Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H08415g100995376e-73
YDR045C (RPC11)110994987e-67
Scas_569.4*110994979e-67
Kwal_27.10939110994353e-57
Sklu_2357.91021014273e-56
AGR029W1121014241e-55
KLLA0F18568g1121014214e-55
KLLA0F09361g292341138e-08
CAGL0D06160g306341094e-07
YGL043W (DST1)309341084e-07
Scas_621.15307341076e-07
Sklu_2213.5287341051e-06
AGR011W304341051e-06
Kwal_26.7521301341051e-06
Kwal_27.997212541984e-06
Sklu_2119.412543976e-06
YJR063W (RPA12)12543967e-06
Scas_673.30*14843961e-05
AFR417W12541942e-05
CAGL0F00561g12843915e-05
KLLA0B13860g16041891e-04
KLLA0D03234g122101871e-04
Kwal_56.2405412293790.002
Sklu_1830.311093760.005
YGL070C (RPB9)12293760.006
CAGL0H03509g12293730.016
Scas_720.22*12293730.018
AFL088W12287720.025
ABL041W81843660.22
Scas_544.7d17370592.0
AFR518C43627592.3
Kwal_47.1741434846582.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H08415g
         (99 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H08415g 824631..824933 highly similar to sp|Q04307 Saccharo...   211   6e-73
YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA polyme...   196   7e-67
Scas_569.4*                                                           196   9e-67
Kwal_27.10939                                                         172   3e-57
Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement      169   3e-56
AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH] complement...   167   1e-55
KLLA0F18568g complement(1708319..1708657) highly similar to sp|Q...   166   4e-55
KLLA0F09361g complement(864425..865303) similar to sp|P07273 Sac...    48   8e-08
CAGL0D06160g complement(580707..581627) highly similar to sp|P07...    47   4e-07
YGL043W (DST1) [1934] chr7 (417485..418414) Transcription elonga...    46   4e-07
Scas_621.15                                                            46   6e-07
Sklu_2213.5 YGL043W, Contig c2213 7532-8395                            45   1e-06
AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH] complement(...    45   1e-06
Kwal_26.7521                                                           45   1e-06
Kwal_27.9972                                                           42   4e-06
Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement         42   6e-06
YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I s...    42   7e-06
Scas_673.30*                                                           42   1e-05
AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH] complement...    41   2e-05
CAGL0F00561g complement(58585..58971) highly similar to sp|P3252...    40   5e-05
KLLA0B13860g 1215461..1215943 some similarities with sp|P32529 S...    39   1e-04
KLLA0D03234g 270311..270679 highly similar to sp|P27999 Saccharo...    38   1e-04
Kwal_56.24054                                                          35   0.002
Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement         34   0.005
YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA polyme...    34   0.006
CAGL0H03509g complement(326276..326644) highly similar to sp|P27...    33   0.016
Scas_720.22*                                                           33   0.018
AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH] complement(...    32   0.025
ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH] complement(...    30   0.22 
Scas_544.7d                                                            27   2.0  
AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp...    27   2.3  
Kwal_47.17414                                                          27   2.6  

>CAGL0H08415g 824631..824933 highly similar to sp|Q04307
          Saccharomyces cerevisiae YDR045c RPC11, start by
          similarity
          Length = 100

 Score =  211 bits (537), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 99/99 (100%), Positives = 99/99 (100%)

Query: 1  MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60
          MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP
Sbjct: 1  MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60

Query: 61 NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
          NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE
Sbjct: 61 NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99

>YDR045C (RPC11) [898] chr4 complement(547974..548306) RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination [333 bp, 110 aa]
          Length = 110

 Score =  196 bits (498), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 89/99 (89%), Positives = 93/99 (93%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60
           MLL+ + D+GVY L+CRSCPYEFPIE IEIYDRKKLPRKEVDDVLGGGWDNVDQTK QCP
Sbjct: 11  MLLITSGDSGVYTLACRSCPYEFPIEGIEIYDRKKLPRKEVDDVLGGGWDNVDQTKTQCP 70

Query: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNC HRWKE
Sbjct: 71  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCGHRWKE 109

>Scas_569.4*
          Length = 110

 Score =  196 bits (497), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 89/99 (89%), Positives = 94/99 (94%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60
           MLL+ T+D+GVY L+CRSCPYEFPIE IEIYDRK LPRKEVDDVLGGGWDNVDQTKVQCP
Sbjct: 11  MLLITTADSGVYTLTCRSCPYEFPIEGIEIYDRKTLPRKEVDDVLGGGWDNVDQTKVQCP 70

Query: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           NY+ CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE
Sbjct: 71  NYEKCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 109

>Kwal_27.10939
          Length = 110

 Score =  172 bits (435), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 76/99 (76%), Positives = 86/99 (86%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCP 60
           ML+V+ +++G Y L C SCPY FPIE +E+YDRK LPRKEVDDVLGGGWDNVDQT VQCP
Sbjct: 11  MLVVSPAESGAYALKCGSCPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWDNVDQTAVQCP 70

Query: 61  NYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           NYD C GE AYFFQLQIRSADEPMTTFYKCV+C +RW+E
Sbjct: 71  NYDQCAGERAYFFQLQIRSADEPMTTFYKCVSCGNRWRE 109

>Sklu_2357.9 YDR045C, Contig c2357 12849-13157 reverse complement
          Length = 102

 Score =  169 bits (427), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 2/101 (1%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58
           MLL+AT+D G+Y L+C SCPYEFPIE IE+YDRK L RKEVDDVLGG   WDNVDQT  Q
Sbjct: 1   MLLIATNDAGIYKLNCPSCPYEFPIEGIEVYDRKTLVRKEVDDVLGGEGAWDNVDQTGAQ 60

Query: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           CPN+D CGG  AYFFQLQIRSADEPMTTFYKCV C H+W+E
Sbjct: 61  CPNHDNCGGNKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 101

>AGR029W [4339] [Homologous to ScYDR045C (RPC11) - SH]
           complement(768240..768578) [339 bp, 112 aa]
          Length = 112

 Score =  167 bits (424), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 2/101 (1%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58
           ML V+  D+GVY L C SCPYEFPIE +EIYDR+ LPRKEVDDVLGG   WDNVDQT VQ
Sbjct: 11  MLPVSKGDSGVYRLGCPSCPYEFPIEGVEIYDRRNLPRKEVDDVLGGEGAWDNVDQTAVQ 70

Query: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           CP ++TCGGE AYFFQLQIRSADEPMTTFYKCV C H+W+E
Sbjct: 71  CPQHETCGGEKAYFFQLQIRSADEPMTTFYKCVTCGHKWRE 111

>KLLA0F18568g complement(1708319..1708657) highly similar to
           sp|Q04307 Saccharomyces cerevisiae YDR045c RPC11 RNA
           polymerase III subunit C11, required for RNA cleavage
           activity and transcription termination singleton, start
           by similarity
          Length = 112

 Score =  166 bits (421), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 2/101 (1%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLGG--GWDNVDQTKVQ 58
           MLLV+ +D+G+Y L+C SCPY+F I+ IE+YDRK LPRKEVDDVLGG   WDNVDQT  Q
Sbjct: 11  MLLVSKADSGLYKLACGSCPYQFLIDGIEVYDRKNLPRKEVDDVLGGEGAWDNVDQTAAQ 70

Query: 59  CPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKE 99
           CPN+D C GE AYFFQLQIRSADEPMTTFYKCVNC H+W+E
Sbjct: 71  CPNHDQCAGERAYFFQLQIRSADEPMTTFYKCVNCGHKWRE 111

>KLLA0F09361g complement(864425..865303) similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS
           (transcription elongation factor) singleton, start by
           similarity
          Length = 292

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C      ++QLQ RSADEP+TTF  C NC +RWK
Sbjct: 257 CKQRKVSYYQLQTRSADEPLTTFCTCENCGNRWK 290

>CAGL0D06160g complement(580707..581627) highly similar to sp|P07273
           Saccharomyces cerevisiae YGL043w DST1 TFIIS, start by
           similarity
          Length = 306

 Score = 46.6 bits (109), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 271 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 304

>YGL043W (DST1) [1934] chr7 (417485..418414) Transcription
           elongation factor S-II, a DNA strand transfer protein
           catalyzing homologous DNA strand exchange [930 bp, 309
           aa]
          Length = 309

 Score = 46.2 bits (108), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 274 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 307

>Scas_621.15
          Length = 307

 Score = 45.8 bits (107), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 272 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 305

>Sklu_2213.5 YGL043W, Contig c2213 7532-8395
          Length = 287

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 252 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 285

>AGR011W [4321] [Homologous to ScYGL043W (DST1) - SH]
           complement(737606..738520) [915 bp, 304 aa]
          Length = 304

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 269 CKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWK 302

>Kwal_26.7521
          Length = 301

 Score = 45.1 bits (105), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 65  CGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           C  +   ++QLQ RSADEP+TTF  C  C +RWK
Sbjct: 266 CKEKKVSYYQLQTRSADEPLTTFCTCEVCGNRWK 299

>Kwal_27.9972
          Length = 125

 Score = 42.4 bits (98), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 58  QCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           +CP    CG +  ++  LQ+RSADE  T FY C +C +R++
Sbjct: 85  KCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTSCGYRFR 122

>Sklu_2119.4 YJR063W, Contig c2119 5697-6074 reverse complement
          Length = 125

 Score = 42.0 bits (97), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 56  KVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           K +CP    CG +   +  LQ+RSADE  T FY C +C +R++
Sbjct: 83  KEKCPQ---CGNDEMRYHTLQLRSADEGATVFYTCTSCGYRFR 122

>YJR063W (RPA12) [2957] chr10 (555109..555486) RNA polymerase I
           subunit A12.2 [378 bp, 125 aa]
          Length = 125

 Score = 41.6 bits (96), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 56  KVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           K +CP    CG E   +  LQ+RSADE  T FY C +C ++++
Sbjct: 83  KEKCPQ---CGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFR 122

>Scas_673.30*
          Length = 148

 Score = 41.6 bits (96), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 56  KVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           K +CP    CG +  ++  LQ+RSADE  T FY C  C ++++
Sbjct: 106 KEKCPQ---CGNDEMHYHTLQLRSADEGATVFYTCTKCGYKFR 145

>AFR417W [3609] [Homologous to ScYJR063W (RPA12) - SH]
           complement(1184595..1184972) [378 bp, 125 aa]
          Length = 125

 Score = 40.8 bits (94), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 58  QCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           +CP    CG +   +  LQ+RSADE  T FY C +C +R++
Sbjct: 85  KCPQ---CGHDEMQYHTLQLRSADEGATVFYTCTSCGYRFR 122

>CAGL0F00561g complement(58585..58971) highly similar to sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, start by similarity
          Length = 128

 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 56  KVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           K +CP    CG +   +  LQ+RSADE  T FY C+ C ++++
Sbjct: 86  KEKCPK---CGHDEMRYQTLQLRSADEGATVFYTCIKCNYKYR 125

>KLLA0B13860g 1215461..1215943 some similarities with sp|P32529
           Saccharomyces cerevisiae YJR063w RPA12 DNA-directed RNA
           polymerase I, 13. 7 KD subunit singleton, hypothetical
           start
          Length = 160

 Score = 38.9 bits (89), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 58  QCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWK 98
           +CP    C  +  ++  LQ+RSADE  T FY C  C +R++
Sbjct: 120 KCPK---CANDKMHYHTLQLRSADEGATVFYTCTACGYRFR 157

>KLLA0D03234g 270311..270679 highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9 DNA-directed RNA
           polymerase II, 14. 2 KD subunit singleton, start by
           similarity
          Length = 122

 Score = 38.1 bits (87), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 2   LLVATSDNGVYNL--SCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQ 54
           +L    D   + L   CR+CPY     +  +Y R +L +  + +  G     G    + +
Sbjct: 13  MLYPREDKETHKLLFECRTCPYVEEAGTPLVY-RHEL-KTNIGETAGVVQDIGSDPTLPR 70

Query: 55  TKVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
           +  +CP    C      FFQ Q R  D  M  FY C++C+H
Sbjct: 71  SDKECPK---CHSRENVFFQSQQRRKDTSMVLFYVCLHCSH 108

>Kwal_56.24054
          Length = 122

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 10/93 (10%)

Query: 8   DNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNY 62
           DN      CR+C Y     +  +Y  + +    + +  G     G    + ++  +CP  
Sbjct: 21  DNQRLLFECRTCTYAEEAGTPMVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPK- 77

Query: 63  DTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
             C      FFQ Q R +D  M  F+ C+ C+H
Sbjct: 78  --CHSHENVFFQSQQRRSDTSMVLFFVCLGCSH 108

>Sklu_1830.3 YGL070C, Contig c1830 5480-5812 reverse complement
          Length = 110

 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 10/93 (10%)

Query: 8  DNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNY 62
          DN      CR+C Y     +  +Y  + +    + +  G     G    + ++  +CP  
Sbjct: 9  DNQRLLFECRTCTYAEEAGTPLVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPK- 65

Query: 63 DTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
            C      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 66 --CHSHENVFFQSQQRRKDTSMVLFFVCLACSH 96

>YGL070C (RPB9) [1910] chr7 complement(374460..374828) RNA
           polymerase II, non-essential subunit, involved in
           transcription start site selection [369 bp, 122 aa]
          Length = 122

 Score = 33.9 bits (76), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 38/93 (40%), Gaps = 10/93 (10%)

Query: 8   DNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNY 62
           +N      CR+C Y     S  +Y  + +    + +  G     G    + ++  +CP  
Sbjct: 21  ENNRLLFECRTCSYVEEAGSPLVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPK- 77

Query: 63  DTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
             C      FFQ Q R  D  M  F+ C++C+H
Sbjct: 78  --CHSRENVFFQSQQRRKDTSMVLFFVCLSCSH 108

>CAGL0H03509g complement(326276..326644) highly similar to sp|P27999
           Saccharomyces cerevisiae YGL070c RPB9, start by
           similarity
          Length = 122

 Score = 32.7 bits (73), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 10/93 (10%)

Query: 8   DNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNY 62
           +N      CR+C Y     S  +Y  + +    + +  G     G    + ++  +CP  
Sbjct: 21  ENNRLLFECRTCSYIEEAGSPLVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPK- 77

Query: 63  DTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
             C      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 78  --CHSRENVFFQSQQRRKDTSMVLFFVCLACSH 108

>Scas_720.22*
          Length = 122

 Score = 32.7 bits (73), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 10/93 (10%)

Query: 8   DNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNY 62
           +N      CR+C Y     +  +Y  + +    + +  G     G    + ++  +CP  
Sbjct: 21  ENNRLLFECRTCSYVEEAGAPLVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPR- 77

Query: 63  DTCGGESAYFFQLQIRSADEPMTTFYKCVNCAH 95
             C      FFQ Q R  D  M  F+ C+ C+H
Sbjct: 78  --CHARDNVFFQSQQRRKDTSMVLFFVCLQCSH 108

>AFL088W [3105] [Homologous to ScYGL070C (RPB9) - SH]
           complement(276175..276543) [369 bp, 122 aa]
          Length = 122

 Score = 32.3 bits (72), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 35/87 (40%), Gaps = 10/87 (11%)

Query: 14  LSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG-----GGWDNVDQTKVQCPNYDTCGGE 68
             CR+C Y     +  +Y  + +    + +  G     G    + ++  +CP    C   
Sbjct: 27  FECRTCTYAEEAGTPLVYRHELI--TNIGETAGVVQDIGSDPTLPRSDRECPR---CHSH 81

Query: 69  SAYFFQLQIRSADEPMTTFYKCVNCAH 95
              FFQ Q R  D  M  F+ C+ C+H
Sbjct: 82  DNVFFQSQQRRRDTSMVLFFVCLGCSH 108

>ABL041W [551] [Homologous to ScYMR089C (YTA12) - SH]
           complement(318701..321157) [2457 bp, 818 aa]
          Length = 818

 Score = 30.0 bits (66), Expect = 0.22,   Method: Composition-based stats.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 4   VATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDVLG 46
           V  ++NG++ L  R   Y F I S+E ++RK    +E  D LG
Sbjct: 221 VVLNENGMHQLQNRDTSYYFTIGSVENFERK---LREAQDELG 260

>Scas_544.7d
          Length = 173

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 18/70 (25%)

Query: 1   MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPR-----KEVDDV----------- 44
           +LL  +S    Y  +C+ C Y++   S+ + D + + +      E  +V           
Sbjct: 70  VLLAKSSRKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEYLRFQELKKN 129

Query: 45  --LGGGWDNV 52
             LGGG DNV
Sbjct: 130 IELGGGIDNV 139

>AFR518C [3710] [Homologous to NOHBY] (1364371..1365681) [1311 bp,
           436 aa]
          Length = 436

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 28  IEIYDRKKLPRKEVDDVLGGGWDNVDQ 54
           IEI  R++L  +E+++  G  W N D+
Sbjct: 345 IEIASRRRLTIRELENSYGSSWRNADK 371

>Kwal_47.17414
          Length = 348

 Score = 26.9 bits (58), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%)

Query: 20  PYEFPIESIEIYDRKKLPRKEVDDVLGGGWDNVDQTKVQCPNYDTC 65
           P E   E +E Y + +  +  V ++L    D +    V CP+Y+T 
Sbjct: 301 PIEISPELVEKYKQSETTKDAVKELLDTISDGLKAVTVTCPDYETL 346

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,475,925
Number of extensions: 132553
Number of successful extensions: 278
Number of sequences better than 10.0: 34
Number of HSP's gapped: 275
Number of HSP's successfully gapped: 34
Length of query: 99
Length of database: 16,596,109
Length adjustment: 70
Effective length of query: 29
Effective length of database: 14,172,849
Effective search space: 411012621
Effective search space used: 411012621
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)