  IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLL 139
           I   E+ L     E++ M   K   NIV   D       + +P   +    EL      +
Sbjct: 110 IFTREILLKRAIRELKFMSYFKGHRNIVSLIDLEI---VNEEPYSGLYCYQEL------V 160

Query: 140 DYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKL 196
           DY   R+       SE  I   +Y +  G+  +H  D  +IHRD+K  N+L       K+
Sbjct: 161 DYDLARVIHSNVLFSEFHIKHFLYQILCGMKYIHSAD--VIHRDLKPGNILCSITGEIKI 218

Query: 197 CDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLY-RYLPINEKSDIWALGI 255
           CD G     SP       I+    N YV  T  YRAPE+I  + RY   ++  D+WA+G 
Sbjct: 219 CDFGLARGISPSFTVAGGISNHITN-YV-ATRWYRAPELILSHKRY---SKSVDMWAVGC 273

Query: 256 FL 257
            L
Sbjct: 274 IL 275

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 115/243 (47%), Gaps = 30/243 (12%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEY--LNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMR 91
           ++V    +G    +Y+ K ++    N+   L S     VG+   +K++ ++++     + 
Sbjct: 361 QLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIM 420

Query: 92  NEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK-- 149
           NE+ VM   +   NIV + ++      D +   E+ ++ME      L D ++   ++   
Sbjct: 421 NELLVMNDSRQE-NIVNFLEAYI---IDDE---ELWVIMEYMEGGCLTDILDAVARSNTG 473

Query: 150 -----LSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQ 204
                L+E+++  I+ +   G+  +H  ++ +IHRDIK +N+L+++    K+ D G    
Sbjct: 474 EHSSPLNENQMAYIVKETCQGLKFLH--NKKIIHRDIKSDNILLNSQGLVKITDFGF--- 528

Query: 205 CSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYT 264
           C          A M        TP + APE+++   Y   +EK D+W+LGI L +++   
Sbjct: 529 CVELTEKRSKRATMV------GTPYWMAPEIVNQKGY---DEKVDVWSLGIMLIEMIEGE 579

Query: 265 TPF 267
            P+
Sbjct: 580 PPY 582

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 21/128 (16%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V++ +  +H     +I+RD+K EN+L+D N + K+ D G   +              T 
Sbjct: 142 EVTLALEYLH--AHNIIYRDLKPENILLDRNGHIKITDFGFAKEVD------------TV 187

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE----ITGQMAIL 276
              +  TP Y APE+I      P N+  D W+LGI ++++L   TPF     I     IL
Sbjct: 188 TWTLCGTPDYIAPEVITTK---PYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKIL 244

Query: 277 HSKYDFPP 284
             K  FPP
Sbjct: 245 AGKVVFPP 252

>Sklu_1843.3 YOR231W, Contig c1843 2632-4092 reverse complement
          Length = 486

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 88/183 (48%), Gaps = 31/183 (16%)

Query: 126 VLLLMELCPNKSL-LDYMNQ-RLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKI 183
           + + ME    KSL   Y N  R   ++SE  + KI   V  G+S +H  ++ +IHRDIK 
Sbjct: 272 IYIAMEYMGGKSLDAIYKNLLRRGGRISEKVLGKIAESVLRGLSYLH--ERRIIHRDIKP 329

Query: 184 ENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLP 243
           +N+L++     KLCD G + +           A+ +       T  Y APE I   +  P
Sbjct: 330 QNILLNEIGQVKLCDFGVSGE-----------AVNSLATTFTGTSYYMAPERI---QGQP 375

Query: 244 INEKSDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENP 303
            +  SD+W+LG+ L ++     PF  + +MAI     + PP       I L++++L   P
Sbjct: 376 YSVTSDVWSLGLTLLEVAQGHFPFN-SDKMAI-----NMPP-------IELLMLILTLTP 422

Query: 304 NLR 306
            L+
Sbjct: 423 ELK 425

>Kwal_33.14434
          Length = 759

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 98/234 (41%), Gaps = 46/234 (19%)

Query: 55  YLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVE------VMKKLKSS----- 103
           Y    E+LG+ +    G +  ++R   N    + E R + +       +KK+ S      
Sbjct: 403 YTKTGENLGAGAG---GSVRLVRRTQDNKLFAVKEFRTKFDHEAKRDYVKKITSEYCIGT 459

Query: 104 ----PNIVQ----YFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
               PNI++     +D+N            +L +ME C      D     +  K+S  EI
Sbjct: 460 TLRHPNIIETVEIVYDNN-----------RILQVMEFCD----YDLFAIVMSNKMSYEEI 504

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
                 +  G+  +H +   L HRD+K++N +++ +   KL D G+ +  S P       
Sbjct: 505 CCCFKQILTGVQYLHSMG--LAHRDLKLDNCVINKHGVVKLIDFGAAAVFSYPFSKT--- 559

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI 269
            ++  +  V + P Y APE+    +Y P     D+W++ I    ++    P++I
Sbjct: 560 -LVESSGIVGSDP-YLAPEVCIFSKYDP--RPVDVWSVAIIFACMVLKKFPWKI 609

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 63/128 (49%), Gaps = 21/128 (16%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V + +  +H  D  +I+RD+K EN+L+D N + K+ D G             D+     
Sbjct: 194 EVCLALEYLHSKD--IIYRDLKPENILLDKNGHIKITDFGFAKYVP-------DVTYT-- 242

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMA----IL 276
              +  TP Y APE++      P N+  D W+ G+ +Y++L   TPF  +  M     IL
Sbjct: 243 ---LCGTPDYIAPEVVST---KPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENIL 296

Query: 277 HSKYDFPP 284
           +++  FPP
Sbjct: 297 NAELKFPP 304

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 86/186 (46%), Gaps = 20/186 (10%)

Query: 85  MGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ 144
           M   ++  EV++  +  +  N+++  D N S          + + MEL     L D +  
Sbjct: 57  MSQEDVLREVKLHSRCSNFVNVLKVIDCNLSDPF-------LWIAMELAEGGDLFDKIEP 109

Query: 145 RLKTKLSESEILKIMYDVSI-GISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
            +     +SE+ +  Y   I  IS +H     + HRDIK EN+L+D + N KL D G  S
Sbjct: 110 DIGV---DSEVAQFYYKQLIKAISYLHD-TCGVAHRDIKPENILLDKDGNLKLADFGLAS 165

Query: 204 QCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFY 263
                +   +D +         + P Y APE+I    Y    + +DIW++G+ L+ LL  
Sbjct: 166 -----LFKRKDGSKRISRDQRGSLP-YMAPEIIYCDGYYA--DMTDIWSIGVLLFVLLTG 217

Query: 264 TTPFEI 269
            TP+E+
Sbjct: 218 ETPWEL 223

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 109/256 (42%), Gaps = 47/256 (18%)

Query: 34  EIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNE 93
           +I+  L  G F ++++++   +   F +L    A+    +  LK+V         E  N+
Sbjct: 153 QILRTLGTGSFGRVHLIR-SNHNGRFYAL---KALKKHTVVKLKQV---------EHTND 199

Query: 94  VEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM--NQRLKTKLS 151
              M  + S P I++ + +    +        V ++M+      L   +  +QR    ++
Sbjct: 200 ERRMLSIVSHPFIIRMWGTFQDSQ-------HVFMVMDYIEGGELFSLLRKSQRFPNPVA 252

Query: 152 ESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMS 211
           +       Y   + ++  +   + +I+RD+K EN+L+D N + K+ D G           
Sbjct: 253 K------FYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYVP----- 301

Query: 212 NQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITG 271
             D+        +  TP Y APE++      P N+  D W+ GI +Y++L   TPF    
Sbjct: 302 --DVTYT-----LCGTPDYIAPEVVST---KPYNKSVDWWSFGILIYEMLAGYTPFYDAN 351

Query: 272 QMA----ILHSKYDFP 283
            M     IL+S+  FP
Sbjct: 352 TMKTYEHILNSELKFP 367

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 115/258 (44%), Gaps = 40/258 (15%)

Query: 82  NDEMGLN-EMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLD 140
           ND+   N + R E  ++ +++  PNIV   DS     +  K   +  L++E   +  L +
Sbjct: 236 NDDQKKNKQFREETNILMRVQH-PNIVNLLDSFVEPIS--KSQIQKYLVLEKIDDGELFE 292

Query: 141 YMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200
            + +  KT L + E   +   +  G+  +H  +Q +IHRDIK EN+L++        +  
Sbjct: 293 RIVR--KTCLRQDESKALFKQLLTGLKYLH--EQNIIHRDIKPENILLNITRR----ENP 344

Query: 201 STSQCSPPMMSNQDIAMMTQNI----------YVHT---TPQYRAPEMIDLYRYLPINEK 247
           S  Q  P      DI +   +           + +T   TP Y APE++    Y     K
Sbjct: 345 SQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGY---TSK 401

Query: 248 SDIWALGIFLYKLLFYTTPFEITGQMA-------ILHSKYDFPP---NKYSSKIINLIII 297
            D+W+ G+ LY  L    PF  + Q+        IL +KY F     +K    +++LI  
Sbjct: 402 VDLWSAGVILYVCLCGFPPF--SDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISN 459

Query: 298 MLAENPNLRPNIFQVVYH 315
           +L  NP+ R NI + + H
Sbjct: 460 LLVLNPDERYNIDEALNH 477

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 124/302 (41%), Gaps = 46/302 (15%)

Query: 24  QMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVND 83
           Q I VG    E +  L +G   ++Y+V+  +  N   +L   S   +     +KR++   
Sbjct: 370 QDILVGPQSFEKIRLLGQGDVGRVYLVR-EKQTNRLYALKIFSKPEMIKRKKIKRILTEQ 428

Query: 84  EMGLNEMRNEVEVMKKLKSS--PNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
           E+              L +S  P IV  + S  +          + L ME C        
Sbjct: 429 EI--------------LATSNHPFIVTLYHSFQTEDY-------LYLCMEYCMGGEFFRA 467

Query: 142 MNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGS 201
           +  R    +SE +      +V+  +  +H +    I+RD+K EN+L+  + +  L D   
Sbjct: 468 LQTRKTKCISEDDARFYSSEVTAALEYLHLMG--FIYRDLKPENILLHQSGHIMLSDFDL 525

Query: 202 TSQC----SPPMMSNQDIAMMTQNIYVHT--------TPQYRAPEMIDLYRYLPINEKSD 249
           + Q     +P +  N   +++   I            T +Y APE+I   R        D
Sbjct: 526 SVQAKDTKNPQVKGNASHSLVDTKICSDGFRTNSFVGTEEYIAPEVI---RGNGHTAAVD 582

Query: 250 IWALGIFLYKLLFYTTPF--EITGQMA--ILHSKYDFPPNKYSSKII-NLIIIMLAENPN 304
            W LGI +Y++LF  TPF  + T Q    IL ++   P N  +S+   +LI  +L +N N
Sbjct: 583 WWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVVIPNNNETSRACKDLIRKLLIKNEN 642

Query: 305 LR 306
            R
Sbjct: 643 KR 644

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 67/142 (47%), Gaps = 13/142 (9%)

Query: 127 LLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENV 186
           L++ME CP     D+ N  +  ++++ E+      +  G+  +H   Q L HRD+K++N 
Sbjct: 339 LVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLH--SQGLAHRDLKLDNC 392

Query: 187 LVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINE 246
           +V A+   KL D GS          N +  +      V + P Y APE++    Y P   
Sbjct: 393 VVTADGILKLIDFGSAII----FRYNFNSKLEPAKGIVGSDP-YLAPELLTQLYYDP--S 445

Query: 247 KSDIWALGIFLYKLLFYTTPFE 268
            +D+W++ +  Y +     P++
Sbjct: 446 AADVWSIAVMFYCMSLRRFPWK 467

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 111/261 (42%), Gaps = 44/261 (16%)

Query: 73  IACLKRVIVN-DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131
           I  +K V +  DE    ++  E+EV+   +S P IV ++    +   +G     V + ME
Sbjct: 443 IMAMKEVRLELDESKFRQILMELEVLHNCQS-PYIVDFY---GAFFIEGA----VYMCME 494

Query: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191
                SL    +      + E ++ +I   V  G+  +  +   +IHRD+K  N+L  A+
Sbjct: 495 YMDGGSLDKTYDDEQIGGIDEPQLARITSSVIQGLKELKDVHN-IIHRDVKPTNILCSAS 553

Query: 192 -NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-----DLYRYLPIN 245
               KLCD G        +  N   ++   NI   +   Y APE I     D   Y   +
Sbjct: 554 QGTIKLCDFG--------VSGNLVASLAKTNIGCQS---YMAPERIKSLNPDKSTY---S 599

Query: 246 EKSDIWALGIFLYKLLFYTTPF------EITGQMAILHSKYDFPP-----NKYSSKIINL 294
            +SDIW+LG+ + ++     P+       I  Q++ +    D PP      K+S+   N 
Sbjct: 600 VQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAI---VDGPPPKLPEGKFSADAQNF 656

Query: 295 IIIMLAENPNLRPNIFQVVYH 315
           + + L + P  RP    ++ H
Sbjct: 657 VSMCLQKIPERRPTYAALLEH 677

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 16/179 (8%)

Query: 85  MGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQ 144
           M +     E++++K   S  NI+   D     R      FE + L++      L   +NQ
Sbjct: 51  MFVTRTLRELKLLKFFHSHENIISVLDI---VRPTSWHKFEAVYLVQELMETDLQKIINQ 107

Query: 145 RLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQ 204
           +    LSE  I   +Y +   + ++H     +IHRD+K  N+L+++N + K+CD G    
Sbjct: 108 Q---NLSEDHIQYFVYQILRALKSLH--SAQVIHRDLKPSNLLLNSNCDLKVCDFGLARC 162

Query: 205 CSPPMMSNQD-IAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEKSDIWALGIFLYKLL 261
            +    S ++ +  MT+ +    T  YRAPE M+    Y       DIW+ G  L +++
Sbjct: 163 LASSDQSRENMVGFMTEYV---ATRWYRAPEIMLSFQEY---TTAMDIWSCGCILAEMI 215

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 90/190 (47%), Gaps = 20/190 (10%)

Query: 87  LNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL 146
           ++ +++E+ ++K+L+   NIV Y+ S+       + G  + + +E  P  S+   ++   
Sbjct: 456 IDALQHEMSLLKELQHE-NIVTYYGSS-------QEGGNLNIFLEYVPGGSVSSMLSNY- 506

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
                E  I+     + IG++ +H   + +IHRDIK  N+L+D     K+ D G + + S
Sbjct: 507 -GPFEEPLIVNFTRQILIGVAYLHR--KNIIHRDIKGANILIDIKGCVKITDFGISKKLS 563

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTP 266
           P    NQD     +   +  +  + +PE++   +      K+DIW+ G  + ++     P
Sbjct: 564 PLNQENQD-----KRTSLQGSVYWMSPEVV---KQTATTSKADIWSTGCVVIEMFTGKHP 615

Query: 267 FEITGQMAIL 276
           +    QM  L
Sbjct: 616 YPDFSQMQAL 625

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 12/115 (10%)

Query: 147 KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCS 206
           K +L E    ++   +  G+  MH+  + L HRD+K+EN+L+D + N  + D G  ++ S
Sbjct: 152 KRRLKEPAACRLFAQLISGVHYMHH--KGLAHRDLKLENLLLDEHENLIITDFGFVNEFS 209

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLL 261
               S  D+   +       +P Y APE++   +      K+D+W+ G+ LY +L
Sbjct: 210 ----SRNDLMKTSCG-----SPCYAAPELVVTTKAYEA-RKADVWSCGVILYAML 254

>Kwal_27.9763
          Length = 868

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 109/247 (44%), Gaps = 44/247 (17%)

Query: 93  EVEVMKKLKSSPNIVQYFDSNASRRTDGKPGF-----EVLLLMELCPNKSLLDYMNQRLK 147
           E++++K LK   NIV+Y             GF     ++ +L+E C   SL D +    +
Sbjct: 68  EIDLLKNLKHE-NIVKYH------------GFIQKSHQLFILLEYCSQGSLRDLIK---R 111

Query: 148 TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSP 207
             + E +    +     G+  +H  DQ +IHRDIK  N+L+DA N  KL D G +++ + 
Sbjct: 112 GPVEEQQCKTYIRQTLHGLKYLH--DQGVIHRDIKAANLLLDAQNVVKLADFGVSTRVN- 168

Query: 208 PMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF 267
                 ++AM         +P + APE++        +  SDIW+LG  + ++L    PF
Sbjct: 169 ------NLAMTYAG-----SPNWMAPEVM---MGQGASTVSDIWSLGATVVEILTGNPPF 214

Query: 268 E----ITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLP 323
                     AI+H  Y  PP+  SS     +     +N   RP    ++ H   I    
Sbjct: 215 HNLVNEAACYAIVHDVY-IPPSTLSSSCRKFLRSCFQKNMFKRPKAQDLLSHE-WIFETK 272

Query: 324 VPIEDRY 330
            PI +R+
Sbjct: 273 KPILERF 279

>Scas_633.29
          Length = 789

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 105/266 (39%), Gaps = 52/266 (19%)

Query: 26  ISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN--D 83
           I+V     E +  L  GG +++Y VK  +                  +  LKRV  +  D
Sbjct: 293 ITVNDTEYEKIELLGRGGSSRVYKVKNSQ----------------NKVFALKRVSFDEFD 336

Query: 84  EMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMN 143
           +  ++  + E+E+++KL +   +V+ FD              VL L+  C +  L   ++
Sbjct: 337 DSSVDGFKGEIELLEKLSNESRVVKLFDYQMDS--------GVLFLIMECGDHDLSQILS 388

Query: 144 QRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTS 203
           QR    L    +     +V   I  +H  D  ++H D+K  N  V      K+ D G  +
Sbjct: 389 QRSDMPLDMDFVRYHAREVVRCIKIVH--DAGIVHSDLKPAN-FVFVKGILKIIDFGIAN 445

Query: 204 QCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY---------LPINEKSDIW 251
                      I   T NIY      TP Y APE +    Y           + + SDIW
Sbjct: 446 A----------IPDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIW 495

Query: 252 ALGIFLYKLLFYTTPFE-ITGQMAIL 276
           + G  +Y++++   P+    GQ  +L
Sbjct: 496 SCGCIIYQMIYGRPPYAGFQGQNRLL 521

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 71/150 (47%), Gaps = 19/150 (12%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           ++   + N+H LD  +++RD+K EN+L+D   +  LCD G    C   M  +        
Sbjct: 453 ELLCALDNLHKLD--VVYRDLKPENILLDYQGHIALCDFG---LCKLNMKDDDKTDTFC- 506

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF--EITGQM--AIL 276
                 TP+Y APE++    Y    +  D W LG+ LY++L    P+  E   +M   IL
Sbjct: 507 -----GTPEYLAPELLLGLGY---TKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 558

Query: 277 HSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
                F P+ +     +L+I +L+ +P  R
Sbjct: 559 QEPLVF-PDGFDRDAKDLLIGLLSRDPTRR 587

>Scas_689.25*
          Length = 409

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V + +  +H LD  +I+RD+K EN+L+D N + K+ D G             D+     
Sbjct: 205 EVCLALDYLHSLD--IIYRDLKPENLLLDRNGHIKVTDFGFAKYVP-------DVTYT-- 253

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMA----IL 276
              +  TP Y APE+I      P N+  D W+ GI +Y++L   TPF  +  M     IL
Sbjct: 254 ---LCGTPDYIAPEVISAK---PYNKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENIL 307

Query: 277 HSKYDFP 283
           ++   FP
Sbjct: 308 NAPLKFP 314

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 67/143 (46%), Gaps = 19/143 (13%)

Query: 126  VLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
            +   ME      L+ ++ NQRL  + ++       Y   + ++  ++ D  +I+RD+K+E
Sbjct: 898  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKYFHDNGIIYRDLKLE 951

Query: 185  NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
            N+L+    + K+ D G         +   ++    +      TP++ APE++    Y   
Sbjct: 952  NILLTLEGHIKIADYG---------LCKDEMWFGNRTSTFCGTPEFMAPEILREQAY--- 999

Query: 245  NEKSDIWALGIFLYKLLFYTTPF 267
             +  D WA G+ LY++L   +PF
Sbjct: 1000 TKAVDWWAFGVLLYQMLLCQSPF 1022

>YKL048C (ELM1) [3211] chr11 complement(346859..348781)
           Serine/threonine protein kinase that regulates
           pseudohyphal growth [1923 bp, 640 aa]
          Length = 640

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 88/184 (47%), Gaps = 17/184 (9%)

Query: 157 KIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNF-KLCDMGS---TSQCSPPMMSN 212
           KI+ D++ G+  +H   Q  IHRDIK  N+L+D      KL D GS   T Q  P   +N
Sbjct: 238 KILEDMTKGLEYLH--SQGCIHRDIKPSNILLDEEEKVAKLSDFGSCIFTPQSLPFSDAN 295

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMIDL----YRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
            +     +   +  TP + APE+  L      ++    K DIW+LG+ LY LL+   PF 
Sbjct: 296 FEDCFQRELNKIVGTPAFIAPELCHLGNSKRDFVTDGFKLDIWSLGVTLYCLLYNELPFF 355

Query: 269 ITGQMAILHSKYDFP-PNKYSSKIINLIII--MLAENPNLRPNIFQVVYHICSIMNLPVP 325
              +    H   +    +K +   +N ++I  +L ++  LR +I  +V     +++   P
Sbjct: 356 GENEFETYHKIIEVSLSSKINGNTLNDLVIKRLLEKDVTLRISIQDLV----KVLSRDQP 411

Query: 326 IEDR 329
           I+ R
Sbjct: 412 IDSR 415

>Scas_653.25
          Length = 666

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 87/193 (45%), Gaps = 21/193 (10%)

Query: 102 SSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTK--LSESEILKIM 159
           S PNI++  D   +      P  ++  +ME CP+    D+ N  +     L+  E     
Sbjct: 327 SHPNIIETLDIFYN------PSGQISEIMEWCPH----DFFNIVMSRTHLLTRRETFCYF 376

Query: 160 YDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMT 219
             +  G+  +H L   + HRD+K++N ++  N   KL D GS +       + +   ++ 
Sbjct: 377 KQLCNGVRYLHTLG--IAHRDLKLDNCVITYNGILKLIDFGSATIFQLNKSTEEKPELIP 434

Query: 220 QNIYVHTTPQYRAPEMIDLYRYLPINEK-SDIWALGIFLYKLLFYTTPFEI----TGQMA 274
               V + P Y APE++ L + +P +   +D+W+LGI    ++    P+ I         
Sbjct: 435 SRGIVGSDP-YLAPEVL-LSKEIPYDASLADVWSLGIIFCAIMLKRFPWRIPLASKDHNY 492

Query: 275 ILHSKYDFPPNKY 287
            L+SK D  P+ Y
Sbjct: 493 ELYSKPDLEPHDY 505

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 74/150 (49%), Gaps = 19/150 (12%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           ++   +  +H L+  +I+RD+K EN+L+D   +  LCD G         M +QD      
Sbjct: 495 ELLCALETLHSLN--VIYRDLKPENILLDYQGHIALCDFGLCKL----NMKDQD----KT 544

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF--EITGQM--AIL 276
           N +   TP+Y APE++    Y   ++  D W LG+ LY++L    P+  E   +M   IL
Sbjct: 545 NTFCG-TPEYLAPELLLGQGY---SKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600

Query: 277 HSKYDFPPNKYSSKIINLIIIMLAENPNLR 306
                F P+ +  +  NL+I +L  +P  R
Sbjct: 601 QEPLRF-PDGFDREAKNLLIELLCRDPKRR 629

>Scas_667.18
          Length = 437

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 87/196 (44%), Gaps = 28/196 (14%)

Query: 74  ACLKRV--IVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDS---NASRRTDGKPGFEVLL 128
             +K+V  I   E+ L     E++ M   +   NIV   D    N +   DG        
Sbjct: 107 VAIKKVTNIFQKEILLKRAIRELKFMNFFQGHKNIVNLIDLEIINENSPYDG-------- 158

Query: 129 LMELCPNKSLLDYMNQRL---KTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIEN 185
              L   + L+DY   ++     KL+E  I   MY +  G+  +H  D  +IHRD+K  N
Sbjct: 159 ---LYCYQELIDYDLAKVIHSSIKLTEFHIQYFMYQILSGLKYIHSAD--VIHRDLKPGN 213

Query: 186 VLVDANNNFKLCDMGSTSQCSPPMMS-NQDIA---MMTQNIYVHTTPQYRAPEMIDLYRY 241
           +L   N N K+CD G     +P   + N ++A   +     YV  T  YRAPE+I  ++ 
Sbjct: 214 ILCTLNGNLKICDFGLARGINPKFYNDNGNLASPKLHDITNYV-ATRWYRAPELILSHKM 272

Query: 242 LPINEKSDIWALGIFL 257
               +  D+W++G  L
Sbjct: 273 Y--TKAIDLWSVGCIL 286

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 65/143 (45%), Gaps = 19/143 (13%)

Query: 126  VLLLMELCPNKSLLDYM-NQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
            +   ME      L+ ++ NQRL  + ++       Y   + ++   + D  +I+RD+K+E
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQRLSVRRAK------FYAAEVLLALKFFHDNGVIYRDLKLE 946

Query: 185  NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
            N+L+    + K+ D G    C   M      +          TP++ APE++   R    
Sbjct: 947  NILLTPEGHIKIADYG---LCKDGMWYGNKTSTFC------GTPEFMAPELL---REQDY 994

Query: 245  NEKSDIWALGIFLYKLLFYTTPF 267
             +  D WA G+ LY++L   +PF
Sbjct: 995  TKAVDWWAFGVLLYQMLLCQSPF 1017

>KLLA0E07414g complement(672690..673787) highly similar to sp|P21965
           Saccharomyces cerevisiae YNL307c MCK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 365

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 95/203 (46%), Gaps = 30/203 (14%)

Query: 93  EVEVMKKLKSSPNIV--QYFDSNASRRTDGKPGFEVLLLMELCPNK---SLLDYMNQRLK 147
           E+E+++ +   PN+V  +YF ++ S  TD K      L ME  P      +L Y    L+
Sbjct: 72  ELEILR-IADHPNVVKLEYFYTHISP-TDHK--LYQHLAMECLPEMLQNEILRYKKNNLE 127

Query: 148 TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN-FKLCDMGSTSQCS 206
             L   ++    Y ++ G+  +H L   + HRDIK  NVLVD      K+CD GS  +  
Sbjct: 128 LPLKHVKLYA--YQIARGMLYLHALG--ICHRDIKPSNVLVDPQTGILKICDFGSAKK-- 181

Query: 207 PPMMSNQDIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPINEKSDIWALGIFLYKLLFYTT 265
             + SNQ       +I    +  YRAPE+I    +Y     K DIW LG  L ++L    
Sbjct: 182 --LESNQP------SISYICSRYYRAPELIVGCTQY---TTKIDIWGLGCVLGEMLLGKA 230

Query: 266 PFEITGQMAILH--SKYDFPPNK 286
            F+    +  LH  +K   PP+K
Sbjct: 231 VFQGHQPLLQLHEITKLLGPPDK 253

>YJL187C (SWE1) [2737] chr10 complement(76802..79261)
           Serine/tyrosine dual-specificity protein kinase,
           phosphorylates Cdc28p on tyrosine and inhibits its
           activity, involved in G2 phase cell-cycle checkpoint
           control [2460 bp, 819 aa]
          Length = 819

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 110/228 (48%), Gaps = 31/228 (13%)

Query: 36  VSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVE 95
           V  + +G F+ +Y V F +   ++    +  AI       LKR+++  ++ LNE+ N++ 
Sbjct: 447 VHSIGKGQFSTVYQVTFAQTNKKY----AIKAIKPNKYNSLKRILLEIKI-LNEVTNQIT 501

Query: 96  VMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL---KTKLSE 152
           + ++ K    I+ Y  S   + +         ++ ELC N +L  ++ +++   K +L +
Sbjct: 502 MDQEGKEY--IIDYISSWKFQNS-------YYIMTELCENGNLDGFLQEQVIAKKKRLED 552

Query: 153 SEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSN 212
             I KI+ ++S+ +  +H     ++H D+K  NV++    N KL D G  +         
Sbjct: 553 WRIWKIIVELSLALRFIHD-SCHIVHLDLKPANVMITFEGNLKLGDFGMATH-------- 603

Query: 213 QDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKL 260
             + +  ++       +Y APE+I    Y   + K+DI++LG+ + ++
Sbjct: 604 --LPLEDKSFENEGDREYIAPEIISDCTY---DYKADIFSLGLMIVEI 646

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 111/262 (42%), Gaps = 58/262 (22%)

Query: 39   LAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIV-----NDEMGLN---EM 90
            + +G F  +Y+      LN          +T G++  +K+V V      DE  +N    +
Sbjct: 1130 IGKGSFGAVYL-----GLN----------VTTGEMMAVKQVEVPKFGSQDETTVNNAEAL 1174

Query: 91   RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFE-----VLLLMELCPNKSLLDYMNQR 145
             +EV  +K L    NIVQY             GFE       L +E     S+   +  R
Sbjct: 1175 ISEVSTLKDLDHL-NIVQYL------------GFENKNCIYSLFLEYVAGGSVGSLI--R 1219

Query: 146  LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQC 205
            L     E  I  +   V  G++ +H   + ++HRD+K +N+L+D +   K+ D G  S+ 
Sbjct: 1220 LYGHFDEQLIRFLTTQVLEGLAYLHL--RGILHRDMKADNLLLDNDGVCKISDFG-ISRK 1276

Query: 206  SPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTT 265
            S  + SN ++ M         T  + APEM+D  +    + K DIW+LG  + ++     
Sbjct: 1277 SNNIYSNSEMTM-------RGTVFWMAPEMVDTTQGY--SAKVDIWSLGCVVLEMFAGKR 1327

Query: 266  PF---EITGQMAILHSKYDFPP 284
            P+   E+   M  +      PP
Sbjct: 1328 PWSNLEVVAAMFQIGKSKSAPP 1349

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 96/234 (41%), Gaps = 46/234 (19%)

Query: 55  YLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVE------VMKKLKSS----- 103
           YL   E+LG+ +    G +  +KR+  N    + E R + E       +KK+ S      
Sbjct: 422 YLKTGENLGAGAG---GSVRLMKRISDNQVFAVKEFRPKFEHESKRDYVKKITSEYCIGT 478

Query: 104 ----PNIVQ----YFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEI 155
               PNI+      +++N            +  +ME C      D     +  K+S  EI
Sbjct: 479 TLRHPNIISTIEIVYENN-----------RIFQVMEYCD----YDLFAIVMSNKMSYEEI 523

Query: 156 LKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDI 215
                 +  G+  +H +   L HRD+K++N +++     KL D G+    S P       
Sbjct: 524 CCCFKQILTGVEYLHSIG--LAHRDMKLDNCVINNQGIVKLIDFGAAEVFSYP----HSK 577

Query: 216 AMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEI 269
            ++  +  V + P Y APE+    +Y P     DIW++ I    ++    P++I
Sbjct: 578 TLIESSGIVGSDP-YLAPEVCIFTKYDP--RPVDIWSVAILFACMVLKKFPWKI 628

>Scas_690.13
          Length = 354

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 116/271 (42%), Gaps = 48/271 (17%)

Query: 31  HRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEM 90
           H  +++  L  G F ++++V+ V         G   AI V     LK+  V   M   E 
Sbjct: 42  HDFQVMRTLGTGSFGRVHLVRSVHN-------GRYYAIKV-----LKKQQVV-RMKQIEH 88

Query: 91  RNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYM--NQRLKT 148
            N+   M KL   P +++ + +    R        + ++M+      L   +  +QR   
Sbjct: 89  TNDERRMLKLVEHPFLIRMWGTFQDSRN-------LFMVMDYIEGGELFSLLRKSQRFPN 141

Query: 149 KLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPP 208
            +++        +V++G+  +H     +I+RD+K EN+L+D N + K+ D G   +    
Sbjct: 142 PVAKFYAA----EVTLGLEYLH--SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVD-- 193

Query: 209 MMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFE 268
                     T    +   P Y APE+I      P N+  D W+LG+ ++++L   TPF 
Sbjct: 194 ----------TVTWTLCGPPDYIAPEVIATK---PYNKSVDWWSLGVLIFEMLAGYTPFY 240

Query: 269 ITGQM----AILHSKYDFPPNKYSSKIINLI 295
            T  M     IL  K  + P  +   +++L+
Sbjct: 241 DTTPMKTYEKILQGKVVY-PTFFHPDVVDLL 270

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 84/187 (44%), Gaps = 22/187 (11%)

Query: 125 EVLLLMELCPNKSLLDYMNQR-LKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKI 183
           E L L+  C N   L Y  QR  +  LS S       ++   +  +H +D  +I+RD+K 
Sbjct: 441 EKLYLVLACINGGELFYHLQREGRFDLSRSRFYAA--ELLCALDTLHKMD--VIYRDLKP 496

Query: 184 ENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLP 243
           EN+L+D   +  LCD G    C   M                 TP+Y APE++    Y  
Sbjct: 497 ENILLDYQGHIALCDFG---LCKLNMKDEDKTDTFC------GTPEYLAPELLLGQGY-- 545

Query: 244 INEKSDIWALGIFLYKLLFYTTPF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIML 299
            ++  D W LG+ LY++L    P+  E   +M   IL     F P+ +     +L+I +L
Sbjct: 546 -SKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVF-PDGFDRDAKDLLIGLL 603

Query: 300 AENPNLR 306
           + +P  R
Sbjct: 604 SRDPQRR 610

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 111/247 (44%), Gaps = 33/247 (13%)

Query: 74  ACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELC 133
             +K++   DE  LNE   E++++K L+   NIV+Y       R   +   E+ +++E C
Sbjct: 36  CAIKQIEFEDESELNEHMLEIDLLKNLRHQ-NIVEY-------RGFIQKAHELYIILEYC 87

Query: 134 PNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN 193
              SL D +       L E + +  +     G+  +H  +Q +IHRDIK  N+L+     
Sbjct: 88  ARGSLRDILKH---GPLLEDDTVNYVTQTLYGLQYLH--EQGVIHRDIKAANLLLTEEGI 142

Query: 194 FKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWAL 253
            KL D G +++ +   M+               +P + APE++       +   SDIW+L
Sbjct: 143 VKLADFGVSTRINRMAMTYAG------------SPNWMAPEVMTGQGASTV---SDIWSL 187

Query: 254 GIFLYKLLFYTTPFE----ITGQMAILHSKYDFPPNKYSSKIINLIIIMLAENPNLRPNI 309
           G  + +LL    PF      +   AI++ +Y  PP   S++  + +     +N   R   
Sbjct: 188 GATVVELLTGNPPFHNLVNESACYAIVNEEY-IPPLTLSAECKDFLSRCFQKNMFKRATA 246

Query: 310 FQVVYHI 316
            +++ HI
Sbjct: 247 QELLAHI 253

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 21/128 (16%)

Query: 161 DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQ 220
           +V + +  +H   + +I+RD+K EN+L+D N + KL D G             D+     
Sbjct: 251 EVCLALEYLH--SKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVP-------DVTYT-- 299

Query: 221 NIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPF----EITGQMAIL 276
              +  TP Y APE++      P N+  D W+ G+ +Y++L   TPF     I     IL
Sbjct: 300 ---LCGTPDYIAPEVVSTK---PYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENIL 353

Query: 277 HSKYDFPP 284
           ++   FPP
Sbjct: 354 NAPVRFPP 361

>Scas_610.7
          Length = 668

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 92/210 (43%), Gaps = 29/210 (13%)

Query: 75  CLKRVIVNDEMGLNEM--RNEVEVMKKLKSSPNIVQYF--------DSNASRRTDGKPGF 124
            +K+++VN E  L  +  + E+ ++K+L    NI++          DS++SR  + K   
Sbjct: 99  AMKKILVNVEKDLFPITAQREIVILKRLNHK-NIIKLIEMVYDYAPDSSSSRAAEVK-SL 156

Query: 125 EVLLLMELCPNKS---LLDYMNQRL-------KTKLSESEILKIMYDVSIGISNMHYLDQ 174
                    P+K    +L YM   L       +  L   +I  IM  V  G++ +H   Q
Sbjct: 157 STAAGPPASPSKHFYMILPYMVADLSGILHNPRITLEMPDIKNIMLQVLEGVNYIHC--Q 214

Query: 175 PLIHRDIKIENVLVDANNNFKLCDMG--STSQCSPPMMSNQDIA-MMTQNIYVHTTPQYR 231
             +HRDIK  N+L+D N   KL D G   T   SPP +     A    +   V  T  YR
Sbjct: 215 KFMHRDIKAANILIDHNGILKLADFGLARTYYGSPPNLKYPGGAGSGAKYTSVVVTRWYR 274

Query: 232 APEMIDLYRYLPINEKSDIWALGIFLYKLL 261
           APE++   ++       DIW +G    +L 
Sbjct: 275 APELVLGDKHY--TTAVDIWGVGCVFAELF 302

>Kwal_26.8703
          Length = 444

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 92/208 (44%), Gaps = 38/208 (18%)

Query: 102 SSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRL---KTKLSESEILKI 158
           SS  IV+Y+   A   T       + + ME    KSL D + + L     ++ E  + KI
Sbjct: 212 SSEYIVRYYGMFAEESTS-----SIYIAMEYMGGKSL-DAIYKHLLERGGRIGEKVLGKI 265

Query: 159 MYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMM 218
              V  G+S +   ++ +IHRDIK +N+L++     KLCD G +            +A+ 
Sbjct: 266 AESVLKGLSYLQ--ERKIIHRDIKPQNILLNEAGQVKLCDFGVSG-----------VAVN 312

Query: 219 TQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAILHS 278
           +       T  Y APE I   +  P +  SD+W+LG+ L ++     PF      A    
Sbjct: 313 SLATTFTGTSFYMAPERI---QGQPYSVTSDVWSLGLTLLEVAQGQFPFGSDNMAA---- 365

Query: 279 KYDFPPNKYSSKIINLIIIMLAENPNLR 306
             + PP       I L++++L   P L+
Sbjct: 366 --NMPP-------IELLMLILTFTPALK 384

>Scas_717.69
          Length = 674

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 86/186 (46%), Gaps = 20/186 (10%)

Query: 125 EVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIE 184
           E L L+  C N   L Y  Q+ + +   S       ++   +  +H LD  +I+RD+K E
Sbjct: 416 EKLYLVLACINGGELFYHLQK-EGRFELSRARFYTAELLCALETLHNLD--VIYRDLKPE 472

Query: 185 NVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPI 244
           N+L+D   +  LCD G         M +QD     +      TP+Y APE++    Y   
Sbjct: 473 NILLDYQGHIALCDFG----LCKLNMKDQD-----KTDTFCGTPEYLAPELLLNQGY--- 520

Query: 245 NEKSDIWALGIFLYKLLFYTTPF--EITGQM--AILHSKYDFPPNKYSSKIINLIIIMLA 300
           ++  D W LGI LY++L    P+  E   +M   IL     FP   +     +L+I +L+
Sbjct: 521 SKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDPLRFPEG-FDRDAKDLLIGLLS 579

Query: 301 ENPNLR 306
            +P+ R
Sbjct: 580 RDPDRR 585

>ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH]
           (1263082..1265541) [2460 bp, 819 aa]
          Length = 819

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/274 (22%), Positives = 109/274 (39%), Gaps = 58/274 (21%)

Query: 24  QMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN- 82
           Q+I+V     E V  L  GG +++Y V+                 +   I  LKRV  + 
Sbjct: 483 QVITVNGSEYEKVELLGRGGSSKVYKVRN----------------SSNRIYALKRVSFDE 526

Query: 83  -DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDY 141
            D+   +  + E+E++KKL++   +V+  D   +          VL ++  C +  L   
Sbjct: 527 FDDASADGFKGEIELLKKLENQTRVVKLIDHEMNH--------GVLYVVMECGDHDLSQV 578

Query: 142 MNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGS 201
           + QR    L    +     ++   +  +H  D  ++H D+K  N  V      K+ D G 
Sbjct: 579 LAQRSSMPLDIEFVRYHAQEMLKCVKVVH--DAGIVHSDLKPAN-FVFVKGILKIIDFG- 634

Query: 202 TSQCSPPMMSNQDIAMMTQNIYVHT---TPQYRAPEMIDLYRY---------------LP 243
                   ++N  +   T NIY  T   TP Y APE +    Y                 
Sbjct: 635 --------IANA-VPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWK 685

Query: 244 INEKSDIWALGIFLYKLLFYTTPF-EITGQMAIL 276
           + + SDIW+ G  +Y++++   P+    GQ  +L
Sbjct: 686 VGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLL 719

>CAGL0C02893g complement(286017..287966) similar to tr|Q08732
           Saccharomyces cerevisiae YOR267c, hypothetical start
          Length = 649

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 19/166 (11%)

Query: 104 PNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVS 163
           PN+++  D  +  + +    +EV   M+ CP    +D+    +  K+S  EI   +  ++
Sbjct: 275 PNVIETVDVFSDSKQNKY--YEV---MQYCP----IDFFAVVMTGKMSRGEINCCLKQLT 325

Query: 164 IGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIY 223
            G+  +H +   L HRD+K++N ++ A+   KL D GS      P    +D   M   I 
Sbjct: 326 EGVRYLHSMG--LAHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPF---EDDVTMAHGI- 379

Query: 224 VHTTPQYRAPEMIDLYR-YLPINEKSDIWALGIFLYKLLFYTTPFE 268
           V + P Y APE+I   + Y P  +  DIW++GI    ++    P++
Sbjct: 380 VGSDP-YLAPEVITSTKSYDP--QCVDIWSIGIIYCCMMLKRFPWK 422

>Kwal_47.17252
          Length = 872

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 115/271 (42%), Gaps = 55/271 (20%)

Query: 39  LAEGGFAQIYVVKFVEY--LNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEV 96
           + +G FA +Y  +      LN+F +           I  + R  + ++  L  +  E+ +
Sbjct: 26  IGKGSFATVYKGRIASNRDLNDFIA-----------IKAVSRSKLKNKKLLENLEIEIAI 74

Query: 97  MKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQR---------LK 147
           +KK+K  P+IV   D         + G +  L+ME C    L   + +R         ++
Sbjct: 75  LKKIKH-PHIVGLMDCE-------RTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVR 126

Query: 148 TKL------SES-----EILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL-----VDAN 191
           T        SES      ++ + Y   +  + M    + L+HRDIK +N+L     V+ +
Sbjct: 127 TMFEKYPPPSESHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYS 186

Query: 192 NNFKLCDMGSTSQCSPPMMSNQDI--AMMTQNIYVHTT----PQYRAPEMIDLYRYLPIN 245
           +      MG     + P++   D   A    N  +  T    P Y APE++D  +Y   N
Sbjct: 187 DRETFHKMGFVGIYNLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILDYQKY---N 243

Query: 246 EKSDIWALGIFLYKLLFYTTPFEITGQMAIL 276
            K+D+W++G  LY++     PF+ +  + + 
Sbjct: 244 AKADLWSVGTVLYEMCCGRPPFKASNHLELF 274

>Kwal_26.8941
          Length = 661

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 67/141 (47%), Gaps = 14/141 (9%)

Query: 129 LMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLV 188
           +ME CP    +D+    +   +S  EI   +  +S G+  +H +   L HRD+K++N ++
Sbjct: 211 VMEYCP----IDFFAVVMSGNMSRGEINCCLRQLSEGVRYLHNMG--LAHRDLKLDNCVM 264

Query: 189 DANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPE-MIDLYRYLPINEK 247
             +   KL D GS      P  S+     M   I V + P Y APE M    RY P  + 
Sbjct: 265 TCDGILKLIDFGSAVVFKYPFDSS---VTMAHGI-VGSDP-YLAPEVMTSTKRYDP--QF 317

Query: 248 SDIWALGIFLYKLLFYTTPFE 268
            DIW++GI    ++    P++
Sbjct: 318 VDIWSIGIIYCCMMLKRFPWK 338

>Kwal_55.22001
          Length = 363

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 99/206 (48%), Gaps = 36/206 (17%)

Query: 93  EVEVMKKLKSSPNIV--QYFDSNASRRTDGKPGFEVLLLMELCPNKSLLD---YMNQRLK 147
           E+E+++ +   PN+V  +YF ++ S + D K      L ME  P    L+   Y + +L+
Sbjct: 71  ELEILR-IADHPNVVKLEYFFTHTSPQ-DNK--LYQHLAMECLPETLQLEIHRYASNKLE 126

Query: 148 TKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNN-FKLCDMGSTSQCS 206
             L  +++    Y ++ G+  +H L   + HRDIK  NVLVD N    K+CD GS  +  
Sbjct: 127 LPLKHTKLYT--YQIARGMLYLHALG--ICHRDIKPSNVLVDPNTGVLKICDFGSAKK-- 180

Query: 207 PPMMSNQ-DIAMMTQNIYVHTTPQYRAPEMI-DLYRYLPINEKSDIWALGIFLYKLLFYT 264
             +  NQ  I+ +           YRAPE+I    +Y     + DIW LG  + ++L   
Sbjct: 181 --LEQNQPSISYICSRF-------YRAPELIVGCTQY---TTQIDIWGLGCVMGEMLIGK 228

Query: 265 TPFEITGQMAILH----SKYDFPPNK 286
             F+  GQ  +L     SK   PP+K
Sbjct: 229 AVFQ--GQEPLLQLREISKLLGPPDK 252

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 78/169 (46%), Gaps = 31/169 (18%)

Query: 125 EVLLLMELCPNKSLLDYMNQR------LKTKLSESEILKIMYDVSIGISNMHYLDQPLIH 178
           E L L+  C N   L +  QR       + +   SE+L       + + ++H +D  +++
Sbjct: 448 EKLYLVLACINGGELFHHLQREGIFDISRARFYASELL-------LALDSLHKMD--VVY 498

Query: 179 RDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDL 238
           RD+K EN+L+D+  +  LCD G    C   M  N+  +          TP+Y APE++  
Sbjct: 499 RDLKPENILLDSQGHIALCDFG---LCKLNMKDNEKTSTFCG------TPEYLAPEVLLG 549

Query: 239 YRYLPINEKSDIWALGIFLYKLLFYTTPF--EITGQM--AILHSKYDFP 283
             Y  +    D W LG+ LY++L    P+  E   +M   IL S   FP
Sbjct: 550 KGYTKV---VDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLIFP 595

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 32,832,318
Number of extensions: 1532592
Number of successful extensions: 7670
Number of sequences better than 10.0: 796
Number of HSP's gapped: 7159
Number of HSP's successfully gapped: 851
Length of query: 1012
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 900
Effective length of database: 12,718,893
Effective search space: 11447003700
Effective search space used: 11447003700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)