Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10164g48447721130.0
YBR057C (MUM2)3661443822e-41
ABL103W3171803722e-40
KLLA0F18722g2701813586e-39
Kwal_56.230803141453493e-37
Scas_661.252251452194e-20
Scas_718.502361632011e-17
AEL341W393151780.18
Scas_717.75429115711.3
CAGL0D05258g1170134692.4
Sklu_2412.7112746692.5
CAGL0F03113g64740656.4
Scas_676.1269877657.0
KLLA0C09328g770120649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10164g
         (477 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10164g complement(991125..992579) weakly similar to sp|P38...   818   0.0  
YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein req...   151   2e-41
ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH] complement(2...   147   2e-40
KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236 Saccha...   142   6e-39
Kwal_56.23080                                                         139   3e-37
Scas_661.25                                                            89   4e-20
Scas_718.50                                                            82   1e-17
AEL341W [2164] [Homologous to ScYAL012W (CYS3) - SH] complement(...    35   0.18 
Scas_717.75                                                            32   1.3  
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    31   2.4  
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          31   2.5  
CAGL0F03113g 304124..306067 similar to sp|Q04053 Saccharomyces c...    30   6.4  
Scas_676.12                                                            30   7.0  
KLLA0C09328g complement(812817..815129) similar to sp|P40511 Sac...    29   9.2  

>CAGL0H10164g complement(991125..992579) weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein,
           hypothetical start
          Length = 484

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/477 (85%), Positives = 410/477 (85%)

Query: 1   MSYFYNFNQGDGFANNTSMGTXXXXXXXXXXXXXXXXXXXGKAHTQFGSGQTYIAXXXXX 60
           MSYFYNFNQGDGFANNTSMGT                   GKAHTQFGSGQTYIA     
Sbjct: 1   MSYFYNFNQGDGFANNTSMGTQDQSAFQNQNQNQVQNQSQGKAHTQFGSGQTYIASSMLN 60

Query: 61  XXXXXXXXXXXEKNVNSPQDASAYANYFQPLQNAFNSSPGFQTVTQNNLATDYSYSHANS 120
                      EKNVNSPQDASAYANYFQPLQNAFNSSPGFQTVTQNNLATDYSYSHANS
Sbjct: 61  GMSGSSYSGNYEKNVNSPQDASAYANYFQPLQNAFNSSPGFQTVTQNNLATDYSYSHANS 120

Query: 121 NGNNQIASSGSXXXXXXXXXAYNVSTNNDRFPKMTSDLTHMTSQQSRYPNTTSDKGVDDQ 180
           NGNNQIASSGS         AYNVSTNNDRFPKMTSDLTHMTSQQSRYPNTTSDKGVDDQ
Sbjct: 121 NGNNQIASSGSTDTTTTDTTAYNVSTNNDRFPKMTSDLTHMTSQQSRYPNTTSDKGVDDQ 180

Query: 181 LFTSRYNSMGXXXXXXXXXXXPAKQDNASYLGQVNYNGIPSNRNYTASSTTHSAMLGNSF 240
           LFTSRYNSMG           PAKQDNASYLGQVNYNGIPSNRNYTASSTTHSAMLGNSF
Sbjct: 181 LFTSRYNSMGTLTSTSTISSIPAKQDNASYLGQVNYNGIPSNRNYTASSTTHSAMLGNSF 240

Query: 241 TSDAVTGYYYPTNRETNKQGLINSTKLPSRYSGSDNGQVYNNATTFDATQSSQPSNCSAT 300
           TSDAVTGYYYPTNRETNKQGLINSTKLPSRYSGSDNGQVYNNATTFDATQSSQPSNCSAT
Sbjct: 241 TSDAVTGYYYPTNRETNKQGLINSTKLPSRYSGSDNGQVYNNATTFDATQSSQPSNCSAT 300

Query: 301 VNPKEPKESSGEIDTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEE 360
           VNPKEPKESSGEIDTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEE
Sbjct: 301 VNPKEPKESSGEIDTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEE 360

Query: 361 HITTKEIDVPNSLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYD 420
           HITTKEIDVPNSLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYD
Sbjct: 361 HITTKEIDVPNSLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYD 420

Query: 421 PENLAHKTVVRLETLTKENQEMARMLSFGRAKEKHIAXXXXXXXXXXXXTQIIQLKE 477
           PENLAHKTVVRLETLTKENQEMARMLSFGRAKEKHIA            TQIIQLKE
Sbjct: 421 PENLAHKTVVRLETLTKENQEMARMLSFGRAKEKHIALELLKKENKDLKTQIIQLKE 477

>YBR057C (MUM2) [247] chr2 complement(352153..353253) Protein
           required for premeiotic DNA synthesis and sporulation
           [1101 bp, 366 aa]
          Length = 366

 Score =  151 bits (382), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 107/144 (74%), Gaps = 2/144 (1%)

Query: 313 IDTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNS 372
           ++ L+ ++Q+K++Q++SL+ E+ RLK   +  + N K    K   +  HI  +  ++P S
Sbjct: 190 MEALEVELQIKESQIESLENEIQRLKKIFNEGL-NYKQNEHKYEKENCHIP-QTFELPAS 247

Query: 373 LDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRL 432
           L++IFRKLSS+L  +EKEL ETK NLES+L A+ALNP+NS TK+GRYD E++AHK VVRL
Sbjct: 248 LEVIFRKLSSSLHAKEKELAETKENLESILTALALNPTNSVTKYGRYDAESIAHKMVVRL 307

Query: 433 ETLTKENQEMARMLSFGRAKEKHI 456
           E LT EN+EMA+ML++GR+KE  I
Sbjct: 308 ENLTNENKEMAKMLAYGRSKETQI 331

>ABL103W [489] [Homologous to ScYBR057C (MUM2) - SH]
           complement(205068..206021) [954 bp, 317 aa]
          Length = 317

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 125/180 (69%), Gaps = 17/180 (9%)

Query: 283 ATTFDATQSSQPSNCSATVNPKEPKESSGE-IDTLKYDIQVKDAQLQSLQRELTRLKSAI 341
           +TTF AT SSQ SN         P   S E +++L+ ++Q+K+ Q++SL+ E+T+LKS  
Sbjct: 119 STTF-ATTSSQQSN---------PSHGSLESMESLRLELQLKETQIESLEDEITKLKSIF 168

Query: 342 SVAVDNTKDISSKTADKEEHITTKEID-----VPNSLDIIFRKLSSALQKREKELDETKT 396
           +  +   K    +   ++ H    ++D     +P +L+IIF KL+++L+++++EL++T+ 
Sbjct: 169 NQGL-TFKQQEQQLQKRKLHQHALDLDHMPVEIPANLEIIFNKLATSLKRKDEELEDTRK 227

Query: 397 NLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRLETLTKENQEMARMLSFGRAKEKHI 456
            LES++ A+ALNPSNS T+FGRYD E LAHK +VRLE LTKENQEMA++LS+GR+KE HI
Sbjct: 228 RLESIMTAIALNPSNSVTRFGRYDEEALAHKMIVRLEMLTKENQEMAKLLSYGRSKETHI 287

>KLLA0F18722g 1721734..1722546 weakly similar to sp|P38236
           Saccharomyces cerevisiae YBR057c MUM2 meiotic protein
           singleton, hypothetical start
          Length = 270

 Score =  142 bits (358), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 112/181 (61%), Gaps = 6/181 (3%)

Query: 277 GQVYNNATTFDATQSSQPSNCSATVNPK-EPKESSGEIDTLKYDIQVKDAQLQSLQRELT 335
           G   NN    D +  ++ S  + T + + EP       D  K ++Q+K+ Q++SL+ E+ 
Sbjct: 72  GSSSNNTVIMDRSSYAKSSGFNTTFDSETEPSS-----DNFKLELQLKETQIESLEIEIK 126

Query: 336 RLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDIIFRKLSSALQKREKELDETK 395
           +LK   +  +   +    K    +      EI +P SL+IIF KLS +L+++++EL ETK
Sbjct: 127 KLKEVFNQGLTFKQQEEQKMKKSKALTFDSEIQIPASLEIIFCKLSDSLKRKDQELQETK 186

Query: 396 TNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRLETLTKENQEMARMLSFGRAKEKH 455
             LE ++ A+ALNPSNS+TKFGRYD E LAHK V RLETL KEN+EMA+MLS+GR KE  
Sbjct: 187 RRLEGIVTAVALNPSNSTTKFGRYDEEALAHKMVTRLETLMKENEEMAKMLSYGRVKETS 246

Query: 456 I 456
           I
Sbjct: 247 I 247

>Kwal_56.23080
          Length = 314

 Score =  139 bits (349), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 102/145 (70%), Gaps = 6/145 (4%)

Query: 314 DTLKYDIQVKDAQLQSLQRELTRLKSAIS--VAVDNTKDISSKTADKEEHITTKEIDVPN 371
           ++++ ++Q+K+ Q++SL+ E+  LK   +  + +    D+ + +           ++VP 
Sbjct: 148 ESMQLELQLKETQIESLEVEIQSLKLIFNDGLRLRQEHDLRALSGPA----INASVEVPA 203

Query: 372 SLDIIFRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVR 431
           SL+ IF+KLSS L  ++KELDETK  LES++ A+ALNPSN+ TK GRYD E LAHK VVR
Sbjct: 204 SLEAIFQKLSSTLATKDKELDETKKRLESIVTAVALNPSNTVTKLGRYDEEALAHKMVVR 263

Query: 432 LETLTKENQEMARMLSFGRAKEKHI 456
           LETLTKENQ+MA+ML +GR+KE HI
Sbjct: 264 LETLTKENQDMAKMLGYGRSKENHI 288

>Scas_661.25
          Length = 225

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 84/145 (57%), Gaps = 23/145 (15%)

Query: 320 IQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDII--- 376
           + +K+ QL SLQ E+  LKS +   V   +               K +D PNS +++   
Sbjct: 69  LSIKETQLSSLQIEMDHLKSILKERVQEQQ---------------KSVDDPNSHELLNVT 113

Query: 377 -----FRKLSSALQKREKELDETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVR 431
                F +L+S LQ +E+E+ + +   ES+L A+AL+P+N    +G+ D E ++ K V +
Sbjct: 114 NHELLFTRLNSLLQDKEREIKDIRFKYESMLTALALDPANPMKSYGQLDVEMISQKMVTQ 173

Query: 432 LETLTKENQEMARMLSFGRAKEKHI 456
           LETLTKENQEM+++L+F  +K K+I
Sbjct: 174 LETLTKENQEMSKLLNFEVSKSKNI 198

>Scas_718.50
          Length = 236

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/163 (34%), Positives = 83/163 (50%), Gaps = 15/163 (9%)

Query: 316 LKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDI 375
           L+  + VKD Q++SL+ E+  LK  + +  + T+    K  D +         +      
Sbjct: 84  LQEKLNVKDIQIESLENEIQNLKKILQLNPNGTR----KGDDDK---------ISKHYGP 130

Query: 376 IFRKLSSALQKREKELDETKTNLESVL--AAMALNPSNSSTKFGRYDPENLAHKTVVRLE 433
           IF  L S+L +R +E +  K + E +    AM L+ SNS TK GRYD E +AHK ++R E
Sbjct: 131 IFTNLVSSLLERNEEYESLKRDYEELYLKVAMNLDGSNSITKDGRYDTETIAHKMLIRFE 190

Query: 434 TLTKENQEMARMLSFGRAKEKHIAXXXXXXXXXXXXTQIIQLK 476
            LTKEN  MA+MLS+GR  E  I              +I QL+
Sbjct: 191 MLTKENSRMAKMLSYGRPMETDIELQLVEMENQELKERIKQLE 233

>AEL341W [2164] [Homologous to ScYAL012W (CYS3) - SH]
           complement(9428..10609) [1182 bp, 393 aa]
          Length = 393

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 60/151 (39%), Gaps = 35/151 (23%)

Query: 205 QDNASYLGQ------VNYNGIPSNRNYTASSTTHSAMLGNSFTSDAVTGYYYPTNRETNK 258
           Q  A YL Q      VNY G+PS+R Y  +   H   LG    S  V G           
Sbjct: 264 QKIAEYLEQSEHVVSVNYPGLPSHRGYQIAQKQHRDGLGGGMISFRVKG---------GA 314

Query: 259 QG---LINSTKLPSRYSGSDNGQVYNNATTFDATQS--SQPSNCSATVNPKEPKESSGEI 313
           QG   L  ST+L            +  A +    +S    P+  +    PKE +E+SG  
Sbjct: 315 QGAALLSQSTRL------------FTLAESLGGIESLLEVPAVMTHAGIPKEAREASGVY 362

Query: 314 DTL---KYDIQVKDAQLQSLQRELTRLKSAI 341
           D L      I+  D  L+ +++ L+ +  +I
Sbjct: 363 DDLVRVSVGIEDTDDLLEDIKQALSVVAESI 393

>Scas_717.75
          Length = 429

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 21/115 (18%)

Query: 214 VNYNGIPSNRNYTASSTTHSAMLGNSFTSDAVTGYYYPTNRETNKQGLINSTKLPSRYSG 273
           VNY G+P++ NY      H   LG    S  + G                 ++  S++S 
Sbjct: 316 VNYPGLPTHENYAVVQKQHREALGGGMISFRIQG----------------GSEAASKFSS 359

Query: 274 SDNGQVYNNATTFDATQS--SQPSNCSATVNPKEPKESSGEIDTL-KYDIQVKDA 325
           S   +++  A +    +S    P+  +    PKE +E+SG  D L +  + ++D 
Sbjct: 360 ST--RLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGVYDDLVRLSVGIEDG 412

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
           cerevisiae YFR031c SMC2 chromosome segregation protein,
           start by similarity
          Length = 1170

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 25/134 (18%)

Query: 268 PSRYSGSDNGQVYNNATTF-DATQSSQPSNCSATVNPKEPKESSGEIDTLKYDI----QV 322
           PS    + NG++ N   T  D+T+     N S             EI+ L+ D+    + 
Sbjct: 739 PSLMMQNRNGEIENEVKTLEDSTKQKMLENSSL----------EAEIEKLRKDMVDFSKN 788

Query: 323 KDAQLQSLQRELTRLKSAISVAVDNTKDISS---KTADKEEHITTKEIDVPNSLDIIFRK 379
           K A+L+ L+ E+  L   I       KD+ S   K  D  E I  +   + N +D   + 
Sbjct: 789 KGAKLKELKAEVHELNEQI-------KDLESESEKLNDTYEKIKVETEQIANEIDTDTKS 841

Query: 380 LSSALQKREKELDE 393
           L S +Q  EK+L+E
Sbjct: 842 LDSTVQDIEKKLEE 855

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 296 NCSATVNPKEP---KESSGEIDTLKYDIQVKDAQLQSLQRELTRLK 338
           NC  +++PK     KE  GE+  + YD   K +++ SL + L +L+
Sbjct: 920 NCRESIDPKRLLTLKERGGEVSVVHYDTSSKSSKICSLLKHLKQLQ 965

>CAGL0F03113g 304124..306067 similar to sp|Q04053 Saccharomyces
           cerevisiae YDR425w, hypothetical start
          Length = 647

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 25/40 (62%)

Query: 326 QLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHITTK 365
           +++ LQREL +L+    + + + +D++  T    EH++TK
Sbjct: 574 EIKILQRELDKLEDVQKLVLRDIEDVNESTLRSLEHVSTK 613

>Scas_676.12
          Length = 698

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 2/77 (2%)

Query: 305 EPKESSGEI--DTLKYDIQVKDAQLQSLQRELTRLKSAISVAVDNTKDISSKTADKEEHI 362
           EP+ ++ +I  + LK ++Q   + L++ QRE + L+  I      T ++  K  + EE+I
Sbjct: 255 EPEANTKKIKVEQLKNNLQALKSMLETKQRETSTLEEQIEQKKLKTTEVVQKRQELEEYI 314

Query: 363 TTKEIDVPNSLDIIFRK 379
              E+D+    +I+ ++
Sbjct: 315 KNTELDLREINEILIKE 331

>KLLA0C09328g complement(812817..815129) similar to sp|P40511
           Saccharomyces cerevisiae YIL073c SPO22 singleton, start
           by similarity
          Length = 770

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 295 SNCSATVN--PKEPKESSGEIDTLKYDIQVKDAQLQSLQR--ELTRLKSAISVAVDNTKD 350
           S+C   +   PKE  +   ++    ++I+     L+ L R      LK +    +   KD
Sbjct: 505 SDCKLYLEYIPKEELDDHKKLYYRYWEIRTDVLSLELLHRTSNWISLKESSLALIAQNKD 564

Query: 351 ISSKTADKEEHITTKEIDVPNS-LDIIFRKLSSALQKREKELDETKTNLESVLAAMALNP 409
             + + DKE+ + T E +V N+ +DII R   +A+   +  L      L+ +L A A NP
Sbjct: 565 FFNTSKDKEQSVLTSE-EVHNTFIDIIVRSFEAAMNLGDLLL------LKHILDATATNP 617

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.121    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,005,421
Number of extensions: 575059
Number of successful extensions: 2494
Number of sequences better than 10.0: 162
Number of HSP's gapped: 2445
Number of HSP's successfully gapped: 184
Length of query: 477
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 372
Effective length of database: 12,961,219
Effective search space: 4821573468
Effective search space used: 4821573468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)