Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H10142g37236619560.0
Scas_661.2437236617560.0
Sklu_2360.537236617510.0
YDR035W (ARO3)37036617120.0
Kwal_56.2307937236617020.0
KLLA0F18744g37236616790.0
ABL102C37336615920.0
Scas_597.1337235311281e-154
AFL047W36436111261e-154
YBR249C (ARO4)37035311121e-152
CAGL0C01573g35635311071e-151
Sklu_1187.136835311081e-151
Kwal_14.155436435310941e-149
KLLA0F06556g36435310851e-148
Scas_26.11831678141e-109
AFR270W381107910.003
Kwal_33.13646125353710.98
Scas_689.51294204682.1
KLLA0D14927g50763672.3
YCR033W (SNT1)122648682.5
Kwal_47.19034103366654.4
CAGL0L08162g135647654.8
CAGL0B02926g61881637.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H10142g
         (366 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H10142g 989652..990770 highly similar to sp|P14843 Saccharo...   758   0.0  
Scas_661.24                                                           681   0.0  
Sklu_2360.5 YDR035W, Contig c2360 14257-15375                         679   0.0  
YDR035W (ARO3) [888] chr4 (521811..522923) 2-Dehydro-3-deoxyphos...   664   0.0  
Kwal_56.23079                                                         660   0.0  
KLLA0F18744g complement(1723008..1724126) highly similar to sp|P...   651   0.0  
ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH] (206411..207...   617   0.0  
Scas_597.13                                                           439   e-154
AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH] complement(...   438   e-154
YBR249C (ARO4) [428] chr2 complement(716839..717951) 2-Dehydro-3...   432   e-152
CAGL0C01573g 170694..171764 highly similar to sp|P32449 Saccharo...   431   e-151
Sklu_1187.1 YBR249C, Contig c1187 489-1595                            431   e-151
Kwal_14.1554                                                          426   e-149
KLLA0F06556g 633167..634261 highly similar to sp|P32449 Saccharo...   422   e-148
Scas_26.1                                                             318   e-109
AFR270W [3462] [Homologous to NOHBY] complement(919886..921031) ...    40   0.003
Kwal_33.13646                                                          32   0.98 
Scas_689.5                                                             31   2.1  
KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces...    30   2.3  
YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p co...    31   2.5  
Kwal_47.19034                                                          30   4.4  
CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces c...    30   4.8  
CAGL0B02926g complement(284897..286753) weakly similar to DEHA0D...    29   7.9  

>CAGL0H10142g 989652..990770 highly similar to sp|P14843
           Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase, start by
           similarity
          Length = 372

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/366 (100%), Positives = 366/366 (100%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD
Sbjct: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI
Sbjct: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA
Sbjct: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360

Query: 361 EGVRNR 366
           EGVRNR
Sbjct: 361 EGVRNR 366

>Scas_661.24
          Length = 372

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/366 (87%), Positives = 345/366 (94%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHEYPISE+G   I+ AR++VCDILNGKD
Sbjct: 1   MFIKNDHAGDRTRLEDWRIKGYDPLTPPDLLQHEYPISERGHKIIVDAREAVCDILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEYAD+LA IA  LS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADRLAKIAATLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFTKL+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAA+HEHYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFVI 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGKHGTN+DAE+V+ TK++L+K  LID  D+ RRIMIDCSHGNSNKDYRNQPKVAQ I
Sbjct: 241 LRGGKHGTNFDAESVQITKKELKKTNLIDANDTQRRIMIDCSHGNSNKDYRNQPKVAQSI 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y+QL+AGEN +CGVMIESNLVEGRQDVPPEGGR GLKYGCSITDACIGW++TE VL+ LA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGRAGLKYGCSITDACIGWESTEDVLKQLA 360

Query: 361 EGVRNR 366
           EGVRNR
Sbjct: 361 EGVRNR 366

>Sklu_2360.5 YDR035W, Contig c2360 14257-15375
          Length = 372

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/366 (87%), Positives = 345/366 (94%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKG   I+ AR+ VC+ILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEYADKLA ++EKLS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT L+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQV+IDAMRAA+H HYFLSVTKPG+TAIVGTEGNSDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHSHYFLSVTKPGITAIVGTEGNSDTFVI 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGK GTNYD+ NVK T+++L KAKL DE  + RRIMIDCSHGNS+KD+RNQPKVAQ I
Sbjct: 241 LRGGKKGTNYDSANVKETQKELIKAKLADENGTQRRIMIDCSHGNSSKDFRNQPKVAQSI 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y+QL+AGEN +CGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGW++TE VLELLA
Sbjct: 301 YDQLTAGENAICGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWESTEQVLELLA 360

Query: 361 EGVRNR 366
           +GV+NR
Sbjct: 361 KGVQNR 366

>YDR035W (ARO3) [888] chr4 (521811..522923)
           2-Dehydro-3-deoxyphosphoheptonate aldolase (DAHPS),
           inhibited by phenylalanine [1113 bp, 370 aa]
          Length = 370

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/366 (85%), Positives = 344/366 (93%), Gaps = 2/366 (0%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKND+ GDR RLEDWRIKGYDPLTPPDLLQHE+PIS KG  NI+KARDSVCDILNGKD
Sbjct: 1   MFIKNDHAGDRKRLEDWRIKGYDPLTPPDLLQHEFPISAKGEENIIKARDSVCDILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCS+HDPKAAY+YAD+LA I+EKLS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSLHDPKAAYDYADRLAKISEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           D++NSFQINKGLRISREMF KL+EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DMNNSFQINKGLRISREMFIKLVEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQVAIDAMRAA+HEHYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAAAHEHYFLSVTKPGVTAIVGTEGNKDTFLI 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGK+GTN+D E+V++TK+QL KA L D  DS +RIMIDCSHGNSNKD++NQPKVA+ I
Sbjct: 241 LRGGKNGTNFDKESVQNTKKQLEKAGLTD--DSQKRIMIDCSHGNSNKDFKNQPKVAKCI 298

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y+QL+ GEN LCGVMIESN+ EGRQD+P EGGREGLKYGCS+TDACIGW++TE VLELLA
Sbjct: 299 YDQLTEGENSLCGVMIESNINEGRQDIPKEGGREGLKYGCSVTDACIGWESTEQVLELLA 358

Query: 361 EGVRNR 366
           EGVRNR
Sbjct: 359 EGVRNR 364

>Kwal_56.23079
          Length = 372

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/366 (84%), Positives = 337/366 (92%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHE PIS KG   I+ AR+ VCDILNGKD
Sbjct: 1   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHELPISAKGHKTIVDAREQVCDILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEY D+LA  ++K + DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVIVIGPCSIHDPKAAYEYCDRLAAESKKHAKDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISRE+FT L+EK+PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISRELFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQV++DAMRAA+H HYFLSVTKPGVTAIVGTEGNSDTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVSVDAMRAAAHSHYFLSVTKPGVTAIVGTEGNSDTFVI 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGK GTNYDAENVK T+E+L KAK+ +E   TRRIMIDCSHGNS+KDYRNQPKVAQ I
Sbjct: 241 LRGGKTGTNYDAENVKKTQEELVKAKIAEENGKTRRIMIDCSHGNSSKDYRNQPKVAQSI 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y QL+ G+N +CGVMIESNLVEGRQDVP EGGREGLKYGCSITDACIGW+TTE VL LLA
Sbjct: 301 YEQLTDGQNAICGVMIESNLVEGRQDVPAEGGREGLKYGCSITDACIGWETTEEVLALLA 360

Query: 361 EGVRNR 366
           +GV+NR
Sbjct: 361 KGVQNR 366

>KLLA0F18744g complement(1723008..1724126) highly similar to
           sp|P14843 Saccharomyces cerevisiae YDR035w ARO3
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           phenylalanine-inhibited, start by similarity
          Length = 372

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/366 (83%), Positives = 333/366 (90%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFI ND+ GDR+ LEDWRIKGYDPLTPPDLLQHEYPI EK    I++AR+ VCDILNGKD
Sbjct: 1   MFITNDHIGDRSSLEDWRIKGYDPLTPPDLLQHEYPIGEKAKKIIVEAREKVCDILNGKD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+V+VIGPCSIHDPKAAYEYAD L  I+++LSDDLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLVVVIGPCSIHDPKAAYEYADLLKKISDELSDDLLIIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREMFT+L EKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMFTRLTEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDGGLQVA+DAMR+A+H HYFLSVTKPGVTAIVGTEGN DTF+I
Sbjct: 181 RELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHSHYFLSVTKPGVTAIVGTEGNEDTFVI 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGK GTN+DAENVK T+ +L KAK+ D     RRIM+DCSHGNS KD+RNQPKVAQ +
Sbjct: 241 LRGGKTGTNFDAENVKKTQAELVKAKVADAEGVQRRIMVDCSHGNSKKDFRNQPKVAQSL 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y QLSAG+N +CGVMIESNLVEGRQDVPPEGGRE L YGCSITDACIGW+TTE VL LLA
Sbjct: 301 YEQLSAGQNAICGVMIESNLVEGRQDVPPEGGREKLIYGCSITDACIGWETTEDVLRLLA 360

Query: 361 EGVRNR 366
           +GV+NR
Sbjct: 361 KGVKNR 366

>ABL102C [490] [Homologous to ScYDR035W (ARO3) - SH]
           (206411..207532) [1122 bp, 373 aa]
          Length = 373

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/366 (78%), Positives = 325/366 (88%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKN+Y GD++RLEDWRIKGYDPLTPP++LQHE P+S  G A I++AR+ V  +L+G+D
Sbjct: 1   MFIKNEYIGDKSRLEDWRIKGYDPLTPPNVLQHELPVSANGRAIIVRAREGVVQVLSGRD 60

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+++V+GPCSIHDP+AA EYA +L+ +A +L  +LL+IMRAYLEKPRTTVGWKGLINDP
Sbjct: 61  DRLLVVVGPCSIHDPEAALEYAQRLSEVASRLRGELLVIMRAYLEKPRTTVGWKGLINDP 120

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180
           DIDNSFQINKGLRISREM+T+L+E +PIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
Sbjct: 121 DIDNSFQINKGLRISREMYTQLVEHIPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH 180

Query: 181 RELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFII 240
           RELASGLSFPIGFKNGTDG LQVAIDAMRAA+H HYFLSVTKPGVTAIVGTEGN DTFII
Sbjct: 181 RELASGLSFPIGFKNGTDGCLQVAIDAMRAAAHSHYFLSVTKPGVTAIVGTEGNEDTFII 240

Query: 241 LRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEI 300
           LRGGK GTNYDA +V+  K+ L  AKL+D A   RRIMIDCSHGNSNKDYRNQPKVAQ+I
Sbjct: 241 LRGGKDGTNYDAASVQQAKQDLVNAKLVDSAGVQRRIMIDCSHGNSNKDYRNQPKVAQDI 300

Query: 301 YNQLSAGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLA 360
           Y QLS GEN +CGVMIESNLVEGRQD+P   GR GLKYGCSITDACIGWD T  VLELLA
Sbjct: 301 YEQLSKGENAICGVMIESNLVEGRQDIPEGNGRVGLKYGCSITDACIGWDQTVEVLELLA 360

Query: 361 EGVRNR 366
           +GV N+
Sbjct: 361 KGVINK 366

>Scas_597.13
          Length = 372

 Score =  439 bits (1128), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 263/353 (74%), Gaps = 10/353 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +EK      K R    +I++G+DDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLVSPALLQVQIPATEKCIETAKKGRRESIEIISGRDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA KL  +A++LS DL++IMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LDAAQEYALKLKKLADELSQDLVVIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTKLIE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 200

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG L VA+DA +AASH H+F+ VTK GV AI  T+GN   F+ILRGGK GTNYDA+
Sbjct: 201 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K QL           +  +MID SHGNSNKD+RNQPKV   +  Q++ GEN + G
Sbjct: 261 SVAEAKAQLPAG--------SNGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGENAIIG 312

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIESN+ EG Q +PPE G+ GLKYG SITDACI ++TTE VL+ LA  VR R
Sbjct: 313 VMIESNINEGSQKIPPE-GKAGLKYGVSITDACISFETTEDVLKKLAAAVRQR 364

>AFL047W [3146] [Homologous to ScYBR249C (ARO4) - SH]
           complement(351599..352693) [1095 bp, 364 aa]
          Length = 364

 Score =  438 bits (1126), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 262/361 (72%), Gaps = 11/361 (3%)

Query: 7   YRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIV 66
           +  D  + ED RI GYDPL  P LLQ + P ++       K R    DI+ GKDDR+++V
Sbjct: 7   FAADADQAEDVRILGYDPLVSPALLQSQIPATQACLETAQKGRREAIDIITGKDDRVLVV 66

Query: 67  IGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSF 126
           +GPCSIHD  AA EYA +L  +AE+L  DL+++MRAYLEKPRTTVGWKGLINDPD++N+F
Sbjct: 67  VGPCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRAYLEKPRTTVGWKGLINDPDVNNTF 126

Query: 127 QINKGLRISREMFTKLIE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELAS 185
            INKGL+ +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELAS
Sbjct: 127 NINKGLQAARQLFVNLTSIGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELAS 186

Query: 186 GLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGK 245
           GLSFPIGFKNGTDG L VA+DA++A+SH H+F+ VTK GV AI  T+GN   F+ILRGGK
Sbjct: 187 GLSFPIGFKNGTDGSLDVALDAVKASSHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGK 246

Query: 246 HGTNYDAENVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLS 305
            GTNYDA +V   K +L           T  +MID SHGNSNKD+RNQPKV + +  Q++
Sbjct: 247 RGTNYDATSVAEAKAKL---------PPTGVLMIDYSHGNSNKDFRNQPKVNEVVSEQIA 297

Query: 306 AGENGLCGVMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRN 365
            GE+ + GVMIESN+ EG Q +PPE G+ GLKYG SITD CI W+TTE VL  LA  VR 
Sbjct: 298 NGEDKIVGVMIESNINEGSQKIPPE-GKAGLKYGVSITDGCISWETTEEVLRKLAGAVRK 356

Query: 366 R 366
           R
Sbjct: 357 R 357

>YBR249C (ARO4) [428] chr2 complement(716839..717951)
           2-Dehydro-3-deoxyphosphoheptonate aldolase
           (3-deoxy-D-arabino-heptulosonate-7-phosphate synthase or
           DAHP synthase), inhibited by tyrosine [1113 bp, 370 aa]
          Length = 370

 Score =  432 bits (1112), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 258/353 (73%), Gaps = 10/353 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +        + R    DI+ GKDDR+++++GPCSIHD
Sbjct: 21  EDVRILGYDPLASPALLQVQIPATPTSLETAKRGRREAIDIITGKDDRVLVIVGPCSIHD 80

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            +AA EYA +L  ++++L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 81  LEAAQEYALRLKKLSDELKGDLSIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 140

Query: 135 SREMFTKLIE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 141 ARQLFVNLTNIGLPIGSEMLDTISPQYLADLVSFGAIGARTTESQLHRELASGLSFPVGF 200

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG L VA+DA +AA+H H+F+ VTK GV AI  T+GN   F+ILRGGK GTNYDA+
Sbjct: 201 KNGTDGTLNVAVDACQAAAHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 260

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K QL           +  +MID SHGNSNKD+RNQPKV   +  Q++ GEN + G
Sbjct: 261 SVAEAKAQLPAG--------SNGLMIDYSHGNSNKDFRNQPKVNDVVCEQIANGENAITG 312

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIESN+ EG Q +P E G+ GLKYG SITDACIGW+TTE VL  LA  VR R
Sbjct: 313 VMIESNINEGNQGIPAE-GKAGLKYGVSITDACIGWETTEDVLRKLAAAVRQR 364

>CAGL0C01573g 170694..171764 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4, start by
           similarity
          Length = 356

 Score =  431 bits (1107), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 210/353 (59%), Positives = 258/353 (73%), Gaps = 10/353 (2%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P +E       + R    +I+ G+DDR+++++GPCS+HD
Sbjct: 8   EDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKESIEIITGRDDRVLVIVGPCSVHD 67

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
             AA EYA +L  ++++L  DL I+MRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 68  LDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQS 127

Query: 135 SREMFTKLIEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 128 ARQLFVNLTNTGVPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPIGF 187

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG L VA+DA +AASH H+F+ VTK GV AI  T+GN   F+ILRGGK GTNYDA+
Sbjct: 188 KNGTDGTLGVAVDACQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKKGTNYDAK 247

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K+QL         +    +MID SHGNSNKD+RNQPKV   +  Q++ GE  + G
Sbjct: 248 SVAEAKKQL--------PEGANGLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEKAIVG 299

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIESN+ EG Q +PPE G+ GLKYG SITDACI W+TTE VL  LA  VR R
Sbjct: 300 VMIESNINEGNQCIPPE-GKAGLKYGVSITDACISWETTEDVLRKLAAAVRQR 351

>Sklu_1187.1 YBR249C, Contig c1187 489-1595
          Length = 368

 Score =  431 bits (1108), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 210/353 (59%), Positives = 259/353 (73%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P ++       + R    DI+ GKDDR+++++GPCSIHD
Sbjct: 19  EDVRILGYDPLVSPALLQSQVPATQVSLQTAQRGRKESIDIITGKDDRVLVIVGPCSIHD 78

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            + A EY  +L  ++++L  DL IIMRAYLEKPRTTVGWKGLINDPD++N+F INKGL+ 
Sbjct: 79  LELAQEYGTRLKKLSDELQGDLCIIMRAYLEKPRTTVGWKGLINDPDVNNTFNINKGLQY 138

Query: 135 SREMFTKLIE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    +PI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFPIGF
Sbjct: 139 ARQLFVNLTSLGVPIGSEMLDTISPQYLTDLLSFGAIGARTTESQLHRELASGLSFPIGF 198

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG L VA+DA++AASH H+F+ VTK GV AI  T+GN   FIILRGGK GTNYDA+
Sbjct: 199 KNGTDGTLGVALDAVKAASHSHHFMGVTKHGVAAITTTKGNEHCFIILRGGKKGTNYDAQ 258

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K QL           T  +M+D SHGNSNKD+RNQPKV   +  Q++ GE+ + G
Sbjct: 259 SVAEAKAQL---------PPTGALMVDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 309

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIES++ EG+Q +PPE G+ GLKYG SITD CIGW++TE VL  LA  VR R
Sbjct: 310 VMIESHINEGQQSIPPE-GKAGLKYGVSITDGCIGWESTEQVLRKLAAAVRQR 361

>Kwal_14.1554
          Length = 364

 Score =  426 bits (1094), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/353 (58%), Positives = 255/353 (72%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI G DPL  P LLQ + P + +    + K R     I+ G+DDR+++++GPCSIHD
Sbjct: 14  EDVRILGLDPLVSPALLQSQIPATPECLRTVQKGRVGASKIIMGEDDRLLVIVGPCSIHD 73

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
              A EYA +L  +A++L  +L IIMRAYLEKPRTTVGWKGLINDPD++NSF INKGL+ 
Sbjct: 74  LDLAQEYARRLKKVADELEGELCIIMRAYLEKPRTTVGWKGLINDPDVNNSFNINKGLQC 133

Query: 135 SREMFTKLIEK-LPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           +R++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 134 ARQLFVNLTSAGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 193

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG + VAIDAM AASH H+F+ VTK G  AI  T+GN   F+ILRGG  GTNYDA+
Sbjct: 194 KNGTDGTMGVAIDAMLAASHSHHFMGVTKHGFAAITTTKGNEHCFVILRGGTKGTNYDAK 253

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K QL              +M+DCSHGNSNKDYRNQPKV   +  Q++ GE+ + G
Sbjct: 254 SVAEAKAQLPPGG---------TLMVDCSHGNSNKDYRNQPKVNDAVCEQVANGEDKIIG 304

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIES++ EG+Q +PPE G+ GLKYG SITD CIGW+TTE VL  L+  V+ R
Sbjct: 305 VMIESHINEGKQSIPPE-GKAGLKYGVSITDGCIGWETTEEVLRKLSNAVKQR 356

>KLLA0F06556g 633167..634261 highly similar to sp|P32449
           Saccharomyces cerevisiae YBR249c ARO4
           2-dehydro-3-deoxyphosphoheptonate aldolase,
           tyrosine-inhibited, start by similarity
          Length = 364

 Score =  422 bits (1085), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/353 (59%), Positives = 256/353 (72%), Gaps = 11/353 (3%)

Query: 15  EDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKDDRMVIVIGPCSIHD 74
           ED RI GYDPL  P LLQ + P S++      K R    DI+ GKDDR+++V+GPCSIHD
Sbjct: 13  EDVRILGYDPLVSPALLQAQVPASQECLETAQKGRKESIDIITGKDDRVLVVVGPCSIHD 72

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            K A +YA  L  ++++L  DL IIMRAYLEKPRTTVGWKGLINDPD+DN++ INKGL++
Sbjct: 73  LKEAQDYAKGLKALSDELKGDLCIIMRAYLEKPRTTVGWKGLINDPDVDNTYNINKGLQV 132

Query: 135 SREMFTKLIE-KLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGF 193
           SR++F  L    LPI  EMLDTISPQ+L+D  S GAIGARTTESQLHRELASGLSFP+GF
Sbjct: 133 SRQLFVNLTSLGLPIGSEMLDTISPQYLADLLSFGAIGARTTESQLHRELASGLSFPVGF 192

Query: 194 KNGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAE 253
           KNGTDG L VA+DA++AASH H+F+ VTK GV AI  T+GN   F+ILRGGK GTNYD+ 
Sbjct: 193 KNGTDGTLGVALDAVQAASHSHHFMGVTKHGVAAITTTKGNEHCFVILRGGKQGTNYDSV 252

Query: 254 NVKSTKEQLRKAKLIDEADSTRRIMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCG 313
           +V   K+ L           T  +MID SHGNSNKD+RNQPKV   +  Q++ GE+ + G
Sbjct: 253 SVAEAKKAL---------PPTGVLMIDYSHGNSNKDFRNQPKVNDAVCEQIANGEDKIIG 303

Query: 314 VMIESNLVEGRQDVPPEGGREGLKYGCSITDACIGWDTTESVLELLAEGVRNR 366
           VMIES++ EG+Q +P E G+ GLKYG SITD CI  +TT  VL  LA  VR R
Sbjct: 304 VMIESHINEGKQSIPAE-GKAGLKYGVSITDGCISLETTAEVLRKLAAAVRAR 355

>Scas_26.1
          Length = 183

 Score =  318 bits (814), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 158/167 (94%)

Query: 1   MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAANILKARDSVCDILNGKD 60
           MFIKND+ GDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKG   I+ AR+ VC+ILNGKD
Sbjct: 3   MFIKNDHVGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGHKTIVDAREQVCEILNGKD 62

Query: 61  DRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDP 120
           DR+VIVIGPCSIHDPKAAYEYADKLA ++EKLS DLLIIMRAYLEKPRTTVGWKGLINDP
Sbjct: 63  DRLVIVIGPCSIHDPKAAYEYADKLAALSEKLSKDLLIIMRAYLEKPRTTVGWKGLINDP 122

Query: 121 DIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQFLSDCFSL 167
           DIDNSFQINKGLRISREMFT L+EKLPIAGEMLDTISPQFLSDCFS+
Sbjct: 123 DIDNSFQINKGLRISREMFTNLVEKLPIAGEMLDTISPQFLSDCFSV 169

>AFR270W [3462] [Homologous to NOHBY] complement(919886..921031)
           [1146 bp, 381 aa]
          Length = 381

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 135 SREMFTKLIEKLPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLHRELASGLSFPIGFK 194
           +R++   + E   +  ++LD     F+SD  SL  + AR+ +  L  ++ASGL   +  +
Sbjct: 126 TRDVLRAICEHTGVCLDILDNTLMNFVSDIPSLVVLDARSPDISL--KVASGLPSNVAVR 183

Query: 195 NGTDGGLQVAIDAMRAASHEHYFLSVTKPGVTAIVGTEGNSDTFIIL 241
                 +  AI  +   +    + +V+  G+   + T GN DTF+ L
Sbjct: 184 CRNANEIFSAIKILEHIAQPTLYPTVSHDGLPICIHTTGNPDTFLAL 230

>Kwal_33.13646
          Length = 1253

 Score = 32.0 bits (71), Expect = 0.98,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLIND--PDIDNS 125
           P+   E+  + A+I+E+L      ++R Y ++    +GW+ L+++  P ++N+
Sbjct: 902 PELLKEFGTQWALISERLGTKSTTMVRNYFQRNAEQMGWQSLVDNSSPSVENN 954

>Scas_689.5
          Length = 1294

 Score = 30.8 bits (68), Expect = 2.1,   Method: Composition-based stats.
 Identities = 45/204 (22%), Positives = 84/204 (41%), Gaps = 22/204 (10%)

Query: 75   PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRI 134
            P+   E+  + ++I++K+      ++R Y ++     GWK L+ D D +    I  G   
Sbjct: 959  PELLKEFGSQWSLISQKIGSKSTTMVRNYYQRNSAHFGWKLLVEDAD-NRRNAIRSGSVH 1017

Query: 135  SREMFTKLIEKLPIAGEMLDTISPQ------FL---SDCFSLGAIGARTTESQLHRELAS 185
              +M  +  + LP    +   I PQ      F    SD     + GA T  +  H E+  
Sbjct: 1018 QSQMLLQPEQMLPT---LSSGIPPQQRPALHFFGNQSDLDHRYSQGAGTPTNPFHSEIGR 1074

Query: 186  GLSFPIGFKNGTDGGLQVAIDAMRAASHEHYF-LSVTK------PGVTAIVGTEGNSDTF 238
              SF +     +       + +++  SHE  F L+V++      P +T +  +   +   
Sbjct: 1075 D-SFSV-VTTPSTALPPPRLPSIQLQSHEPSFPLNVSQQQATNVPHMTPVPSSNVTNPLP 1132

Query: 239  IILRGGKHGTNYDAENVKSTKEQL 262
             +   G+ G++  A NV S +  L
Sbjct: 1133 TVTESGRTGSSTSAANVNSIQSIL 1156

>KLLA0D14927g 1258177..1259700 similar to sp|P53255 Saccharomyces
           cerevisiae YGR093w singleton, start by similarity
          Length = 507

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 76  KAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDIDNSFQINKGLRIS 135
           K AY +   L    E + D+L  I   YLEKP    G + L+ DP+ DNS  ++K  R  
Sbjct: 203 KWAYAFKINLLEGLETIPDNL--IDNPYLEKPS---GKRDLVPDPETDNSSAVSKKQRKP 257

Query: 136 REM 138
           +++
Sbjct: 258 KQV 260

>YCR033W (SNT1) [567] chr3 (186484..190164) Component of Set3p
           complex (Set3p-Yil112p-Snt1p-Hst1p-Hos2p-Cph1p-Sif2p)
           that has histone deacetylase activity and a role in
           repression of meiotic-specific sporulation gene
           expression [3681 bp, 1226 aa]
          Length = 1226

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 27/48 (56%)

Query: 75  PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPDI 122
           P+   E+  + ++I+EKL      ++R Y ++     GWK L+++ D+
Sbjct: 901 PELLKEFGSQWSLISEKLGTKSTTMVRNYYQRNAARNGWKLLVDETDL 948

>Kwal_47.19034
          Length = 1033

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 46  LKARDSVCDILNGKDDRMVIVIGPC--------SIHDPKAAYEYADKLAVIAEKLSDDLL 97
           L+ RDS   +LN K+D+ V+  G C        ++ D K  + YA +LA     L+D   
Sbjct: 369 LEFRDSQF-VLNAKNDQRVVAEGDCFNISLGFNNLKDSKTGFNYAVQLADTVLILADGKP 427

Query: 98  IIMRAY 103
            ++ AY
Sbjct: 428 SVLTAY 433

>CAGL0L08162g 899222..903292 similar to sp|P25357 Saccharomyces
            cerevisiae YCR033w, start by similarity
          Length = 1356

 Score = 29.6 bits (65), Expect = 4.8,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 25/47 (53%)

Query: 75   PKAAYEYADKLAVIAEKLSDDLLIIMRAYLEKPRTTVGWKGLINDPD 121
            P    E+  + ++I++KL+     ++R Y ++     GWK ++ + D
Sbjct: 1000 PDLLNEFGSQWSLISQKLATKSTTMVRNYYQRNAAQFGWKSIVEEAD 1046

>CAGL0B02926g complement(284897..286753) weakly similar to
           DEHA0D04994g Debaryomyces hansenii and CA4636|IPF1520
           Candida albicans, hypothetical start
          Length = 618

 Score = 28.9 bits (63), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 9/81 (11%)

Query: 23  DPLTPPDLLQHEYPISE--KGAANILKARDSVCD----ILNGKDDRMVIVIGPCSIHDPK 76
           +P+ P  L+  E+ ISE  K     ++  D+V D     ++     M I +  CS+ D K
Sbjct: 357 NPIVP--LVDKEFSISETQKNWTPFIRDEDAVADGSRGFVHIVQHIMPITVLKCSLDDGK 414

Query: 77  AAYEY-ADKLAVIAEKLSDDL 96
             YE+ ADK+  + +    DL
Sbjct: 415 CTYEFRADKIDKLKKSQFKDL 435

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,236,802
Number of extensions: 532946
Number of successful extensions: 1358
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1363
Number of HSP's successfully gapped: 25
Length of query: 366
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 263
Effective length of database: 13,030,455
Effective search space: 3427009665
Effective search space used: 3427009665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)