Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H08393g61260230520.0
YDR046C (BAP3)60455021040.0
Scas_718.4259558820380.0
YBR068C (BAP2)60955320240.0
Scas_569.559353920060.0
CAGL0L07546g63457420030.0
Kwal_27.1053860255018040.0
AGR038C58053717180.0
AGR039C58654415520.0
CAGL0K05753g66057115530.0
YDR508C (GNP1)66357715140.0
CAGL0B01012g62356914990.0
Kwal_33.1321559854914630.0
Kwal_33.1320460755414620.0
KLLA0C01606g62056114580.0
YCL025C (AGP1)59554014510.0
AGR040C57354014370.0
AFR698C60955614310.0
Scas_517.267957514240.0
YBR069C (TAT1)61954313461e-180
Kwal_27.1268159354911871e-156
ADL272W56452611781e-155
Scas_718.4161452011681e-153
Sklu_2029.259853511641e-153
KLLA0A06886g58759411581e-152
CAGL0L03267g59754211541e-151
YKR039W (GAP1)60253911321e-148
KLLA0A11770g58152711251e-147
Kwal_33.1540758754110871e-141
Sklu_2390.160552610871e-141
CAGL0B03773g60552310771e-139
YGR191W (HIP1)60351510761e-139
Scas_479.159553810701e-139
AGR319W62655110711e-138
KLLA0A06930g58754410531e-136
AFR230C60455410421e-134
Scas_507.159254510391e-134
KLLA0F01012g55652010311e-133
Scas_607.459954410241e-132
Kwal_33.1427659654410161e-131
CAGL0D02178g5775539741e-124
YOL020W (TAT2)5925469561e-122
AEL030W7395389611e-121
KLLA0A10813g5845479191e-116
Kwal_34.162544814508831e-112
Kwal_56.229515965678541e-106
KLLA0B06776g5885408421e-105
YPL274W (SAM3)5875458181e-101
YLL061W (MMP1)5835517825e-96
Scas_536.13723627638e-96
CAGL0J08162g5975067487e-91
Scas_706.375445307421e-90
Kwal_33.134015595437343e-89
KLLA0E16335g6055127364e-89
CAGL0A01199g6135427332e-88
YEL063C (CAN1)5905327312e-88
YNL268W (LYP1)6116047295e-88
AER405C4975037172e-87
Scas_706.36d6075097243e-87
KLLA0C02365g5795447223e-87
AFR667C5635257196e-87
CAGL0J08184g5725287127e-86
YNL270C (ALP1)5735307049e-85
Kwal_33.134115605426961e-83
YPL265W (DIP5)6085416964e-83
KLLA0C02343g5814936901e-82
Scas_486.25975376806e-81
AFR668W5564876715e-80
Kwal_33.155455765206446e-76
Scas_377.24904956379e-76
KLLA0F27093g5635266384e-75
Scas_520.2*3723555824e-69
Kwal_26.96125434915911e-68
YOR348C (PUT4)6275035925e-68
YFL055W (AGP3)5585285816e-67
ACL135W5885205819e-67
CAGL0E05632g5985645792e-66
Sklu_2438.145585475712e-65
KLLA0F23419g5735435695e-65
CAGL0M00154g5505335659e-65
AFR156W5585435483e-62
Kwal_23.28175805545469e-62
Scas_84.12132095171e-61
Kwal_8.5906295025462e-61
KLLA0B14685g5715355405e-61
Kwal_26.69405705065344e-60
Scas_552.35585315107e-57
Kwal_26.80975445314852e-53
Kwal_23.40265344214333e-46
Scas_460.35845254232e-44
Sklu_2365.98056024168e-43
AAR038W5665284053e-42
Scas_377.11481373676e-41
CAGL0C00539g5725583966e-41
YBR132C (AGP2)5964973923e-40
KLLA0C15873g5685113886e-40
Kwal_23.38475794463753e-38
KLLA0D16830g8326663787e-38
KLLA0B09922g7975813635e-36
Scas_682.308455943352e-32
Kwal_53.194615655763303e-32
CAGL0E01089g8535713282e-31
Kwal_27.119007264823262e-31
YDR160W (SSY1)8525833235e-31
AGL171W8515763139e-30
Scas_619.2*4714693071e-29
Scas_642.222371882533e-24
Scas_485.4*2371882491e-23
Scas_476.42371912481e-23
CAGL0B02838g5924131006e-04
Scas_233.114158890.003
Sklu_2305.6541104880.016
CAGL0K04367g582180800.14
Scas_670.14585180800.14
YJR041C1174117770.32
Scas_711.22*101881770.36
Kwal_47.18050506184760.41
AEL125C57589731.0
CAGL0M08272g62190721.1
AFL081W542105721.2
Sklu_2147.4568222721.2
Kwal_26.70701315136692.8
ABL003C561424684.2
YGR055W (MUP1)574180675.3
Scas_531.2*105330666.3
KLLA0B13233g578345659.2
Sklu_1731.231075649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H08393g
         (602 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...  1180   0.0  
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   815   0.0  
Scas_718.42                                                           789   0.0  
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   784   0.0  
Scas_569.5                                                            777   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   776   0.0  
Kwal_27.10538                                                         699   0.0  
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   666   0.0  
AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   602   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   602   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   587   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   582   0.0  
Kwal_33.13215                                                         568   0.0  
Kwal_33.13204                                                         567   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   566   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   563   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   558   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   555   0.0  
Scas_517.2                                                            553   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   523   e-180
Kwal_27.12681                                                         461   e-156
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   458   e-155
Scas_718.41                                                           454   e-153
Sklu_2029.2 , Contig c2029 2095-3891                                  452   e-153
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   450   e-152
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   449   e-151
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   440   e-148
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   437   e-147
Kwal_33.15407                                                         423   e-141
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        423   e-141
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   419   e-139
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   419   e-139
Scas_479.1                                                            416   e-139
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   417   e-138
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   410   e-136
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   405   e-134
Scas_507.1                                                            404   e-134
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   401   e-133
Scas_607.4                                                            399   e-132
Kwal_33.14276                                                         395   e-131
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   379   e-124
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   372   e-122
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   374   e-121
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   358   e-116
Kwal_34.16254                                                         344   e-112
Kwal_56.22951                                                         333   e-106
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   328   e-105
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   319   e-101
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   305   5e-96
Scas_536.1                                                            298   8e-96
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   292   7e-91
Scas_706.37                                                           290   1e-90
Kwal_33.13401                                                         287   3e-89
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   288   4e-89
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   286   2e-88
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   286   2e-88
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   285   5e-88
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   280   2e-87
Scas_706.36d                                                          283   3e-87
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   282   3e-87
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   281   6e-87
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   278   7e-86
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   275   9e-85
Kwal_33.13411                                                         272   1e-83
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   272   4e-83
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   270   1e-82
Scas_486.2                                                            266   6e-81
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   263   5e-80
Kwal_33.15545                                                         252   6e-76
Scas_377.2                                                            249   9e-76
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   250   4e-75
Scas_520.2*                                                           228   4e-69
Kwal_26.9612                                                          232   1e-68
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   232   5e-68
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   228   6e-67
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   228   9e-67
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   227   2e-66
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        224   2e-65
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   223   5e-65
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   222   9e-65
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   215   3e-62
Kwal_23.2817                                                          214   9e-62
Scas_84.1                                                             203   1e-61
Kwal_8.590                                                            214   2e-61
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   212   5e-61
Kwal_26.6940                                                          210   4e-60
Scas_552.3                                                            201   7e-57
Kwal_26.8097                                                          191   2e-53
Kwal_23.4026                                                          171   3e-46
Scas_460.3                                                            167   2e-44
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         164   8e-43
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   160   3e-42
Scas_377.1                                                            145   6e-41
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   157   6e-41
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   155   3e-40
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   154   6e-40
Kwal_23.3847                                                          149   3e-38
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   150   7e-38
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   144   5e-36
Scas_682.30                                                           133   2e-32
Kwal_53.19461                                                         131   3e-32
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   130   2e-31
Kwal_27.11900                                                         130   2e-31
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   129   5e-31
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   125   9e-30
Scas_619.2*                                                           122   1e-29
Scas_642.22                                                           102   3e-24
Scas_485.4*                                                           100   1e-23
Scas_476.4                                                            100   1e-23
CAGL0B02838g complement(274984..276762) highly similar to sp|P50...    43   6e-04
Scas_233.1                                                             39   0.003
Sklu_2305.6 YGL077C, Contig c2305 10656-12281                          39   0.016
CAGL0K04367g 412204..413952 highly similar to sp|P50276 Saccharo...    35   0.14 
Scas_670.14                                                            35   0.14 
YJR041C (YJR041C) [2935] chr10 complement(510153..513677) Protei...    34   0.32 
Scas_711.22*                                                           34   0.36 
Kwal_47.18050                                                          34   0.41 
AEL125C [2381] [Homologous to ScYKL174C - SH] (387763..389490) [...    33   1.0  
CAGL0M08272g complement(823019..824884) highly similar to sp|P36...    32   1.1  
AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH] complement(...    32   1.2  
Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement         32   1.2  
Kwal_26.7070                                                           31   2.8  
ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH] (390867..392...    31   4.2  
YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity methio...    30   5.3  
Scas_531.2*                                                            30   6.3  
KLLA0B13233g complement(1159097..1160833) highly similar to sp|P...    30   9.2  
Sklu_1731.2 YBR283C, Contig c1731 1517-2449                            29   9.9  

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score = 1180 bits (3052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/602 (96%), Positives = 578/602 (96%)

Query: 1   MNSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEGXXXXXXXXXXXHNLRSRFDVQVK 60
           MNSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEG           HNLRSRFDVQVK
Sbjct: 1   MNSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEGDYDDDDKSSSSHNLRSRFDVQVK 60

Query: 61  NRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNG 120
           NRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNG
Sbjct: 61  NRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNG 120

Query: 121 KGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATT 180
           KGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATT
Sbjct: 121 KGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATT 180

Query: 181 WLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIF 240
           WLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIF
Sbjct: 181 WLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIF 240

Query: 241 NACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAY 300
           NACKILMIGGFIIFAIVVNC             WHDPGAFASSNGASRFKGICYNLVNAY
Sbjct: 241 NACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVNAY 300

Query: 301 FSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGAS 360
           FSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGAS
Sbjct: 301 FSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGAS 360

Query: 361 GGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR 420
           GGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR
Sbjct: 361 GGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR 420

Query: 421 FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI 480
           FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI
Sbjct: 421 FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI 480

Query: 481 RFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSF 540
           RFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSF
Sbjct: 481 RFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSF 540

Query: 541 FASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
           FASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN
Sbjct: 541 FASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600

Query: 601 SS 602
           SS
Sbjct: 601 SS 602

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/550 (69%), Positives = 462/550 (84%), Gaps = 6/550 (1%)

Query: 58  QVKNRHLQGFIDSFKRADDS--PDHNDLE---KTTTAHQEQKKTMKSRHVIMMSLGTGIG 112
           + +N  +  F+DSF+RA+     + NDLE   K+  ++   KK+MKSRHV+MMSLGTGIG
Sbjct: 46  ESRNGLVHRFVDSFRRAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIG 105

Query: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172
           TGLLV+N KGLSLAGP SLVI Y +VSFVTYFM+QAAGEM VTYPTLPG+FNAY S FIS
Sbjct: 106 TGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFIS 165

Query: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232
           K FGFATTWLFCIQWLTVLPLELIT++MT+KYWN +I+ DVF++IFYVFL+FIHFFGV+A
Sbjct: 166 KSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKA 225

Query: 233 YGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGI 292
           YGETEFIFN+CKILM+ GFII ++V+NC             W DPG+FA  +GA+RFKGI
Sbjct: 226 YGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGI 285

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352
           CY LV+AYFS+GG ELFVLS+N+Q NPRKSTP AAK +VYRI++IYLLTMILIGF VPHN
Sbjct: 286 CYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHN 345

Query: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412
           + +L+G SGG+  HASPYVLAASIH ++V+PHIINAVILI++ISVANS+LYA PRL+ SL
Sbjct: 346 NDQLMG-SGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSL 404

Query: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472
           AQQGYAP+FL+Y+DR GRPL AL++ +LVGV+GF A SP+EE+ FTWLAAI+GLSELFTW
Sbjct: 405 AQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTW 464

Query: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532
           + IM SHIRFR+AMK+Q +SLD +GYKANTG+WGSY+GV FN+LVF AQFWVALSP  +G
Sbjct: 465 SGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNG 524

Query: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDL 592
           GKCDA +FF SYLA P+W+  Y GYM + +DFT L  L+++DLD HR+VYDPE +RQED 
Sbjct: 525 GKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDE 584

Query: 593 ENKERLRNSS 602
           ENKERL+NSS
Sbjct: 585 ENKERLKNSS 594

>Scas_718.42
          Length = 595

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/588 (66%), Positives = 456/588 (77%), Gaps = 17/588 (2%)

Query: 22  SKSNDYVHEQNHIIEGXXXXXXXXXXXHNLRSRFD-----VQVKNR-HLQGFIDSFKRAD 75
           SK N+   E N I               N+  +F+       VK+R H   F+DSFKRA+
Sbjct: 4   SKKNETSPEVNSITSSTLKTP-------NVTEKFEPYPDTTAVKHRTHFNRFVDSFKRAE 56

Query: 76  DSPDHNDLEKTTTAHQEQ---KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132
            + +  DLE  T + Q     KK MKSRHVIMMSLGTGIGTGLLV+N KGL LAGPASLV
Sbjct: 57  VNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLV 116

Query: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192
           I Y +VSF+TYF+IQAAGEMAVTYPTLPG FN Y S F+SKPFGFAT WLFCIQWLTVLP
Sbjct: 117 IGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLP 176

Query: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252
           LELITA+MTIKYWN  I+ DVFV+I YVFL+FIHFFGV+AYGE EFIFN+CKILMIGGF+
Sbjct: 177 LELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFV 236

Query: 253 IFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLS 312
           I +IVVNC             W DPGAFAS N ASRFKG+ + LV AYFSYGG ELF LS
Sbjct: 237 ILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALS 296

Query: 313 VNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372
           VN+Q+NPR+STPAAAK ++YRI++IYLLTMILIGF VPHNS +L+GA GG+  HASPYVL
Sbjct: 297 VNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGA-GGSATHASPYVL 355

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432
           A SIHG+KVVPHIINAVILI++ SVANS+LYA PRLL SLA+QGYAP++ +YVDR GRPL
Sbjct: 356 AVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPL 415

Query: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS 492
            AL+L ++ GVI F A S +EE +FTWLAAI+GLSELFTW+SI+ SH+RFR AMK Q KS
Sbjct: 416 RALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKS 475

Query: 493 LDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552
           L+ LGY + TG+WGS +G  FN+LVF AQFWVALSPP S G   A +FF SYLA P+WL 
Sbjct: 476 LNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLF 535

Query: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
           FY GYM + +DFT LTDL ++DLDNHR++YDPE LRQED E KER+RN
Sbjct: 536 FYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRN 583

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/553 (67%), Positives = 446/553 (80%), Gaps = 12/553 (2%)

Query: 61  NRHLQGFIDSFKRADDS--------PDHNDLE---KTTTAHQEQKKTMKSRHVIMMSLGT 109
           ++ +  F DSFKRA+ S         + +DLE   ++ T+  + KK+MKSRHV+MMSLGT
Sbjct: 48  DKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGT 107

Query: 110 GIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSF 169
           GIGTGLLV+N KGL   GPA+L+I Y LVSF TYFMIQAAGEMAVTYPTLP +FNAY+S 
Sbjct: 108 GIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFNAYSSI 167

Query: 170 FISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFG 229
           FISK FGFAT WL+C QWLTVLPLELITA+MTI++ N  I+PD++++IFYVFL+FIHFFG
Sbjct: 168 FISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVFIHFFG 227

Query: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRF 289
           V+AYGETEFIFN CKILMI GFII +IV+NC             WH+PGAFA      RF
Sbjct: 228 VKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDTSIGRF 287

Query: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349
           K +CY LV AYFS+GG ELF LSV +Q NPRKSTP AAK ++YRIVVIYLLTMILIGF V
Sbjct: 288 KNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNV 347

Query: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409
           P+N  +L+GA GG+  HASPYVLAASIHG+K+VPHIINAVILI+++SVANSSLYAGPRL+
Sbjct: 348 PYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLI 406

Query: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469
            SLAQQGYAP+FL YVDR GRPL AL++  + GVI F A S +EE VFTWLAAI+GLSEL
Sbjct: 407 CSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSEL 466

Query: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529
           FTWTSIM SH+RFR+AMK+Q +SLD LGYKA TG+WGS +GV FNILVF AQFWVAL+P 
Sbjct: 467 FTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPL 526

Query: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589
            +GGKCDA SFF +YLA PIWL FYFGYM + +DFT+L  L+++DLD HR++YDPE +RQ
Sbjct: 527 GNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQ 586

Query: 590 EDLENKERLRNSS 602
           ED ENKE+LRN S
Sbjct: 587 EDEENKEKLRNMS 599

>Scas_569.5
          Length = 593

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/539 (68%), Positives = 439/539 (81%), Gaps = 5/539 (0%)

Query: 67  FIDSFKRADDSPDHNDLEKTTTAHQEQ---KKTMKSRHVIMMSLGTGIGTGLLVSNGKGL 123
           F+DSFKRA DS + NDLE  T    +    KK MKSRHVIMM +GTGIGTGLLV+N  GL
Sbjct: 47  FVDSFKRAQDSTE-NDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGL 105

Query: 124 SLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLF 183
           S  GP SLVI Y LVSFVTYFMIQAAGEMAV YPTLPG+FN+YTS FISKPFGFAT WLF
Sbjct: 106 SYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLF 165

Query: 184 CIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNAC 243
            IQWLTV PLELITA++TIKYWN  I+ DVF++IFYVFL+FIHFFGV+AYGE EFIFN+C
Sbjct: 166 FIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSC 225

Query: 244 KILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSY 303
           K+LMI GFII +IV+NC             W DPG+FA  +   +FKGICY LV AYFSY
Sbjct: 226 KVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSY 285

Query: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN 363
           GG ELF LSVN+Q+NPRKSTP AAK ++YRI++IYLLTMILIGF VPHN+ +L+G SGG+
Sbjct: 286 GGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMG-SGGS 344

Query: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423
             HASPYVLAASIHG+KVVPH INAVILI++ISVANS+LYA PRL+ SLA+QGYAP+FL 
Sbjct: 345 ATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLD 404

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
           YVDR GRPL AL+L A+ GVIGF + S +EEEVFTWLAAI+GLSELFTW+ IM SH+RFR
Sbjct: 405 YVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFR 464

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS 543
           + MKL  +S + +G++A TG+WGS +G+ FN+LVF AQFWVAL+PP+  GK DA SFF S
Sbjct: 465 QCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQS 524

Query: 544 YLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSS 602
           YLA PIWL FYFGYM + +DFT L  L+++DL+ HR++YDPE +RQED ENKE+++NSS
Sbjct: 525 YLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKNSS 583

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/574 (66%), Positives = 447/574 (77%), Gaps = 28/574 (4%)

Query: 56  DVQVKNRHLQGFIDSFKRADDSPD--------HNDLEKTTTAHQEQ-------------- 93
           + + + + +  F+DSFKRA D P         +N   KT    +E               
Sbjct: 52  ESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLEGSDHDSIIT 111

Query: 94  ----KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149
               KK MKSRHV+MMSLGTGIGTGLLV+N KGL   GPA+LVI Y LVSFVTYFMIQAA
Sbjct: 112 NTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAA 171

Query: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209
           GEMAVTYPTLPG+FNAY+S F+S  FGFAT W+FCIQWLTVLPLELITA++TIKYWN  I
Sbjct: 172 GEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDKI 231

Query: 210 DPDVFVIIFYVFLMFIHFFG-VQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXX 268
           + DVF++IFYVFL+ IH FG V AYGETEF+FN CKILM+ GFII +IV+N         
Sbjct: 232 NADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREY 291

Query: 269 XXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAK 328
                WHDPGAFA     SRFKGICY LV+ YFSYGG ELF LSVN+Q NPR+STP A+K
Sbjct: 292 IGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTPQASK 351

Query: 329 SNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINA 388
           S++YRI++IYLLTMILIGF VP++S EL+G SGG+  HASPYVLAAS++G+K+ PH INA
Sbjct: 352 SSLYRILIIYLLTMILIGFNVPYDSDELMG-SGGSATHASPYVLAASLNGVKIAPHFINA 410

Query: 389 VILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAA 448
           VILI++ISVANSSLYA PRL+ SLAQQGYAP+FL YVDR+GRPL AL+   LVGVIGF A
Sbjct: 411 VILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGVIGFVA 470

Query: 449 TSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSY 508
            SP+EEEVFTWLAAI+GLSELFTW+SIM SH+RFR AMKLQN+SL+ LGYKA TG++GS 
Sbjct: 471 ASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTGIYGSI 530

Query: 509 FGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLT 568
           +GV FN+LVFAAQFW AL P    GK +ANSFFA+YLAMPIWLVFYFGYM W +DF +L 
Sbjct: 531 YGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRDFQLLK 590

Query: 569 DLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSS 602
            L+++DLD HR++YDPE +RQED E+KERLRN S
Sbjct: 591 PLDKIDLDFHRRIYDPELMRQEDEESKERLRNGS 624

>Kwal_27.10538
          Length = 602

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/550 (59%), Positives = 427/550 (77%), Gaps = 7/550 (1%)

Query: 60  KNRHLQG-FIDSFKRADD--SPDHNDLEKTTT----AHQEQKKTMKSRHVIMMSLGTGIG 112
           +NR+  G F++SFKRA+   +P + DLE  TT    +    K+++K RHV MMS+ TGIG
Sbjct: 43  ENRNAWGRFVNSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIG 102

Query: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172
           TGLLV+NGK L   GPA L+I Y  VS V Y M+QAAGEMAV YP+LPG+FNAY+S  IS
Sbjct: 103 TGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLIS 162

Query: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232
           +PFGFAT WL+CIQWLTVLPLELITA++TIKYWN SI+ DVF+ IFYVF++FIHFFG + 
Sbjct: 163 RPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRG 222

Query: 233 YGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGI 292
           YGE+EFIF  CK+LMI GF+I +IV+NC             W+DPGAFA  +GA++FKG+
Sbjct: 223 YGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGV 282

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352
            Y LV  YFSYGG EL+ ++VN+Q NPR++  +  K  +YRI++IY+LTMILIGF+VPH 
Sbjct: 283 AYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHT 342

Query: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412
           SSEL+G+SG +  HASPYVLA S+HG+K+VPHIINAVILIA+ISV NS++Y+GPR+L++L
Sbjct: 343 SSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTL 402

Query: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472
           A+QGYAPRFL+YVDR GRPL AL+  ++ G++ F A S  EE+VFTWLAAI+GLSELFTW
Sbjct: 403 AEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTW 462

Query: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532
           ++IM SH+RFR+AM+  N+ L  LGYKANTG+ GS  G+ FNILVF AQFWV+++P    
Sbjct: 463 SAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKD 522

Query: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDL 592
           GK D  SFF SYLA P+W+V +FGYM  ++++ ++  L  +DLD++R +YD + L QEDL
Sbjct: 523 GKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDL 582

Query: 593 ENKERLRNSS 602
           E+K  ++NSS
Sbjct: 583 EHKILIQNSS 592

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/537 (58%), Positives = 406/537 (75%), Gaps = 4/537 (0%)

Query: 67  FIDSFKRADDSP--DHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLS 124
           F+DSF+R D S   D  D E  +T   + ++ M++RHV+MMSLGTGIGTGLLV+N   L 
Sbjct: 35  FVDSFRREDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLH 94

Query: 125 LAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFC 184
             GPA L+I Y LVS V+Y M+ AAGEMAV YPTLPG+FNAY+S FISKPFGFAT WLFC
Sbjct: 95  YGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFC 154

Query: 185 IQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACK 244
           +QWLTV PLELITA + IKYW  S++ +VFV+IFY+F++ IHFFG + YGETEFIFN CK
Sbjct: 155 LQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214

Query: 245 ILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYG 304
           +LMI GF+I  I++N              W +PG+F S     + KG  Y LV AYFS+G
Sbjct: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFG 274

Query: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNG 364
           G EL+ LSVN+  NP+ + P+A K  VYRI+++YLLTMI+IGF+VPH+S  L+G SG N 
Sbjct: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMG-SGSND 333

Query: 365 LHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSY 424
           +H SPYVLA  +HG+KV+PHI+NAVILI++ISV NS++Y+ PRLL +LAQQGYAP+ L Y
Sbjct: 334 VHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDY 393

Query: 425 VDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRR 484
           +DR GRPL +L+L A+ G+I F+A S  +E++F WLAAI+GLSELFTWTSI  SH RFR+
Sbjct: 394 IDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQ 453

Query: 485 AMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASY 544
           AMKLQ +SL+TLGY+A TG WGS + V FN+LVF AQFWVAL P  +  K D  SFF +Y
Sbjct: 454 AMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPI-AKKKVDVLSFFQNY 512

Query: 545 LAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNS 601
           +A P+WL+ + GYM + +++T+L  L+++DLD HR+VYD E L+QE+ E KER+RNS
Sbjct: 513 MAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNS 569

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/544 (53%), Positives = 385/544 (70%), Gaps = 12/544 (2%)

Query: 67  FIDSFKRA--DDSPD------HNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           F DSFKRA  D + D       N L KT    Q  K  +K+RH+ M+SLGTGIGTGLLV+
Sbjct: 37  FTDSFKRAQVDTAVDLEGKDADNGLNKT---QQTLKHNIKTRHLTMISLGTGIGTGLLVA 93

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           +GK L   GPA LVI Y   S + Y ++QA  E+ V Y TLPG++NAY +F + K FGFA
Sbjct: 94  SGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFA 153

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
              ++ +QW TVLPLEL+TA+MT+KYW +S++PDVFV IFYVFL+FIHFFG + Y E EF
Sbjct: 154 VALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEF 213

Query: 239 IFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVN 298
           IFN+ K+L++ GFII AI +               WHDPGAF       RFKGIC   V 
Sbjct: 214 IFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQY-WHDPGAFGGDRAIDRFKGICSVWVQ 272

Query: 299 AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLG 358
           A F+YGG+E   L+  +Q NPR+S P A K  +YR+VV++LL +ILIGF+VPHNS +LL 
Sbjct: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLS 332

Query: 359 ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYA 418
           A GG+G  ASP+V+AA++HG++VVPHIIN +IL ++ISV NS++Y+ PR+L SLA+ G  
Sbjct: 333 AEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMC 392

Query: 419 PRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFS 478
           P+  +YVDR+GRPL  L+  +L G+I F A S +EE VFTWL+AI+GLS+LFTWT+I  S
Sbjct: 393 PKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVS 452

Query: 479 HIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDAN 538
           H+RFRRAM++Q +SL  LGY+ANTG  GSY+ + FN++V  AQFW+A++P    G+ D  
Sbjct: 453 HVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE 512

Query: 539 SFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERL 598
            FF +YLA P+ +VFY GY  W +DF ++   ++VDL +HR+++D E L QE+ E KERL
Sbjct: 513 FFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572

Query: 599 RNSS 602
           RNS+
Sbjct: 573 RNST 576

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/571 (50%), Positives = 381/571 (66%), Gaps = 29/571 (5%)

Query: 58  QVKNRHLQGFIDSFKRADDSPD--HN---DLEKTTTA----------------------- 89
           ++   +++ FIDSFKRA+  P+  HN   DLE   T                        
Sbjct: 79  EMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFE 138

Query: 90  HQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149
            +  KK++K RHV+M+SLGTGIGTGLLV N K L  AGPA LVI Y ++    Y +IQAA
Sbjct: 139 EEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAA 198

Query: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209
           GEMAV Y  L G FN Y S  +   FGFA  W++C+QWL V PLEL+T ++TIKYW T++
Sbjct: 199 GEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTV 258

Query: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXX 269
           +PD FV+IFYV ++FI  FG + Y E EF FN CKILMI GF I  I++N          
Sbjct: 259 NPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYL 318

Query: 270 XXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKS 329
               WHDPGAF  +NG  RFKGI    V+A F++G  E   L+  +Q NPRK+ P+AAK 
Sbjct: 319 GAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKK 378

Query: 330 NVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAV 389
            +YR++ I++ T+ L+GF+VP +S +L+GA GG+   ASPYVLA SIHG++VVPH INAV
Sbjct: 379 VLYRVICIFVGTIALLGFLVPWDSDQLMGA-GGSATKASPYVLAISIHGVRVVPHFINAV 437

Query: 390 ILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAAT 449
           ILI++ SVANS+ Y+  RLL  LAQQGYAP+F  YVDR+GRP  A+  +AL GVI F A 
Sbjct: 438 ILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAA 497

Query: 450 SPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYF 509
           SP+E++VFTWL AISGLS+LFTW +I  SHIRFRRAM +Q +SL  +G+KA  G++GSY+
Sbjct: 498 SPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYY 557

Query: 510 GVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTD 569
                +L   AQFWVA++P  + G  DA  FF +YLAMPI + FYFGY  W +D+ +   
Sbjct: 558 ATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIR 617

Query: 570 LNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
              +DLD++R+V+D E L+QED E KE+L+N
Sbjct: 618 AKDIDLDSYRQVFDEELLKQEDEEYKEKLKN 648

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/577 (49%), Positives = 379/577 (65%), Gaps = 40/577 (6%)

Query: 63  HLQGFIDSFKRAD----DSPD-------------------HNDLE-----------KTTT 88
           +L+ FIDSF+RA+    +SPD                    N+L            K + 
Sbjct: 76  YLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELNRKSSYITVDGIKQSP 135

Query: 89  AHQEQK-----KTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTY 143
             QEQK     K++K RH +MMSLGTGIGTGLLV N K L+ AGP  L+I Y ++    Y
Sbjct: 136 QEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVY 195

Query: 144 FMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIK 203
            +IQA GE+AV Y  L G FN Y  F +    GF+  WLFC+QWL V PLEL+TA+MTIK
Sbjct: 196 CIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIK 255

Query: 204 YWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX 263
           YW TS++PDVFV+IFYV ++ I+ FG + Y E +F FN CKILMI GF I AI+++C   
Sbjct: 256 YWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGA 315

Query: 264 XXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKST 323
                     W DPGAF       RFKG+    V A F++G +E   ++ ++Q NPRK+ 
Sbjct: 316 GTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 324 PAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVP 383
           P+AAK  +YRI+ ++L ++ L+GF+VP+ S +LLGA+ G+   ASPYV+A S HG++VVP
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAA-GSATKASPYVIAVSSHGVRVVP 434

Query: 384 HIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGV 443
           H INAVIL++++SVAN + Y   R+L SLA+QG AP+   Y+DR GRP  A+L+SAL GV
Sbjct: 435 HFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGV 494

Query: 444 IGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTG 503
           I F A+S +EE+VFTWL AISGLS+LFTW +I  SHIRFRRAMK+Q +SL  +GYK+  G
Sbjct: 495 IAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVG 554

Query: 504 LWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKD 563
           +WGS + V   +L   AQFWVA++P   GGK  A SFF +YLAMPIW+  Y  Y  W KD
Sbjct: 555 VWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKD 614

Query: 564 FTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
           +++    ++VDL +HR ++D E L+QED E KERLRN
Sbjct: 615 WSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRN 651

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/569 (49%), Positives = 378/569 (66%), Gaps = 33/569 (5%)

Query: 63  HLQGFIDSFKRAD----------------------DSPDHNDLE---------KTTTAHQ 91
             + F+DSFKRA+                      D  +  DLE         K+   ++
Sbjct: 45  QFRRFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNK 104

Query: 92  EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGE 151
           E K+T+K RHVI++SLGTGIGTGLLV N K L  AGPA L+I Y ++    Y +IQAAGE
Sbjct: 105 ELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGE 164

Query: 152 MAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDP 211
           +AV+Y +L G FN Y SF +   FGF+  W++CIQWL V PLEL+TA+MTIKYW T+++ 
Sbjct: 165 LAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNA 224

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
           D+FV IFYV ++ I+ FG + Y E EF FN CKILM+ GF I  IV+N            
Sbjct: 225 DIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGD 284

Query: 272 XXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNV 331
             WH PGAFA       FKGI   +V A F++G  E   L+  +Q NPRK+ P+AAK  +
Sbjct: 285 RYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVL 344

Query: 332 YRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVIL 391
           YRI+ I+L ++ L+GF+VP++S +L+G SGG+   ASPYVLA S HG+KVVPH INAVIL
Sbjct: 345 YRILFIFLGSITLVGFLVPYDSDQLMG-SGGSATKASPYVLAVSTHGVKVVPHFINAVIL 403

Query: 392 IALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSP 451
           ++++SV NS+ Y+  RLL SLAQQG AP+F  YVDR GRP  A++ + +  +I F A SP
Sbjct: 404 LSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASP 463

Query: 452 REEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGV 511
           +EE+VFTWL AISGLS++FTW +I  SHIRFR+AM +Q +SL  +G+KA TG+WGSY+  
Sbjct: 464 KEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVC 523

Query: 512 GFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLN 571
              +++  AQFWVA++P    GK DA  FF +YLAMPI ++FY GY  W KD+++    N
Sbjct: 524 FMLVMILIAQFWVAIAPIGE-GKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRAN 582

Query: 572 QVDLDNHRKVYDPEFLRQEDLENKERLRN 600
            +DLD HR+++D E L+QED E +E+L+N
Sbjct: 583 NIDLDKHRQIFDEELLKQEDEEYREKLKN 611

>Kwal_33.13215
          Length = 598

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/549 (53%), Positives = 385/549 (70%), Gaps = 19/549 (3%)

Query: 67  FIDSFKRADDSPDHNDLE--------------KTTTAHQEQKKTMKSRHVIMMSLGTGIG 112
           F DSF+R +    HN                 ++ + H+  K+ ++ RHV+M+SL TGIG
Sbjct: 44  FADSFRRHEA---HNGGGGDGDDEDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIG 100

Query: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172
           TG+LV NGK L   GPASLVI Y +VS + Y +IQ+A E+A+ Y +L G FNAY S  + 
Sbjct: 101 TGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVD 160

Query: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232
           K FGF+ +W++C+QWL VLPLEL+TA+MTIKYWN +I+PD FV IFYV L+ I+F G   
Sbjct: 161 KAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAG 220

Query: 233 YGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGI 292
           Y E EF FN CK+LMI GF I  I++NC             WHDPGAF  S+  +RFKGI
Sbjct: 221 YAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGI 280

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352
              LVNA F+YGG E  VL+  +Q+NP+KS  +A+K  VYRI+ IY++T IL+GF+VP N
Sbjct: 281 VAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWN 340

Query: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412
           S ELLG SGG+  HASP+V+A + HG++VVPH INAVIL++++SVANS+LY+  R+L SL
Sbjct: 341 SDELLG-SGGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSL 399

Query: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472
           ++QG+APRFL+YVDR GRP+  LL+S + G++ F A SP+EE VFTWL AISGLSELFTW
Sbjct: 400 SEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTW 459

Query: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532
            SI  SH+R RRAM +Q +S D LGY A TG+WG+Y+ +   + +   QFWVA+SP  S 
Sbjct: 460 FSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGS- 518

Query: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDL 592
            K DAN+FF +YLAMPI +  Y GY  W +D+ +L   ++VDL  HRK++D E LR E L
Sbjct: 519 NKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQL 578

Query: 593 ENKERLRNS 601
           E KE+LR++
Sbjct: 579 EEKEQLRHA 587

>Kwal_33.13204
          Length = 607

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/554 (50%), Positives = 378/554 (68%), Gaps = 9/554 (1%)

Query: 54  RFDVQVKNRHLQGFIDSFKRAD---DSPDHNDLE-KTTTAHQEQ---KKTMKSRHVIMMS 106
           +F         + F  +F RAD   D    ND+E     A Q +   K+T+  RHV MMS
Sbjct: 44  KFHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMS 103

Query: 107 LGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAY 166
           LGTGIGTG+LV NGK L   GPA LVI Y ++    Y +IQAAGE+AV+Y +L G+FNAY
Sbjct: 104 LGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAY 163

Query: 167 TSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIH 226
            S  I + FGF+  W++C+QWL VLPLEL+TA++TIKYW TS++PD+FV IFYV ++ ++
Sbjct: 164 PSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVN 223

Query: 227 FFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGA 286
            FG + Y E EF FN CK+LMI GF I  I+VNC             W++PGAF  +   
Sbjct: 224 MFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPI 283

Query: 287 SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346
             FKGI   +V A F++G  E   L+  +Q NPR++ P+AAK  VYRI++I+L  ++LIG
Sbjct: 284 HHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIG 343

Query: 347 FVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGP 406
           F+VPHNS EL+G SG +  HASPYV+A + HG++VVPH INAVIL++++SV NS+ Y+  
Sbjct: 344 FLVPHNSPELMG-SGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSS 402

Query: 407 RLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGL 466
           RLL +LA Q YAP +L ++DR GRP+ A+L+S + G+I F A SP+EE VFTWL AISGL
Sbjct: 403 RLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGL 462

Query: 467 SELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVAL 526
           S+LFTW SI  SHIRFR+A+ +Q K +  LGYK+ TG+ GSY+       +   QFWVA+
Sbjct: 463 SQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAI 522

Query: 527 SPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEF 586
           +P  S  K DANSFF +YLA+P+++V YFG+  W +D+ +   L Q+DLD+HRK +D E 
Sbjct: 523 APMGS-AKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEEL 581

Query: 587 LRQEDLENKERLRN 600
           L+QED E +E +RN
Sbjct: 582 LKQEDAEYEENIRN 595

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/561 (50%), Positives = 381/561 (67%), Gaps = 11/561 (1%)

Query: 52  RSRFDVQVKNRHLQGFIDSFKRAD--DSPDHNDLEKTTTAHQEQ--------KKTMKSRH 101
           +S  +   K+     F DSFKRAD  ++  H + E      Q          K+ +K RH
Sbjct: 51  QSDEEYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRH 110

Query: 102 VIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPG 161
           V+MMSL TGIGTGLLV NGK L+  GPA L I Y ++    Y +IQAAGE+AV YPTL G
Sbjct: 111 VVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTG 170

Query: 162 SFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVF 221
           +FN Y SF +     FAT  L+CIQWL V PLE+I+AA+TIKYWNTSI+P+V+ +IFYV 
Sbjct: 171 NFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVM 230

Query: 222 LMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFA 281
           ++ I+  G   Y E +F FN CKILM  GF I  I++NC             W+DPGAF 
Sbjct: 231 IIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFN 290

Query: 282 SSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLT 341
              G SRFK I   LV A F++G +E   L+ ++Q NPRK+ P+AAK  +YRI+ IYL +
Sbjct: 291 GDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLAS 350

Query: 342 MILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSS 401
           +IL+GF+VP+NS EL+  SG + +H+SPYV+A + HG+KVVP  INAVILI+++SV N S
Sbjct: 351 IILVGFLVPYNSPELM-GSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFS 409

Query: 402 LYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLA 461
            Y+  R+L  L++ GYAP+F  YVDR+GRPL A+++ ALVG I F + S  EE VFTWL 
Sbjct: 410 FYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLM 469

Query: 462 AISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQ 521
           A+SGLS+LFTWT+I  SH+RFR+AM++QN+S+  LG+++  G+WGSY+G+   ILVF  Q
Sbjct: 470 AVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQ 529

Query: 522 FWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKV 581
           FWVAL P       DA +FFA+YLAMP++L  YFG+  W KD+ +    +++DL +HRK+
Sbjct: 530 FWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKI 589

Query: 582 YDPEFLRQEDLENKERLRNSS 602
           +D E L+QED E K +++++S
Sbjct: 590 FDEEILKQEDEEYKIKMKHAS 610

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/540 (50%), Positives = 362/540 (67%), Gaps = 33/540 (6%)

Query: 58  QVKNRHLQGFIDSFKRADDSPDH---------------------NDLEK--------TTT 88
           Q     ++ F DSFKRAD  P                        +LEK          T
Sbjct: 50  QHNTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANT 109

Query: 89  AHQEQ--KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMI 146
            H+    KKT++ RHV+M++LGTGIGTGLLV NG  L  AGPA L+I Y ++  + Y +I
Sbjct: 110 GHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCII 169

Query: 147 QAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWN 206
           QA GEMA+ Y  L G +NAY SF +   FGFA  W++C+QWL V PLEL+TA+MTIKYW 
Sbjct: 170 QACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWT 229

Query: 207 TSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXX 266
           TS++PDVFVIIFYV ++ I+ FG + Y E EF FN CKILM+ GF I  I+++       
Sbjct: 230 TSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGND 289

Query: 267 XXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326
                  WHDPGAF   +   RFKG+   LV A F++GG+E   ++  +Q NPRK+ P A
Sbjct: 290 GFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGA 349

Query: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHII 386
           AK  +YRI+ ++L T+IL+GF+VP+NS +LLG++GG G  ASPYV+A + HG++VVPH I
Sbjct: 350 AKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGG-GTKASPYVIAVASHGVRVVPHFI 408

Query: 387 NAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGF 446
           NAVIL++++S+ANSS Y+  RL  +L++QGYAP+  SY+DR GRPL A+ +SAL  VI F
Sbjct: 409 NAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAF 468

Query: 447 AATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWG 506
            A SP+EE+VFTWL AISGLS+LFTWT+I  SH+RFRRAMK+Q +SL  LG+K+ TG+WG
Sbjct: 469 CAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWG 528

Query: 507 SYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTV 566
           S +     IL+  AQFWVA++P    GK DA +FF +YLAMPI +  Y GY  W+KD+ +
Sbjct: 529 SAYACIMMILILIAQFWVAIAPIGE-GKLDAQAFFENYLAMPILIALYVGYKVWHKDWKL 587

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/540 (50%), Positives = 374/540 (69%), Gaps = 15/540 (2%)

Query: 64  LQGFIDSFKRADDSP--DHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGK 121
           ++GFIDSF+R  D       D E  TTA  + KKT+K+RH++M++LGTGIGTGLLV NG 
Sbjct: 36  MRGFIDSFRRGRDVDLMCKADAEDGTTA--KMKKTIKTRHLLMITLGTGIGTGLLVGNGS 93

Query: 122 GLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTW 181
            L+ AGPA L++ Y + S + Y +++AAGE+ + Y  + G++ AY+S  +    GF+ +W
Sbjct: 94  ALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSW 153

Query: 182 LFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFN 241
           ++CIQW+TV PL+L+TAAM I+YW T I+PD+FV I Y  ++FI+ FG + Y E EF FN
Sbjct: 154 VYCIQWMTVFPLQLVTAAMIIQYW-TDINPDIFVAIIYAVIVFINLFGAKGYAEAEFFFN 212

Query: 242 ACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYF 301
            CK+LMI GF+I  +V+NC             WH+P  F   NG   FKG+C+    A F
Sbjct: 213 LCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPFM--NG---FKGLCFVFCYAAF 267

Query: 302 SYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASG 361
           +YGG E+ VLS ++Q+NPRKS  +A K  +YRIV+IYLLT +++ F+VP +   L     
Sbjct: 268 AYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL----A 323

Query: 362 GNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421
             G  ASP V+A S HG+K+VPHIINAVILIA++SV NSSLY+ PRLL SLA+QGYAP+ 
Sbjct: 324 SEGSRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKI 383

Query: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481
            +Y+DR+GRPL A  ++ + G++ F A SP +++VF WL AISGLS++F W SI  SHIR
Sbjct: 384 FTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIR 443

Query: 482 FRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFF 541
           FR AMK Q +S+  +GYKA TG WGS+  V    L+  AQFWVA+SP  + G  DA SFF
Sbjct: 444 FRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKG-VDARSFF 502

Query: 542 ASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNS 601
            SYLA PI L+ YFGY  ++KD+ +    ++VDL +HR+V+D + L+QEDLE K +L++S
Sbjct: 503 QSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKSS 562

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/556 (49%), Positives = 374/556 (67%), Gaps = 7/556 (1%)

Query: 52  RSRFD-VQVKNRHLQGFIDSFKRADDSPDHNDLEKT--TTAHQEQKKTMKSRHVIMMSLG 108
           +S F+ ++  +   + F+ SFKRA  S   +          H+  K+T+KSRH+IM+SLG
Sbjct: 46  KSDFEYLEGDDTRFKRFLSSFKRAHGSGGTDTEGGGGQNAKHENLKQTIKSRHMIMISLG 105

Query: 109 TGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTS 168
           TGIGTGLLV +G  L   GPA   I + ++    Y +IQAAGE+AV Y +L G FNAY S
Sbjct: 106 TGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPS 165

Query: 169 FFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIH 226
           F I    GFAT W++C+QWL V PLEL+TA++TIK+W  + S++PD++V IFYV ++ I+
Sbjct: 166 FLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVIN 225

Query: 227 FFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGA 286
           FFG + Y E EF FN+CK+LM+ GF I  I++N              W DPG+       
Sbjct: 226 FFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHF 285

Query: 287 SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346
             FKGI   LVNA FS G +E   L+  +Q NPRKS PAAAK  +Y+I V++L ++ILIG
Sbjct: 286 DHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIG 345

Query: 347 FVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGP 406
           F+VP +S EL+G++  + LH SPYV+A  +HG+ VVP  INAVIL++++SV NS+ Y+  
Sbjct: 346 FLVPKDSHELMGSNDSD-LHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSS 404

Query: 407 RLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGL 466
           RLL SLA+Q YAP+   Y+DR GRPL A+++S L G I F A SP+EEEVF WL AISGL
Sbjct: 405 RLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGL 464

Query: 467 SELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVAL 526
           S+LFTW++I  SHIRFRRA+ +Q  S D LG+KA TG+ GSY      +L    QFWV+L
Sbjct: 465 SQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSL 524

Query: 527 SPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEF 586
            P  +  + DA SFF  YLAMP++L+FYFGY  W KD+ +    +Q+DL +HR+++D + 
Sbjct: 525 VPMGA-TEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADV 583

Query: 587 LRQEDLENKERLRNSS 602
           L+QED+E + +LRNSS
Sbjct: 584 LKQEDIEYRAKLRNSS 599

>Scas_517.2
          Length = 679

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/575 (48%), Positives = 375/575 (65%), Gaps = 35/575 (6%)

Query: 60  KNRHLQGFIDSFKRADDSP---------DHNDLEK----------------------TTT 88
           K   ++ F+DSFKRA+  P           +DLE                         +
Sbjct: 94  KPSRIRNFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNS 153

Query: 89  AHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQA 148
              E KKT+K RHV+M+SLGTGIGTGLLV  G  L  AGPA L+I +G++    Y +IQA
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 149 AGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTS 208
            GE+AV Y  L G FNAY SF + + F FA  WL+ IQWL V PLEL+TA+MTIKYW T 
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 209 IDPDVFVIIFYVFLMFIHFFGVQA-YGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXX 267
           +DPD+FVIIFY+ ++ I+  G  A Y E EFIFN+CKI+M+ GF I  I V C       
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 268 XXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAA 327
                 WHDPGA        RFKG    LVNA F++G +E   ++ ++Q NPRK+ P+AA
Sbjct: 334 YIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAA 393

Query: 328 KSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIIN 387
           K  +YRI+ ++L ++ ++GF+VP+NS +LLG++G +G+ ASPYVLA S HG++VVPH IN
Sbjct: 394 KKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTG-SGVKASPYVLAISTHGVRVVPHFIN 452

Query: 388 AVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFA 447
           AVILI+++SVANS+ Y+  R+L SLA+QGYAP+  SY+DR GRPL  +  +A+ GVI F 
Sbjct: 453 AVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFC 512

Query: 448 ATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGS 507
           ATSP+E+EVF WL AISGLS+LFTW +I  SHIRFRRAM +Q +S+  LG+++  G +GS
Sbjct: 513 ATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGS 572

Query: 508 YFGVGFNILVFAAQFWVALSPPNSGG--KCDANSFFASYLAMPIWLVFYFGYMCWYKDFT 565
            +      ++  AQFWVAL P N+    K DA +FF +YLAMPI L FYFGY  W KD+ 
Sbjct: 573 AYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWK 632

Query: 566 VLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
           +      +DL +HR ++D E ++QE+ E +ERLR 
Sbjct: 633 LFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRT 667

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 274/543 (50%), Positives = 366/543 (67%), Gaps = 9/543 (1%)

Query: 59  VKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           +  R  + F DSFKR    PD N  E  +       K++KSRH++M+SLGTGIGTGLLV 
Sbjct: 58  ILQRKCKEFFDSFKR-QLPPDRNS-ELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVG 115

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           NG+ L  AGPA LV+ YG+ S + Y +IQAAGE+ + Y  L G++  Y S  +    GFA
Sbjct: 116 NGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFA 175

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
            + ++ IQWLTVLPL+L+TAAMT+KYW TS++ D+FV + +VF++ I+ FG + Y E EF
Sbjct: 176 VSVVYTIQWLTVLPLQLVTAAMTVKYW-TSVNADIFVAVVFVFVIIINLFGSRGYAEAEF 234

Query: 239 IFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVN 298
           IFN+CKILM+ GF+I AI++NC             WH+PG FA       FKG+C     
Sbjct: 235 IFNSCKILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFAHG-----FKGVCTVFCY 289

Query: 299 AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLG 358
           A FSYGG E+ +LS  +Q+NP KS P A K  VYRI++IY+LT IL+ F+VP+NS ELLG
Sbjct: 290 AAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLG 349

Query: 359 ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYA 418
           +S  +G HASP+V+A + HG+KVVPH INAVILI++ISVANSSLY+GPRLL SLA+QG  
Sbjct: 350 SSDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVL 409

Query: 419 PRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFS 478
           P+ L+YVDR GRPL    +S + G IGF ATS  EE+VFTWL AIS LS+LF W S+  S
Sbjct: 410 PKCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLS 469

Query: 479 HIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDAN 538
           HIRFR AM  Q +S++ +GYKA TG WGS+  V   I     QFWVA++P N  GK +  
Sbjct: 470 HIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVK 529

Query: 539 SFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVY-DPEFLRQEDLENKER 597
            FF +YLAMPI L  YFG+  ++K ++      ++DLD+HR ++  P     + +++ + 
Sbjct: 530 VFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDD 589

Query: 598 LRN 600
           L+ 
Sbjct: 590 LKE 592

>Kwal_27.12681
          Length = 593

 Score =  461 bits (1187), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 341/549 (62%), Gaps = 10/549 (1%)

Query: 56  DVQVKNRHLQGFIDSFKRADDS---PDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTG 110
             Q      Q F D FKR +     P+  + EK    TA    ++ +K+RH+ M+++G  
Sbjct: 35  QTQASKSRWQDFKDGFKRVELEELDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGA 94

Query: 111 IGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFF 170
           IGTGL V +GK L   GPA ++I +GL+  + Y ++ + GE+AVT+P + G F  Y + F
Sbjct: 95  IGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP-VSGGFTTYATRF 153

Query: 171 ISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSID-PDVFVIIFYVFLMFIHFFG 229
           + + FGFA  + + +QWL VLPLE++ A++T+ +W T     D FV +FY+ ++ I+FFG
Sbjct: 154 VDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFG 213

Query: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRF 289
           V+ YGE EF+F+  K++ + GFII  IV+ C             WH+PGAF+  +  SRF
Sbjct: 214 VRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRF 273

Query: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349
           KG+C   V A FS+ G EL  L+  +  NPRK+ P AAK   +RI++ Y++++ LIG +V
Sbjct: 274 KGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLV 333

Query: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409
           PH S  L+G S  +   ASP+VLA   HGIK +P +IN VILI+++SV NS++YA  R +
Sbjct: 334 PHTSERLIGTSSVDA-AASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSM 392

Query: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469
            +LA+QG  P   +Y+DR+GRPL A++ + + G++ F A S +E +VF WL A+SGLS L
Sbjct: 393 VALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTL 452

Query: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529
           F+W +I   HIRFRRA+  Q +S D L + +  G+ GSYFGV   +LV  AQFWVA+ P 
Sbjct: 453 FSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWP- 511

Query: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589
             GG  +A  FF++YL+ P+ L FY  +  W +++ + T    +D+D  R+  D E LRQ
Sbjct: 512 -IGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQ 570

Query: 590 EDLENKERL 598
           E  E K  L
Sbjct: 571 EIAEEKMLL 579

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  458 bits (1178), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 229/526 (43%), Positives = 335/526 (63%), Gaps = 12/526 (2%)

Query: 79  DHNDLEKTTTAHQEQ---KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAY 135
           D +D EK ++   E    ++++K RHV M+S+ TGIGTGLLV NGK ++ AG    +I Y
Sbjct: 8   DCSDAEKLSSEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGY 67

Query: 136 GLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLEL 195
            ++  +    +Q+ GE+ V +P+L G FN+Y   FI    GF  +WLFC+QW+ VLPLEL
Sbjct: 68  LIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLEL 127

Query: 196 ITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFA 255
           +TA+MTIKYWN+++ P +FV  FY+ +  ++FFG   Y E EFIFN  K++++  FI+  
Sbjct: 128 VTASMTIKYWNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLG 187

Query: 256 IVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVND 315
           IV+                  PGAF ++     FK     LVNA FS GG E   LS  +
Sbjct: 188 IVIITGGLGNSGPIGFQYLKTPGAFNTNYNV--FKATAGTLVNAAFSCGGVEFLALSAAE 245

Query: 316 QK--NPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLA 373
           Q   N  KS   A +    R+ V YLL++ ++G +VP++S  L+G SG +  H SPYV A
Sbjct: 246 QNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMG-SGSDTTHTSPYVAA 304

Query: 374 ASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLT 433
            ++HG+++VPHIINAVILIA++SVANS++Y+  R L SLA+Q +APR+ + +++ G+P+ 
Sbjct: 305 IALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMR 364

Query: 434 ALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSL 493
            L++SA+VG+I F A    +E VF WL +ISGLS +FTWT+I  +HIRFR A+KLQ +SL
Sbjct: 365 CLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSL 424

Query: 494 DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVF 553
           DTLGY++NTG+ GSY     N++V   QFWV+L P  + GK DA  FF +Y+A+P+ ++ 
Sbjct: 425 DTLGYRSNTGVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLL 484

Query: 554 YFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLR 599
           Y G+  +  D+T     + VD++  R VY P     +DL  K  ++
Sbjct: 485 YLGHKLYTNDWTPWIRTHCVDINTDRDVYAPS----DDLSTKGVVK 526

>Scas_718.41
          Length = 614

 Score =  454 bits (1168), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 256/520 (49%), Positives = 347/520 (66%), Gaps = 11/520 (2%)

Query: 63  HLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKG 122
           + Q F  SFKR D   D +D+E   T   +  KT+KSRH++M+SLGTGI TGLLV NG+ 
Sbjct: 75  YFQDFCHSFKRKDSDLD-SDVEAQDT---QLSKTIKSRHLLMISLGTGIATGLLVGNGQV 130

Query: 123 LSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWL 182
           L+ AGPA L+I Y + S + Y +I AAGE+ + Y  L G+F  Y S  I    GFA + L
Sbjct: 131 LAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLL 190

Query: 183 FCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNA 242
           + +QWLTVLPL+L+TAA+TI +W T ++PD+FV+  ++ ++ ++ FG + Y ETEF  N 
Sbjct: 191 YTLQWLTVLPLQLVTAAITISFW-TDVNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNC 249

Query: 243 CKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFS 302
           CKILMI GFII +IV+               W  PG FA       FKG+C     A FS
Sbjct: 250 CKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFAHG-----FKGVCTVFTYAAFS 304

Query: 303 YGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGG 362
           YGG E+ VLS+++Q++P  + P A K  VYRI++IYLLT IL+ F+VP++S  LLG+S  
Sbjct: 305 YGGIEVVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHS 364

Query: 363 NGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFL 422
              HASP+V+A   HG+KVVPH INAVILI++ISVANSSLY+  RLL SL++QG  P++L
Sbjct: 365 G-SHASPFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWL 423

Query: 423 SYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRF 482
           +++D  GRP+   ++S L G+IGF A S + E+VFTWL AISGLS+LF W S+  SHIR 
Sbjct: 424 NFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRL 483

Query: 483 RRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFA 542
           R AMK Q KSLD +GYKA TG WGS+  V         QFWVA++P    G+ D  +FF 
Sbjct: 484 RDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQ 543

Query: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVY 582
           +YLA PI LV Y G+  +YK++ +    +++DLD+HR++Y
Sbjct: 544 NYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  452 bits (1164), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 225/535 (42%), Positives = 333/535 (62%), Gaps = 12/535 (2%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           D +    +   T + +++ K+++K  HV M+++ TGIGTGLLV NGK +S AG    ++ 
Sbjct: 52  DSTTGKTEKGHTGSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVG 111

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           Y ++  +    +Q+ GE+ V +P+L G FN+Y   F+   FGF   WLFC+QW  VLPLE
Sbjct: 112 YFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLE 171

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
           L+TA+MTIKYWN S++P +FV IFY  ++ I FFG + Y + EF+FN  K+LMI GFII 
Sbjct: 172 LVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIIL 231

Query: 255 AIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVN 314
            I+++                 PGAF + N    FK IC  LVNA FS GG E   LS  
Sbjct: 232 GIIISFGAAGTSGYIGIKYLKTPGAFNTRN---TFKSICSTLVNACFSCGGVEFLALSAA 288

Query: 315 DQK--NPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372
           +Q   N  KS   A    + R+ V Y+L++ +IG +VP+NS EL+G+S    +H+SPYV+
Sbjct: 289 EQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSS-EIIHSSPYVI 347

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432
           A + HG+KVVPH+INAVILIA++SVANS++Y+  R L +LA+QG+AP + + +D +GRP 
Sbjct: 348 AVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPF 407

Query: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS 492
             L++S + G++ F A    +E VF WL +ISGLS +FTWT I  +H+RFR AMK QN S
Sbjct: 408 RCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHS 467

Query: 493 LDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552
           L+ LG++A +G++GSY+ +  N L    QFWV+L P +  G+ D  +FF +Y+A+P  L 
Sbjct: 468 LEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALC 527

Query: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPE------FLRQEDLENKERLRNS 601
            Y G+  + + +  +   +++D+D  R +Y  E      F+   D  N    + +
Sbjct: 528 LYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVENRTGHIFMAHCDANNPNGFKET 582

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  450 bits (1158), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/594 (41%), Positives = 361/594 (60%), Gaps = 34/594 (5%)

Query: 9   EVKVSSSEDSQILSKSNDYVHEQNHIIEGXXXXXXXXXXXHNLRSRFDVQ-VKNRHLQGF 67
           E K+  S D +   +S ++ HEQN  +                 S+ D   V+    + F
Sbjct: 4   EKKLDYSIDQETQLESGEF-HEQNSYV-----------------SQSDASPVEGTRWERF 45

Query: 68  IDSFKRADDS---PDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKG 122
            DSFKRAD     P+  D EK    TA+   K+T+KSRH+ M+++G  IGTGL V +GK 
Sbjct: 46  RDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKA 105

Query: 123 LSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWL 182
           L+ AGPA ++I + L   + Y M+ A GE+AVT+P + G F  Y S F+ + FGFA   +
Sbjct: 106 LATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFVDESFGFAFNTI 164

Query: 183 FCIQWLTVLPLELITAAMTIKYWNTSID-PDVFVIIFYVFLMFIHFFGVQAYGETEFIFN 241
           + +QWL VLPLE++ A++T+ YW T     D FV +FYV ++ I+FFGV+ YGE EFIF+
Sbjct: 165 YMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEAEFIFS 224

Query: 242 ACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYF 301
             K++ + G+II  +++ C             WH+PGAFA  NG   FKG+C   V A F
Sbjct: 225 FIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA--NG---FKGVCSVFVTAAF 279

Query: 302 SYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASG 361
           S+ G+EL  L+  +  NPRKS P+AAK   +RI + Y+L ++++G +VP+ S  L+G S 
Sbjct: 280 SFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSS 339

Query: 362 GNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421
            +   ASP+V++    GIK +P +IN VILIA++SV NS+++A  R +++LA QG  P+ 
Sbjct: 340 VDA-AASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGSLPKI 398

Query: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481
             Y+DR GRPL  ++++ + G++ F A SP+E EVF WL A+SGLS LFTW  IM  HIR
Sbjct: 399 FGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIR 458

Query: 482 FRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFF 541
            RRA+  QN++   L + A TG+WGS +G    IL+  AQFW+AL P   G K  A++FF
Sbjct: 459 VRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFP--IGDKPSASAFF 516

Query: 542 ASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595
            +YL+ PI + FY G+  W K++ +      +D+D  R+  D E L+QE  E K
Sbjct: 517 EAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  449 bits (1154), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 234/542 (43%), Positives = 345/542 (63%), Gaps = 14/542 (2%)

Query: 65  QGFIDSFKRADD---SPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSN 119
           + F DSFK  D+   + D +D+EK    TAH   K  +K+RH+ M+++G  IGTGL V +
Sbjct: 48  RKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGS 107

Query: 120 GKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFAT 179
           G  L  AGPA ++I +GL   + Y M+ A GE++V +P + G F  Y + FI + FGFA 
Sbjct: 108 GTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGFAN 166

Query: 180 TWLFCIQWLTVLPLELITAAMTIKYWNTSIDP---DVFVIIFYVFLMFIHFFGVQAYGET 236
            + + +QWL VLPLE++ A++T+ YW T  DP   D FV +F+V ++ I+ FGV+ YGE 
Sbjct: 167 NFNYMLQWLCVLPLEIVAASITVNYWGT--DPKYRDGFVALFWVVIVIINLFGVKGYGEA 224

Query: 237 EFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNL 296
           EF+F+  K+L + GFII  IV+NC             +HDPGAF      +RF+G+C   
Sbjct: 225 EFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVF 284

Query: 297 VNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSEL 356
           V A FS+ G+EL  ++  +   PRKS P AAK   +RI + Y+L+++++G +VP+    L
Sbjct: 285 VTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERL 344

Query: 357 LGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQG 416
           +GAS  +   ASP+V+A + HGI+ +P ++N VILIA++SV NS++Y   R L +LAQQ 
Sbjct: 345 IGASSVDA-AASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQN 403

Query: 417 YAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIM 476
           + P+   Y+DR GRPL  +  ++  G++ F A S +E EVF WL A+SGLS LFTW  I 
Sbjct: 404 FLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGIC 463

Query: 477 FSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCD 536
           F HIRFR A+  Q +S D L +KA  G++GS +G+   +L+F AQF+VAL PP  GGK  
Sbjct: 464 FCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPP--GGKPS 521

Query: 537 ANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKE 596
           A  FF SYL+ P+ L FYFG+  + +++ +L  L+++D+D  R+  D + LRQE  E K+
Sbjct: 522 AEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQ 581

Query: 597 RL 598
            +
Sbjct: 582 MM 583

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  440 bits (1132), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 229/539 (42%), Positives = 342/539 (63%), Gaps = 14/539 (2%)

Query: 65  QGFIDSFKRA---DDSPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSN 119
           Q F DSFKR    +  P+ ++ EK    TA    K  +K+RH+ M+++G  IGTGLLV +
Sbjct: 53  QDFKDSFKRVKPIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGS 112

Query: 120 GKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFAT 179
           G  L   GPASL+I +G    + Y M+ A GE+AV +P + G F  Y + FI + FG+A 
Sbjct: 113 GTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYATRFIDESFGYAN 171

Query: 180 TWLFCIQWLTVLPLELITAAMTIKYWNTSIDP---DVFVIIFYVFLMFIHFFGVQAYGET 236
            + + +QWL VLPLE+++A++T+ +W T  DP   D FV +F++ ++ I+ FGV+ YGE 
Sbjct: 172 NFNYMLQWLVVLPLEIVSASITVNFWGT--DPKYRDGFVALFWLAIVIINMFGVKGYGEA 229

Query: 237 EFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNL 296
           EF+F+  K++ + GFII  I++NC             WHDPGAFA     ++FKG+C   
Sbjct: 230 EFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVF 289

Query: 297 VNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSEL 356
           V A FS+ G+EL  L+ ++   PRKS P AAK   +RI + Y+L++++IG +VP+N   L
Sbjct: 290 VTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSL 349

Query: 357 LGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQG 416
           +GAS  +   ASP+V+A   HGIK +P ++N VILIA++SV NS++YA  R + +LA+Q 
Sbjct: 350 IGASSVDA-AASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQR 408

Query: 417 YAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIM 476
           + P   SYVDR+GRPL  + +++  G+I F A S +E EVF WL A+SGLS LFTW  I 
Sbjct: 409 FLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGIC 468

Query: 477 FSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCD 536
             HIRFR+A+  Q + LD L +K+ TG+WGSY+G+   I++F AQF+VA+ P   G    
Sbjct: 469 ICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFP--VGDSPS 526

Query: 537 ANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595
           A  FF +YL+ P+ +V Y G+  + +++ +     ++D+D  R+  D + L+QE  E K
Sbjct: 527 AEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQEIAEEK 585

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  437 bits (1125), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/527 (42%), Positives = 327/527 (62%), Gaps = 4/527 (0%)

Query: 76  DSPDHNDLEKTTTAHQEQK--KTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVI 133
           D  D ND+EK     ++ K  K +  RH++ +++G  IGTGL V++G  LS  GPASLVI
Sbjct: 45  DYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVI 104

Query: 134 AYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPL 193
           A+ ++S   + ++ + GE++ T+P + G FN Y + F+   FGFA  + +  QW  +LPL
Sbjct: 105 AWTIISTCLFTIVNSLGELSATFPVV-GGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPL 163

Query: 194 ELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFII 253
           EL  A++TI+YWN SI+PD +V IFYV + F +   V+++GETEF+ +  KIL I GF I
Sbjct: 164 ELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTI 223

Query: 254 FAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSV 313
             IV+ C             W+DPGAF     A RFKG+    + A FSY G EL  +S 
Sbjct: 224 LGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSA 283

Query: 314 NDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLA 373
            + +NPR + P AAK   + I + YL+ + LIG +VP N   LL  +      ASP V+A
Sbjct: 284 AESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIA 343

Query: 374 ASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLT 433
               GIK +P ++NA+ILIAL+SVANS++YA  R + S+A+ G  PR L++VD++GRPL 
Sbjct: 344 IQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLY 403

Query: 434 ALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSL 493
           A+ ++ LVG++ F A S + +EVFTWL+A+SGLS LF W +I  +H+RFR AMK QN+SL
Sbjct: 404 AIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSL 463

Query: 494 DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVF 553
           + L Y + TG WGS++G     LV  A FW +L P    G  DA SFF SYL++PI++  
Sbjct: 464 EELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNG-ADATSFFESYLSLPIFIAC 522

Query: 554 YFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
           Y G+  W ++  +   L++VD+D+ R   D   L+QE     E ++ 
Sbjct: 523 YLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKT 569

>Kwal_33.15407
          Length = 587

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 218/541 (40%), Positives = 327/541 (60%), Gaps = 11/541 (2%)

Query: 71  FKRADDSPDHN-----DLEKTT-TAHQEQK---KTMKSRHVIMMSLGTGIGTGLLVSNGK 121
           FK+AD +  +      ++E T+ T+  E     K +  RH++ +++G  IGTGL V++G 
Sbjct: 39  FKKADAASGNESWALENVESTSGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGS 98

Query: 122 GLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTW 181
            L+  GP SLVI + ++S   + ++ A GE++ T+P + G FN Y S F+   FGFA   
Sbjct: 99  ALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVV-GGFNVYISRFVEPSFGFAVNL 157

Query: 182 LFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFN 241
            +  QW  +LPLEL+ A++TI+YWN++I+ D +V IFY  +   +   V+++GETEF+ +
Sbjct: 158 NYLAQWAVLLPLELVAASLTIRYWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLS 217

Query: 242 ACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYF 301
             KIL I GF I  IV+ C             W +PGAF  +  + RF G+C   V A F
Sbjct: 218 MVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAF 277

Query: 302 SYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASG 361
           SY G EL  +S  +  NPR + P A K   + I V Y++ + L+G +VP +   LL  S 
Sbjct: 278 SYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSS 337

Query: 362 GNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421
              + ASP V+A    GIK +P ++NA+ILIA++SVANS++YA  R ++S+A+ G  P+ 
Sbjct: 338 SVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKT 397

Query: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481
            SYVDR+GRPL A+L + + G++ F A S ++E VFTWL+A+SGLS LF W +I  SHIR
Sbjct: 398 FSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIR 457

Query: 482 FRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFF 541
           FR  MK + +SLD L + + TG+WGSY+G     +V    FW AL  P++ G   A SFF
Sbjct: 458 FRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLVVCFWTALF-PSTEGVASAESFF 516

Query: 542 ASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNS 601
            +YL+ PI LV Y G+  + K + +LT   ++D+D+ R+  D E L+ E    ++ +R  
Sbjct: 517 ETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

Query: 602 S 602
           S
Sbjct: 577 S 577

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 215/526 (40%), Positives = 321/526 (61%), Gaps = 5/526 (0%)

Query: 76  DSPDHNDLEKT---TTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132
           D P  +D E     T    +  K +  RH++ +++G  IGTGL V++G  L+  GPASL+
Sbjct: 68  DVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLI 127

Query: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192
           +A+ +VS   + ++ A GE+A  +P + G FN Y + F+   FGFA    +  QW  +LP
Sbjct: 128 VAWVIVSTCLFTIVNALGELAAVFPVV-GGFNVYITRFVEPSFGFAVNINYLAQWAVLLP 186

Query: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252
           LEL+ A++TI+YWN +I+ D +V IFY  +   +   V+++GETEF+ +  KIL I GF 
Sbjct: 187 LELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFT 246

Query: 253 IFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLS 312
           I  IV+ C             W+DPGAF       RFKG+C   V A FSY G EL  +S
Sbjct: 247 ILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVS 306

Query: 313 VNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372
             +  NPR + P A+K   + I + Y+  + +IG +VP+N   LL  +      ASP V+
Sbjct: 307 AAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVI 366

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432
           A    GIK +P ++NA+ILIA++SVANS++YA  R + ++A+ G  P+ L+Y+D+RGRPL
Sbjct: 367 AIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPL 426

Query: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS 492
            A+  + + G++ F A S ++EEVFTWL+A+SGLS LF W SI  SHIRFR+AMK Q++S
Sbjct: 427 YAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRS 486

Query: 493 LDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552
           L+ L + + TG++GS++G     LV  A FW +L P  S G  DA SFF  YL++PI++V
Sbjct: 487 LNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDG-ADAESFFEGYLSLPIFIV 545

Query: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERL 598
            Y G+  + KD+ +      +DLD  R+  D + L+QE    +E++
Sbjct: 546 CYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQM 591

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  419 bits (1077), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 218/523 (41%), Positives = 314/523 (60%), Gaps = 10/523 (1%)

Query: 69  DSFKRADDSPDHNDLEKTTTA--------HQEQKKTMKSRHVIMMSLGTGIGTGLLVSNG 120
           D   + D      D++ T  A        +    K +  RH++ +++G  IGTGL V++G
Sbjct: 56  DDILKGDTKEYPRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSG 115

Query: 121 KGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATT 180
             L+  GPASLVI + +VS   + +I + GE+A  +P + G FN Y + FI   F FA  
Sbjct: 116 ASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVV-GGFNVYITRFIEPSFAFAIN 174

Query: 181 WLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIF 240
             +  QWL +LPLEL+ A++TI+YWN  I+ D +V IFY  +   +   V+++GETEFI 
Sbjct: 175 LNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFIL 234

Query: 241 NACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAY 300
           +  KIL I GF I  IV+ C             WH+PGAF   +  S+FKG+C   V A 
Sbjct: 235 SMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAA 294

Query: 301 FSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGAS 360
           FSY G E+  +S  + +NP+++ P AAK   + I V Y+  + LIG +VP+N   LL  S
Sbjct: 295 FSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGS 354

Query: 361 GGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR 420
                 ASP V+A    GIK +P ++NA+ILIA++SVANS++YA  R + S+A  G  P+
Sbjct: 355 SSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPK 414

Query: 421 FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI 480
           FLS VD+RGRPL A+LL+   G++ F A S ++EEVFTWL+A+SGLS +F W +I  S I
Sbjct: 415 FLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLI 474

Query: 481 RFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSF 540
           RFR AMK Q +SLD + + + +G WG+++GV    LV  A FW +L P  S     A SF
Sbjct: 475 RFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGS-STASAKSF 533

Query: 541 FASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
           F  YL++PI +  Y G+  W +D+ +L  L ++DLD+ R+V D
Sbjct: 534 FEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  419 bits (1076), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 215/515 (41%), Positives = 314/515 (60%), Gaps = 8/515 (1%)

Query: 69  DSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128
           D F+R +D+ +  D+  T  +     K +  RH++ +++G  IGTGL V+ G  LS  GP
Sbjct: 68  DRFRRNEDT-EQEDINNTNLS-----KDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGP 121

Query: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188
           ASLVI + ++S   + +I + GE++  +P + G FN Y+  FI   F FA    +  QWL
Sbjct: 122 ASLVIDWVIISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFAFAVNLNYLAQWL 180

Query: 189 TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMI 248
            +LPLEL+ A++TIKYWN  I+ D +V IFY  +   +   V+++GETEF+ +  KIL I
Sbjct: 181 VLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSI 240

Query: 249 GGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNEL 308
            GF I  IV++C             WHDPGAF   +  ++FKG+C   V A FSY G E+
Sbjct: 241 IGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEM 300

Query: 309 FVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS 368
             +S  + KNPR++ P AAK   + I   Y+  + LIG +VP N   LL  S      +S
Sbjct: 301 TAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS 360

Query: 369 PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRR 428
           P V+A    GIK +P ++NA+ILIA++SVANS++YA  R + ++A  G  P+FL+ VD+R
Sbjct: 361 PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKR 420

Query: 429 GRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKL 488
           GRP+ A+LL+   G++ F A S ++ EVFTWL+A+SGLS +F W +I  SHIRFR+AMK+
Sbjct: 421 GRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKV 480

Query: 489 QNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMP 548
           Q +SLD L + + TG+ GS++G     LV  A FW +L P    G   A SFF  YL+ P
Sbjct: 481 QERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSG-ASAESFFEGYLSFP 539

Query: 549 IWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
           I +V Y G+  + +++T++  L  +DLD  RK  D
Sbjct: 540 ILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>Scas_479.1
          Length = 595

 Score =  416 bits (1070), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 213/538 (39%), Positives = 324/538 (60%), Gaps = 9/538 (1%)

Query: 72  KRADDSPDHNDLEKTTTAHQEQKKTMKS-------RHVIMMSLGTGIGTGLLVSNGKGLS 124
           +++ DSP  ++++ T+ +   ++   KS       RH++ +++G  IG GL V++G  L+
Sbjct: 50  EKSKDSPIEDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALA 109

Query: 125 LAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFC 184
             GPASLVI + ++S   + +I + GE+A  +P + G FN Y + F+   F FA    + 
Sbjct: 110 SGGPASLVIDWVIISTCLFTVINSLGELAAAFPVV-GGFNVYITRFVDPSFAFAVNLNYL 168

Query: 185 IQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACK 244
            QWL +LPLEL+ A++TIKYWN++I+ D +V IFY  +   +   V+++GETEF+ +  K
Sbjct: 169 AQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVK 228

Query: 245 ILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYG 304
           IL I GF I  IV++C             WH+PGAF      ++FKG+C   V A FSY 
Sbjct: 229 ILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTAAFSYS 288

Query: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNG 364
           G E+  +S  + K+PRK+ P AAK   + I   Y+  + L+G +VP++   L+  +    
Sbjct: 289 GIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVD 348

Query: 365 LHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSY 424
             ASP V+A    GIK +  ++NA+ILI++ISVANS++YA  R + S+A  G  P+ L  
Sbjct: 349 AAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGK 408

Query: 425 VDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRR 484
           VD+RGRP+ A L++   G++ F A S ++ EVFTWL+A+SGLS +F W +I  SHIRFR+
Sbjct: 409 VDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQ 468

Query: 485 AMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASY 544
           AM  QN+SLD + Y + TG+WGS +GV    LV  A FW +L P   G   D  SFF  Y
Sbjct: 469 AMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLG-GDSADVQSFFEGY 527

Query: 545 LAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSS 602
           L++PI +V Y G+  ++K+++ +  L ++DLD  RK  DP   R E L  +  +   S
Sbjct: 528 LSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVLAEEAAVAKMS 585

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  417 bits (1071), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 217/551 (39%), Positives = 320/551 (58%), Gaps = 24/551 (4%)

Query: 67  FIDSFKRADD-----SPDHNDLEKTTTAHQEQ-----------------KKTMKSRHVIM 104
            ++ FKRAD+     S   +D+E     ++E                   K +  RH++ 
Sbjct: 61  LLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLT 120

Query: 105 MSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFN 164
           +++G  IGTGL V++G  L+  GP S++IA+ L+S   + ++ + GE+A  +P + G FN
Sbjct: 121 LAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVV-GGFN 179

Query: 165 AYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMF 224
            Y + F+   FGFA    +  QW  +LPLEL  A++TIKYWN  I+ D +V IFYV +  
Sbjct: 180 VYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIAL 239

Query: 225 IHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSN 284
            +   V+++GETEF+ +  KIL I GF I   V+ C             WHDPGAF    
Sbjct: 240 ANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVGDT 299

Query: 285 GASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMIL 344
             ++FKG+C   V A FSY G EL  +S  +  NPR + P A+K + + I   YLL + +
Sbjct: 300 PGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTI 359

Query: 345 IGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYA 404
            G +VP N   LL       + ASP V+A    GI+ VP ++NA+ILIA+ISVANSS+YA
Sbjct: 360 AGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYA 419

Query: 405 GPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAIS 464
             R + S+AQ G  P+  +Y+DR+GRPL A+L + + G++ F A S ++E +FTWL+A+S
Sbjct: 420 CSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALS 479

Query: 465 GLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWV 524
           GLS LF W +I  SHIRFRRAM  Q +SLD L Y + TG+ GS++G    + V    FW 
Sbjct: 480 GLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWT 539

Query: 525 ALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDP 584
           +L PP S G   A SFF  YL+ PI+L+ Y  +  + +D+ +     Q+D+D+ R+  D 
Sbjct: 540 SLFPPGSSGP-SAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDI 598

Query: 585 EFLRQEDLENK 595
           E L+++ L  +
Sbjct: 599 EELKEQKLREQ 609

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  410 bits (1053), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 228/544 (41%), Positives = 337/544 (61%), Gaps = 15/544 (2%)

Query: 58  QVKNRHLQGFIDSFKRA---DDSPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIG 112
           +V     + F DSF+ A   D  P     EK    TA+   K+T+KSRH+ M+ +G  IG
Sbjct: 36  RVGGTRWERFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIG 95

Query: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172
           TGL V +GK L+ AGPA ++I + L   + Y M+ A GE+AVT+P + G +  Y S F+ 
Sbjct: 96  TGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGGYTTYASRFVD 154

Query: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSID-PDVFVIIFYVFLMFIHFFGVQ 231
           + FGFA   ++ + WL  LPLE++ A++T+ YW T     D FV +FYV ++ I+ FGV+
Sbjct: 155 ESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVK 214

Query: 232 AYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKG 291
            YGE EFIF+  K++ + GFII  +++ C             WH+PGAFA  NG   FKG
Sbjct: 215 GYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFA--NG---FKG 269

Query: 292 ICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPH 351
           +C   V A FS+ G+EL  L+  +  NPRKS P+AAK   +RI + Y+L ++++G +VP+
Sbjct: 270 VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPY 329

Query: 352 NSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSS 411
            S  L+G S  +   ASP+V++    GIK +P +IN VILIA++SV N +++   R +++
Sbjct: 330 TSDRLIGQSSVDA-AASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAA 388

Query: 412 LAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFT 471
           LA QG  P+   Y+DR GRPL  ++++ + G++ F A SP+E EVF WL A+SGLS LFT
Sbjct: 389 LANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFT 448

Query: 472 WTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNS 531
           W  I+  HIR RRA+  QN++   L + A T +WGS + +   IL+  AQFW+AL P   
Sbjct: 449 WGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFP--I 506

Query: 532 GGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQED 591
           GGK  A +FF +YL+ PI++VFY G+  W K++ +    + +D+D+ R+  D E L+QE 
Sbjct: 507 GGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEI 566

Query: 592 LENK 595
            E K
Sbjct: 567 AEEK 570

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  405 bits (1042), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/554 (37%), Positives = 333/554 (60%), Gaps = 16/554 (2%)

Query: 57  VQVKNRH-LQGFIDSFKRADD---SPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTG 110
           VQ + R    GF+D+F+RA+     P+ ++ EK    TA     + +K+RH+ M+++G  
Sbjct: 41  VQPEPRKGWNGFVDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGA 100

Query: 111 IGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFF 170
           IG GL V +GK L+ AGPA ++I +GL + +   M  + GE+AVT+P + G +  Y + F
Sbjct: 101 IGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARF 159

Query: 171 ISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPD---VFVIIFYVFLMFIHF 227
           I + +GFA  + + +Q + V+PLE++ A++T+ YW+T  DP     FV +F+V ++ I+ 
Sbjct: 160 IDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDT--DPKYKLAFVALFWVVIVSINL 217

Query: 228 FGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGAS 287
           FGV+ +GE E IF+  K++ I GFII  +V+               W+DPG F  +  + 
Sbjct: 218 FGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSD 277

Query: 288 RFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGF 347
           +FKG+C   V A FS+ G+EL  L+  + + PRKS P AAK   +RI + Y+L+++++G 
Sbjct: 278 KFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGL 337

Query: 348 VVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPR 407
           +VP N+  LL     +  H SP+V+A  +H I+V+P IIN VIL A+ISV NSS+Y+  R
Sbjct: 338 LVPSNNEHLLAPQQIDAAH-SPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSR 396

Query: 408 LLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLS 467
            + +LA+ G+ P+   Y+DR+GRPL A+  ++L G++ F A +  E E+F WL AISGLS
Sbjct: 397 TMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLS 456

Query: 468 ELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALS 527
             FTW +I  +H+RFR A+K Q ++ + L + + TG  GS + VG   +V  AQFWVAL 
Sbjct: 457 SFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALY 516

Query: 528 PPNSGGKCDANS---FFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDP 584
           PP+  G     S   FF  YL+  + +V Y  +  W +++       ++D+D  R+  D 
Sbjct: 517 PPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDL 576

Query: 585 EFLRQEDLENKERL 598
           E  ++E  + +  L
Sbjct: 577 ELFKEELAQERALL 590

>Scas_507.1
          Length = 592

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/545 (38%), Positives = 314/545 (57%), Gaps = 17/545 (3%)

Query: 50  NLRSRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTT-----TAHQEQ------KKTMK 98
           N+ + F ++ K+  L          D    H  ++ TT      +H++        K + 
Sbjct: 25  NIDANFALEEKDSTLS----PLASLDSKVPHEKIQTTTDFASVISHEDDINNVNLNKNLS 80

Query: 99  SRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPT 158
            RH++ +++G  IG GL V++G  L+  GPASLVI + ++S   + +I A GEMA  +P 
Sbjct: 81  IRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPV 140

Query: 159 LPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIF 218
           + G FN Y + FI    GFA    +  QWL +LPLEL+ A+MTIKYWN +I+ D +V IF
Sbjct: 141 V-GGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIF 199

Query: 219 YVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPG 278
           Y  +   +   V+++GETEF+ +  KIL I GF I  IV+ C             W+ PG
Sbjct: 200 YCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPG 259

Query: 279 AFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
           +F   N  ++FKG+C   V A FSY G E+  +S  + K+PR + P AAK   + I   Y
Sbjct: 260 SFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASY 319

Query: 339 LLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVA 398
           +  + LIG +VP++   LL  +      +SP V+A    GIK +P ++NA+ILI++ISVA
Sbjct: 320 VTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVA 379

Query: 399 NSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFT 458
           NS++YA  R + ++A  G  PR L+ VD +GRP+ A++ +   G++ F A S R+ +VFT
Sbjct: 380 NSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFT 439

Query: 459 WLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVF 518
           WL+A+SGLS +F W +I  SHIRFR++M  QN+SLD L + + TG+WGS++G     LV 
Sbjct: 440 WLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVL 499

Query: 519 AAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNH 578
            A FW +L P   G   DA SFF  YL+ PI L  YFG+  + +    +  L  +DLD  
Sbjct: 500 VASFWTSLFPLG-GTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTG 558

Query: 579 RKVYD 583
           R+  D
Sbjct: 559 RRQVD 563

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  401 bits (1031), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 200/520 (38%), Positives = 310/520 (59%), Gaps = 8/520 (1%)

Query: 68  IDSFKRADDSPDHNDLEKT---TTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLS 124
           + +F    D    N ++ T   T    E K+++K  HV MMS  TGIGTGLLV NG+ ++
Sbjct: 9   VATFSNLSDPTRTNSIDTTADVTLPKNELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIA 68

Query: 125 LAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFC 184
           +AG    ++ Y ++  +    +Q  GE+ V +P++PG F +Y   FI    GF  +WLF 
Sbjct: 69  IAGVGGTLVGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFF 128

Query: 185 IQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACK 244
           + W  VLPLE+  A+MTI +WN +I+P + V + Y  +  ++FFG + Y + + IFN  K
Sbjct: 129 LNWTVVLPLEICVASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADADCIFNCLK 188

Query: 245 ILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYG 304
           +LMI GFII  I VN              +H PG F +  G   FK I   L+ A FS G
Sbjct: 189 VLMILGFIILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLITACFSTG 246

Query: 305 GNELFVLSVNDQ--KNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGG 362
           G E   LS  +Q  ++  +S   A+   V RI +I+ +++++IG +VP NS  L+G SG 
Sbjct: 247 GTEFVALSCAEQNTEDMPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNSPYLMG-SGS 305

Query: 363 NGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFL 422
              HASPYV+A + +G++++PHI+NA+IL+++ISVAN+++Y+  R L SLA+QG+A ++ 
Sbjct: 306 ELTHASPYVVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLAEQGFAMKYF 365

Query: 423 SYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRF 482
             +D  G+P   L +SA  G+  F A    +E VF WL +ISGLS +FTW+    SH+RF
Sbjct: 366 CKLDESGKPFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWSMTCVSHLRF 425

Query: 483 RRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFA 542
           R+AMK Q+++LD LGY++  G++GSY  +    ++   QFWV+L P  S G+ +  SF  
Sbjct: 426 RKAMKDQDQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNGRLNVVSFLQ 485

Query: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVY 582
           +Y+A+PI +V Y G+  +  ++       ++D+   R +Y
Sbjct: 486 NYMAVPITIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIY 525

>Scas_607.4
          Length = 599

 Score =  399 bits (1024), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 220/544 (40%), Positives = 321/544 (59%), Gaps = 28/544 (5%)

Query: 65  QGFIDSFKRA-DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGL 123
           Q  IDSFK   D S D N+L          K+++K+RH+IM+++G  IGTGL V +G+ +
Sbjct: 66  QRCIDSFKPPLDGSFDTNNL----------KRSLKARHLIMIAIGGSIGTGLFVGSGQAI 115

Query: 124 SLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLF 183
           +  GP ++VI + +        I   GE+ V +P + G+F  Y++ F+     F  + ++
Sbjct: 116 ATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYSTRFLDPSLSFVISTIY 174

Query: 184 CIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNAC 243
            IQW  VLPLE+I++AMT++YWN SIDP V+V IFY  ++ I+ FG + +GE EF+F++ 
Sbjct: 175 VIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSV 234

Query: 244 KILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSY 303
           K+L I GFII  IV+ C             WHDPG  A       F G+   LV A +S 
Sbjct: 235 KVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLAHG-----FPGVLSVLVVASYSL 289

Query: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN 363
           GG E+  L+ + + +P K  P+A K   +RI+  +L+++ LIGF+VP+ +  LLG   G+
Sbjct: 290 GGTEMVCLA-SGETDP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLG---GS 344

Query: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423
            ++ SP+V+A  +H IKV+P I+NAVILI+++SV NS ++A  R L S+A QG  PRF  
Sbjct: 345 SVNNSPFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFG 404

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
           Y+DR GRPLT ++ ++L G++ F   S    EVF WL AI+GL+    W SI  SHIRFR
Sbjct: 405 YIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFR 464

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN--SGGKCDANSFF 541
            AMK Q +SLD L + +  G+WGS +    N L+  AQF+ AL P          A  FF
Sbjct: 465 LAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFF 524

Query: 542 ASYLAMPIWLVFYFGYMCWYK----DFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKER 597
            SYL   I +V + G+  +Y+     +  +  LN++DL+  RK  D E L+QE  E    
Sbjct: 525 QSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRH 584

Query: 598 LRNS 601
           LR S
Sbjct: 585 LRAS 588

>Kwal_33.14276
          Length = 596

 Score =  395 bits (1016), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 213/544 (39%), Positives = 326/544 (59%), Gaps = 16/544 (2%)

Query: 64  LQGFIDSFK--RADD-SPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           +  F+D F+  + DD  P+ +  E+    TA    K+ +K+RH+ M+++G  IGTGL V 
Sbjct: 50  IHNFVDGFREYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVG 109

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           +GK L + GPA++++A+ L   + Y ++QA GE+ V  P + GS+ +Y S FI   FGFA
Sbjct: 110 SGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDPSFGFA 168

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSID-PDVFVIIFYVFLMFIHFFGVQAYGETE 237
             + + +  L  +PLE++ A++T+ YWN      D FV +FYV ++ I+F GV+ YGE E
Sbjct: 169 IAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAE 228

Query: 238 FIFNACKILMIGGFIIFAIVVNCXXXXXXXXXX-XXXWHDPGAFASSNGASRFKGICYNL 296
           F+F+  K+L I GFII  IV+ C              WH+PG FA       FKG     
Sbjct: 229 FVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFAHG-----FKGFAAIF 283

Query: 297 VNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSEL 356
           V + FS+ G+E+F L   + KNPR+  P AAK   +RI + YL+++ LIG +VP+ +  L
Sbjct: 284 VTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHL 343

Query: 357 LGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQG 416
             +S  +   ASP+V+A    GI  +P +IN VIL+A++SV N+ ++A  R   SLA  G
Sbjct: 344 FASSSVD-ASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYG 402

Query: 417 YAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIM 476
           Y P+  +YVDR+GRPL  L+LS + G++ F ++S  +  VF W+ A+SGL   FTW SI 
Sbjct: 403 YLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSIC 462

Query: 477 FSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCD 536
             H+RFR+ ++ Q +S D L +KA TG+WGS +G+    +V   QFWVAL P +      
Sbjct: 463 VCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSK--SPS 520

Query: 537 ANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKE 596
           A  FF  YL++P+ +VFY G+  + +++ ++    ++DLD  R+  D E L+QE  E  E
Sbjct: 521 AYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENE 580

Query: 597 RLRN 600
            +R+
Sbjct: 581 SIRS 584

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/553 (38%), Positives = 320/553 (57%), Gaps = 32/553 (5%)

Query: 57  VQVKNRHLQGFIDSFKR-ADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGL 115
           V  K    Q  +DSFK   D S D ++L          K+T+KSRH+IM+++G  IGTGL
Sbjct: 36  VVTKRNIFQRCVDSFKPPVDGSFDTSNL----------KRTLKSRHLIMIAIGGSIGTGL 85

Query: 116 LVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPF 175
            + +G+ L+  GP +++I + +        I   GE+ V +P + G+F  Y++ F+    
Sbjct: 86  FIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVV-GAFADYSTRFLDPSI 144

Query: 176 GFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235
            F  + ++ IQW  VLPLE+I +A+TI+YWN+SIDP V+V IFY  ++ I+ FG + +GE
Sbjct: 145 SFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGE 204

Query: 236 TEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYN 295
            EF+F+  K + I GFII  IV+ C             WHDPGA A       F G+   
Sbjct: 205 AEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALAHG-----FPGVLSV 259

Query: 296 LVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSE 355
           LV A +S GG E+  L+ + + +P K  P+A K   +RI+  +L ++ L+GF+VP+ +  
Sbjct: 260 LVVASYSLGGTEMTCLA-SGETDP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNEN 317

Query: 356 LLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQ 415
           LLG   G+ +  SP+V+A  +H IK +P I+NAVILI+++SV NS ++A  R L S+A Q
Sbjct: 318 LLG---GSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQ 374

Query: 416 GYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSI 475
           G  PRF  Y+DR GRPL  ++ ++L G++ F   S    EVF WL AI+GL+    W SI
Sbjct: 375 GLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSI 434

Query: 476 MFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKC 535
             SHIRFR AMK QNK+LD L + +  G+WGS +    N+L+  AQF+++L P   GG  
Sbjct: 435 NLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWP--IGGWT 492

Query: 536 D----ANSFFASYLAMPIWLVFYFGYMCWYK----DFTVLTDLNQVDLDNHRKVYDPEFL 587
           D    A  FF SYL   I L+ +  +  +Y+     +  +  L  +DL+  RK  D + +
Sbjct: 493 DSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVI 552

Query: 588 RQEDLENKERLRN 600
           + E  E K  L+ 
Sbjct: 553 KAEIAERKMYLKK 565

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  372 bits (956), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/546 (39%), Positives = 313/546 (57%), Gaps = 28/546 (5%)

Query: 60  KNRHLQGFIDSFKRA-DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           K    Q  +DSFK   D S D ++L          K+T+K RH+IM+++G  IGTGL V 
Sbjct: 54  KRNIFQRCVDSFKSPLDGSFDTSNL----------KRTLKPRHLIMIAIGGSIGTGLFVG 103

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           +GK ++  GP  +VI + +        I   GE+ V +P + G+F  Y + F+     F 
Sbjct: 104 SGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPSISFV 162

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
            + ++ +QW  VLPLE+I AAMT++YWN+SIDP ++V IFY  ++ I+ FGV+ +GE EF
Sbjct: 163 VSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEF 222

Query: 239 IFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVN 298
            F+  K + + GFII  +V+ C             WHDPG  A  NG   F G+   LV 
Sbjct: 223 AFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLA--NG---FPGVLSVLVV 277

Query: 299 AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLG 358
           A +S GG E+  L+ + + +P K  P+A K   +RI+  +L+++ L+GF+VP+ +  LLG
Sbjct: 278 ASYSLGGIEMTCLA-SGETDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLG 335

Query: 359 ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYA 418
              G+ +  SP+V+A  +H IK +P I+NAVILI+++SV NS ++A  R L S+A QG  
Sbjct: 336 ---GSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLI 392

Query: 419 PRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFS 478
           P +  Y+DR GRPL  ++ ++L G++ F   S    EVF WL AI+GL+    W SI  S
Sbjct: 393 PWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLS 452

Query: 479 HIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN--SGGKCD 536
           HIRFR AMK Q KSLD L + +  G+WGS +    N L+  AQF+ +L P    + GK  
Sbjct: 453 HIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKER 512

Query: 537 ANSFFASYLAMPIWLVFYFGYMCWYKDFT----VLTDLNQVDLDNHRKVYDPEFLRQEDL 592
           A  FF +YL   I L  +  +  +YK  T     +  L  +DL+  RK  D E ++QE  
Sbjct: 513 AKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIA 572

Query: 593 ENKERL 598
           E K  L
Sbjct: 573 EKKMYL 578

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/538 (38%), Positives = 323/538 (60%), Gaps = 32/538 (5%)

Query: 68  IDSFKR-ADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLA 126
           IDSFK   D S D ++L          K+T+KSRH+IM+++G  IGTGL + +GK L+  
Sbjct: 209 IDSFKPPVDGSFDPDNL----------KRTLKSRHLIMIAIGGSIGTGLFIGSGKALATG 258

Query: 127 GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQ 186
           GP +++I + L        I   GE+ V +P + G+F  Y++ F+     F  + ++ +Q
Sbjct: 259 GPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVV-GAFANYSTRFLDPSVSFVVSSIYVLQ 317

Query: 187 WLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKIL 246
           W  VLPLE+I +A+T+++W TS+DP V+V +FY  ++ I+ FGV+ +G+ +F+F+  K++
Sbjct: 318 WFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMV 377

Query: 247 MIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGN 306
            I GFII  +V+               WHDPGA A  NG   FKG+   +V A +S GG+
Sbjct: 378 PICGFIILCLVLILGGGPTHEFIGARYWHDPGALA--NG---FKGVAAVMVTASYSLGGS 432

Query: 307 ELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLH 366
           E+  L+ + + +P K  P A K   +RI+  +L+++ L+GF+VP+ + +LLG   G+ ++
Sbjct: 433 EMTCLA-SGETDP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG---GSNVN 487

Query: 367 ASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVD 426
            SP+V+A  +H I+V+PHIIN VIL++++SV NS ++A  R L S+A QG  PR   YVD
Sbjct: 488 NSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVD 547

Query: 427 RRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAM 486
           R GRPLT +L ++L G++ F   S     VFTWL A++GL+    W SI  SHIRFR AM
Sbjct: 548 RAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAM 607

Query: 487 KLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSP----PNSGGKCDANSFFA 542
           K Q KSLD L + +  G+WGS +    N++V  AQF+V+L P     +  G+ +A  FF 
Sbjct: 608 KAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEA--FFQ 665

Query: 543 SYLAMPIWLVFYFGYMCWYKDFT----VLTDLNQVDLDNHRKVYDPEFLRQEDLENKE 596
           +YL   I L  +  +  +Y+  T     +  L ++DL++ RK  D E ++ E    K+
Sbjct: 666 NYLCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 723

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  358 bits (919), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/547 (38%), Positives = 321/547 (58%), Gaps = 29/547 (5%)

Query: 60  KNRHL-QGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           KN+++ +  IDSFK   D   H+D           K+ +KSRH+IM+++G  IGTGL V 
Sbjct: 45  KNKNIVRRMIDSFKPPLDGSYHSD---------NLKRKLKSRHLIMIAIGGSIGTGLFVG 95

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           +GK L+  GP +++I + +        I   GE+ + +P + G+F  Y++  +     F 
Sbjct: 96  SGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVV-GAFANYSTRLLDPSISFM 154

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
            + ++  QW  VLP+ELI +AMT+++W T +DP V+V IFYV ++ ++ FGV+ +GE EF
Sbjct: 155 VSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEF 214

Query: 239 IFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVN 298
            F+  K++ I GFII +I++ C             WH PGA A  NG   FKG+    V 
Sbjct: 215 AFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALA--NG---FKGVASVFVT 269

Query: 299 AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLG 358
           A +S GG+E+  L  + + +P K  P A K   +RIV  +L+++ L+GF+VP+ +  LLG
Sbjct: 270 ASYSLGGSEMVCLC-SAETDP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLG 327

Query: 359 ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYA 418
              G+ ++ SP+V+A  + GI+V+P IINAVILI+++SV NS ++A  R L S+A QG  
Sbjct: 328 ---GSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLI 384

Query: 419 PRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFS 478
           PR   YVDR GRPL  +++++L G++ F   S     VF WL AI+GL+    W SI  S
Sbjct: 385 PRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINIS 444

Query: 479 HIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN--SGGKCD 536
           HIRFR AMK QN+SLD L +K++ G++GS +    NIL+  AQF+++L P    +  +  
Sbjct: 445 HIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQR 504

Query: 537 ANSFFASYLAMPIWLVFYFG-----YMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQED 591
             SFF +YL   + LVF F      + C    +     L ++DL+  RK  D E ++QE 
Sbjct: 505 TESFFKNYLCALV-LVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEV 563

Query: 592 LENKERL 598
            E +  L
Sbjct: 564 REREMYL 570

>Kwal_34.16254
          Length = 481

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 184/450 (40%), Positives = 272/450 (60%), Gaps = 21/450 (4%)

Query: 61  NRH-LQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSN 119
           NR+ LQ  +DSFK  +D   H+D           KK++K+RH++M+++G  IGTGL + +
Sbjct: 49  NRNVLQRMVDSFKPPEDGSFHSD---------NLKKSLKARHLVMIAIGGSIGTGLFIGS 99

Query: 120 GKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFAT 179
           GK L+L GP +L+I + +        I   GE+ V +P + G+F  Y + F+     F  
Sbjct: 100 GKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVV-GAFADYGTRFLEPSISFVV 158

Query: 180 TWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFI 239
             ++ +QW  VLPLE+I AAMT++YW+TS+ P V+V IFY  +  I+  GV+ +GE EF+
Sbjct: 159 VLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFV 218

Query: 240 FNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNA 299
           F+  K++ I GFII  IV+ C             WHDPG  A  NG   FKG+   LV A
Sbjct: 219 FSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA--NG---FKGVAGVLVIA 273

Query: 300 YFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA 359
            +S GG E+  L+ + + +P K  P+A K   +RIV  +L+++ L+GF+VP+ +  L+G 
Sbjct: 274 SYSLGGTEMACLA-SGETDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMG- 330

Query: 360 SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAP 419
             G+ +  SP+V+A  +HGI  +P I+NAVIL++L+SV NS ++A  R L S+A QG  P
Sbjct: 331 --GSSVDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIP 388

Query: 420 RFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSH 479
           R   Y+DR GRPLT +L + L G++ F   S    +VFTWL AI+GL+    W SI  SH
Sbjct: 389 RVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISH 448

Query: 480 IRFRRAMKLQNKSLDTLGYKANTGLWGSYF 509
           IRFR AMK Q   L+ L + +  G++GS +
Sbjct: 449 IRFRLAMKAQGVDLEELEFVSGVGIYGSVY 478

>Kwal_56.22951
          Length = 596

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/567 (35%), Positives = 327/567 (57%), Gaps = 31/567 (5%)

Query: 50  NLRSRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQK----------KTMKS 99
           +L +RF  Q   R +     SF+R  ++P+   ++ +  + ++++          K++  
Sbjct: 29  SLINRFK-QKSRRQIHDIAHSFQR-QEAPNSEGVDLSLLSEEQRRNYELANQPYEKSLSQ 86

Query: 100 RHVIMMSLGTGIGTGLLVSNGKGLSLA-GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPT 158
           RH++M+S+G  +GTGL +  G G SLA GP SL+I + +V  + + ++Q+A EMA  YP 
Sbjct: 87  RHLMMISIGGTLGTGLFI--GLGFSLASGPGSLLIGFLIVGLMMFCVVQSAAEMACQYP- 143

Query: 159 LPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIF 218
           + GSF+ + S F+    GF  +  + + WL   P ELI  A+T++YW +S++  V+V IF
Sbjct: 144 VSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCAITLRYW-SSVNGAVWVAIF 202

Query: 219 YVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX-XXXXXXXXXXWHDP 277
           YVF+M ++ FGV+ YGE EF  +  K++ I  FII  IV+ C              WH+P
Sbjct: 203 YVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTKYWHNP 262

Query: 278 GAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVI 337
           G+FA       FKG+C   ++A FS+GG EL VL+ ++ K   +S   AAK   +RI + 
Sbjct: 263 GSFAKPV----FKGLCNTFISAAFSFGGAELVVLTASESKKV-ESVSRAAKGTFWRIAIF 317

Query: 338 YLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGI--KVVPHIINAVILIALI 395
           Y+ T+++IG +VP+    LLG   G  + ASP+V+A S  G     V H +NAVILIA++
Sbjct: 318 YITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQGSMGTKVSHFMNAVILIAVL 377

Query: 396 SVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEE 455
           SV NS +YA  R++ +L   G  PR   Y+D++GRPL  + +  + G++GF     ++++
Sbjct: 378 SVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIAICGVFGLLGFLVACDKQDD 437

Query: 456 VFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNI 515
           VFTWL A+  +S  FTW  I  S +RFR A++ Q +S D + +K+  G++G   G   NI
Sbjct: 438 VFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEIAHKSMLGIYGGILGGVLNI 497

Query: 516 LVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYF---GYMCWYKDFT-VLTDLN 571
           L+ A + +V++ P   GG   A  FF   +++PI +V Y     Y    +D   +L  L+
Sbjct: 498 LLIAGEIYVSIFPL--GGSPSAEQFFQYCMSIPIMIVVYALHKTYKATRRDAKRILVPLS 555

Query: 572 QVDLDNHRKVYDPEFLRQEDLENKERL 598
           ++DLD+ R++ D E  + E  E+K R+
Sbjct: 556 EIDLDSGRRIQDIELFKHELEEDKARI 582

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  328 bits (842), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 199/540 (36%), Positives = 309/540 (57%), Gaps = 30/540 (5%)

Query: 69  DSFKRAD---------DSPDHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117
           DSFKR +         D+    D ++T    A Q  +K +  RH+ M+++G  +GTGL +
Sbjct: 39  DSFKRQELVETEGIDLDTYSMTDYQRTNYLLAKQPYQKNLSQRHLTMIAIGGTLGTGLFI 98

Query: 118 SNGKGLSLA-GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFG 176
             G G SLA GP +L+I + L     + ++Q A E++  YP + GSF ++ S F+   +G
Sbjct: 99  --GIGWSLASGPGNLLIGFLLTGLAIFCVVQCAAELSCQYP-VSGSFASHVSRFVDPSWG 155

Query: 177 FATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGET 236
           F  T  +C+ W    P ELI  AMTI YW++S++P V+VIIF++F+M ++ FGV+ + ET
Sbjct: 156 FTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNPVVWVIIFWLFIMALNLFGVRGFAET 215

Query: 237 EFIFNACKILMIGGFIIFAIVVNCXXX-XXXXXXXXXXWHDPGAFASSNGASRFKGICYN 295
           E++ +  KIL I  F+I  +V+ C              WHDPG+F     A  FK +C  
Sbjct: 216 EYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIGTKYWHDPGSFK----APVFKSLCNT 271

Query: 296 LVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSE 355
            V+A FS+GG EL VL+  + +   +S   AAK   +R++V Y+ T+++IG +VP+    
Sbjct: 272 FVSAAFSFGGTELVVLTAAESRK-VESISRAAKGTFWRVIVFYVSTVVVIGCLVPYTDER 330

Query: 356 LLGASGGNGLHASPYVLAASIHGI--KVVPHIINAVILIALISVANSSLYAGPRLLSSLA 413
           LLG      + ASP+V+A +  G   + V + +NAVILIA++SV NS +YA  R++ SL 
Sbjct: 331 LLGGDTSEDIAASPFVIALANTGKFGERVSNFMNAVILIAVLSVCNSCVYAASRVIQSLG 390

Query: 414 QQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWT 473
             G  P    YVDR+GRPL  +L+  L G + F   S +  EVF WL A+  +S +F W 
Sbjct: 391 ASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIVASNKVSEVFDWLFALCSISSMFIWF 450

Query: 474 SIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGG 533
           SI +S++R+R A+K QN+S D + YK+  G+WG+Y G+  + L+   + +V+L P   G 
Sbjct: 451 SICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAYLGLLLSALLIVGEIYVSLFP--LGE 508

Query: 534 KCDANSFFASYLAMPIWLVFYFGYMCW---YKDFTVLTDLNQVDLDNHRKVYDPEFLRQE 590
              A +FF   L++PI +  Y G+  +   +K F +   L+ +DLD      D E ++ E
Sbjct: 509 SPSAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVI--PLSGIDLDTGLSHSDVEIMKHE 566

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 202/545 (37%), Positives = 309/545 (56%), Gaps = 26/545 (4%)

Query: 69  DSFKRADDSPDHNDLEKTTTAHQEQ----------KKTMKSRHVIMMSLGTGIGTGLLVS 118
           DSFK+++      DLE +    QE+          +K +  RH+ M+++G  +GTGL + 
Sbjct: 39  DSFKQSNLHVIPEDLENSEQTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFI- 97

Query: 119 NGKGLSLA-GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177
            G G SLA GPA+L+I + LV    + ++Q+A E++  +P + GS+  + S FI +  GF
Sbjct: 98  -GLGYSLASGPAALLIGFLLVGTSMFCVVQSAAELSCQFP-VSGSYATHVSRFIDESVGF 155

Query: 178 ATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETE 237
                + + WL   P ELI  A+TI YWN +++P V+V IFYVF+M ++ FGV+ + ETE
Sbjct: 156 TVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETE 215

Query: 238 FIFNACKILMIGGFIIFAIVVNCXXX-XXXXXXXXXXWHDPGAFASSNGASRFKGICYNL 296
           F  +  K++ I  FII  IV+                WHDPGAFA       FK +C   
Sbjct: 216 FALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAKYWHDPGAFAKP----VFKNLCNTF 271

Query: 297 VNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSEL 356
           V+A FS+GG+EL +L+  + KN   +   AAK   +RI + Y+ T+++IG +VP+N   L
Sbjct: 272 VSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRL 330

Query: 357 LGASGGNGLHASPYVLAASIHGI--KVVPHIINAVILIALISVANSSLYAGPRLLSSLAQ 414
           L  S    + ASP+V+A S  G     V + +N VIL+A++SV NS +YA  RL+ +L  
Sbjct: 331 LSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGA 390

Query: 415 QGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTS 474
            G  P   SY+DR+GRPL  + +S   G++GF   S +E+EVFTWL A+  +S  FTW  
Sbjct: 391 SGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFC 450

Query: 475 IMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGK 534
           I  S IRFR A+K Q +S D + YK+  G++G   G   N L+ A + +V+ +P   G  
Sbjct: 451 ICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAP--VGSP 508

Query: 535 CDANSFFASYLAMPIWLVFYFGYMCWYKDFT-VLTDLNQVDLDNHRKVYDPEFLRQEDLE 593
             A +FF   L++PI +V YF +  + +D+       +++DLD    V + E  + +  E
Sbjct: 509 SSAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQK-E 567

Query: 594 NKERL 598
            +E+L
Sbjct: 568 AEEQL 572

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  305 bits (782), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 189/551 (34%), Positives = 299/551 (54%), Gaps = 25/551 (4%)

Query: 61  NRHLQGFIDSFKRADDSP---------DHNDLEKTT--TAHQEQKKTMKSRHVIMMSLGT 109
           N  +  F +SFKR +DSP         + ++ EK     A+Q  KK +  RH+ M+++G 
Sbjct: 27  NNLIHRFKNSFKR-NDSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQRHLTMIAIGG 85

Query: 110 GIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSF 169
            +GTGL +  G+ L+ +GPASL+I + LV      ++Q   E++  YP + GS+  + S 
Sbjct: 86  TLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALHASR 143

Query: 170 FISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFG 229
           FI    GF+    + + WL   P EL+  ++TI YW  S++P  +V I +V  M ++ FG
Sbjct: 144 FIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLNLFG 203

Query: 230 VQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX-XXXXXXXXXXWHDPGAFASSNGASR 288
            + + E+EF  +  KI+ +  FII  IV+                WHDPG+FA       
Sbjct: 204 ARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGSFA----VPV 259

Query: 289 FKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFV 348
           FK +C   V+A +S+ G E+ VL+  + ++   S   AAK   +RI++ Y++T+I+IG +
Sbjct: 260 FKNLCNTFVSAAYSFSGTEMVVLTSTEARSV-SSVSRAAKGTFWRIIIFYIVTVIIIGCL 318

Query: 349 VPHNSSELLGASGGNGLHASPYVLAASIHGI--KVVPHIINAVILIALISVANSSLYAGP 406
           VP+N   L+  S    + ASP+V+A S  G     V H +NAVILIA+ SV NS +YA  
Sbjct: 319 VPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVYASS 378

Query: 407 RLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGL 466
           RL+  LA  G  P+  +Y+DR GRPL  + +    G++GF   S  +  VFTWL A+  +
Sbjct: 379 RLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFALCSI 438

Query: 467 SELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVAL 526
           S   TW  I F  +RFR AMK Q +S D + Y++  G++G  FG   N+L+   + +V+ 
Sbjct: 439 SFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIYVSA 498

Query: 527 SPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFT-VLTDLNQVDLDNHRKVYDPE 585
           +P   G    A +FF   +++PI +  Y G+  + +D+         +DLD+   + D E
Sbjct: 499 AP--VGSPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLEDFE 556

Query: 586 FLRQEDLENKE 596
             + E  E+K+
Sbjct: 557 ATKLERDEDKK 567

>Scas_536.1
          Length = 372

 Score =  298 bits (763), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 156/362 (43%), Positives = 226/362 (62%), Gaps = 3/362 (0%)

Query: 240 FNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNA 299
           F+  K+  + GFII  IV+ C             WHDPGAF      ++FKG+C   V A
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 62

Query: 300 YFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA 359
            FS+ G+EL  ++  +  NPRKS P AAK  V+RIV+ Y+ T+ +IG +VP+N   L+GA
Sbjct: 63  AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 122

Query: 360 SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAP 419
           S  +   ASP+V+A   HGIK +P +IN VILIA++SV NS+++A  R +++L+ QG+ P
Sbjct: 123 SSVDA-AASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLP 181

Query: 420 RFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSH 479
           +   Y+DR GRPL  + +++  G++ F A S +E EVF WL A+SGLS LFTW  I   H
Sbjct: 182 KVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCH 241

Query: 480 IRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANS 539
           IRFR A+K Q +  + L + +  G+ GSY+G+   +L+F AQF+VAL PP  GGK DA  
Sbjct: 242 IRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPP--GGKPDAEV 299

Query: 540 FFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLR 599
           FF SYL+ PI +  YFG+  + +++ +   L  +D+D  R+  D E L+QE +E K  L 
Sbjct: 300 FFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILA 359

Query: 600 NS 601
           + 
Sbjct: 360 SK 361

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  292 bits (748), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 169/506 (33%), Positives = 277/506 (54%), Gaps = 15/506 (2%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           K+ +K RH+ M++LG  IGTGL V     LS +GP   +IAY  +  + YF+ Q+ GEMA
Sbjct: 92  KRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEMA 151

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDV 213
              P +  S   ++  F+S  FG A  +++   W     +E+      I+YW   +    
Sbjct: 152 TFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAA 210

Query: 214 FVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXX 273
           ++ IF+V +  ++FF V+ YGE EF   + K++ I G++I+A+++ C             
Sbjct: 211 WIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRY- 269

Query: 274 WHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAK 328
           W +PGA      +S  G +RF G   +L+NA F+Y G EL  ++  +  NPRKS P A  
Sbjct: 270 WRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 329

Query: 329 SNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINA 388
             V+RIV+ Y++++  +G +VP+N   L  +S    + +SP+V++    G KV+P I NA
Sbjct: 330 KVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS--AVIASSPFVISIQNAGTKVLPDIFNA 387

Query: 389 VILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAA 448
           V+L+ +IS ANS++Y G R+L +LAQ G AP+  +YV R G P   ++ +AL+G++ F  
Sbjct: 388 VVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLV 447

Query: 449 TSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSY 508
            +      F WL  IS L+ L  W  I  +HIRF +A+K +  S D L +KA    WG+Y
Sbjct: 448 VNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAY 507

Query: 509 FGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLT 568
           +   F  ++   Q + A +P     K D + FF +Y+++ + +V + G   +Y+    L 
Sbjct: 508 YASFFVTVIIFIQGFQAFAP-----KFDVSEFFTAYISLILLVVLFAGCQLYYRC-RFLW 561

Query: 569 DLNQVDLDNHRKVYDPEFLRQEDLEN 594
            L  +D+D+ R+  D      ++ +N
Sbjct: 562 KLEDIDIDSDRREIDAIVWEDDEPQN 587

>Scas_706.37
          Length = 544

 Score =  290 bits (742), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 171/530 (32%), Positives = 290/530 (54%), Gaps = 17/530 (3%)

Query: 74  ADDSPDH-NDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132
           ++D+P   + L+      Q+ K+ +K RH+ M++LG  IGTGL +   + L +AGP   +
Sbjct: 15  SNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGAL 74

Query: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192
           IAY  +  V + + Q+ GEM  T+  +  SF  +   F+S  FG A  +++   W     
Sbjct: 75  IAYLFMGTVVFSVTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFA 133

Query: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252
           LEL      I++W  ++    ++ I +V L   + F V+ YGE EF   + K+L I GFI
Sbjct: 134 LELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFI 193

Query: 253 IFAIVVNCXXXXXXXXXXXXXWHDPGAFA----SSN-GASRFKGICYNLVNAYFSYGGNE 307
           I   +                W +PG +     SSN   +RF G   +L+NA F++ G E
Sbjct: 194 I-YGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTE 252

Query: 308 LFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHA 367
           L  ++  + KNPRK+ P A K  V+RI+V Y+ ++++IG +VP+N  +L   S  + + +
Sbjct: 253 LVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL--QSNDSYVSS 310

Query: 368 SPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDR 427
           SP+++     G K++PHI NAVILI +IS  NS++Y G R+L  LA+   AP+F +   +
Sbjct: 311 SPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSK 370

Query: 428 RGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMK 487
            G P   +L +++ G + +  T+   ++ FTWL  I G++  F W  I  SHIRF +A+K
Sbjct: 371 AGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALK 430

Query: 488 LQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAM 547
            +  S + L YKA    W +Y+ V F +++   Q + + +P     K    +FFA+Y+++
Sbjct: 431 QRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANFFAAYISV 485

Query: 548 PIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKER 597
            ++++F+  +  W+K   ++  L  VDLD  R+  + E +  +D+E+K +
Sbjct: 486 FLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEE-VWSDDVEDKNK 533

>Kwal_33.13401
          Length = 559

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 165/543 (30%), Positives = 282/543 (51%), Gaps = 16/543 (2%)

Query: 49  HNLRSRFDVQVKNRHLQGFID-SFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSL 107
             +  + + ++++  +  F + +  +   S   + L  +       ++ +K RHV M++L
Sbjct: 8   EGMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIAL 67

Query: 108 GTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYT 167
           G  IGTGL +     L  AGP   +I+Y  +  + Y + Q+ GEMA   P +  SF  +T
Sbjct: 68  GGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIP-VTSSFTVFT 126

Query: 168 SFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHF 227
             F+S P G A  +++C  W     LEL      I+YW +++    ++ IF+V +   + 
Sbjct: 127 RRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNL 186

Query: 228 FGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFAS----- 282
             V+ YGE +F     K++ I GF+++ + + C             W +PG +       
Sbjct: 187 VPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRY-WRNPGPWGDGIISH 245

Query: 283 SNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTM 342
                RF G   +LVNA F+Y G EL  +S  +  NPRK+ P A     +RI++ Y+ ++
Sbjct: 246 DIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSL 305

Query: 343 ILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSL 402
             IG +VP N  +L  +   +    SP+++A    G K++P I NAVIL  +IS ANS++
Sbjct: 306 FFIGLLVPFNDEKLTSSDSYSA--GSPFIIAIQNSGTKILPDIFNAVILATIISAANSNV 363

Query: 403 YAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAA 462
           Y G R+L  LA++  APRF +  +R G P  A+L  A  G +G+ + S    + F WL  
Sbjct: 364 YVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLN 423

Query: 463 ISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQF 522
           I+ ++  F+W  I   H+RF +A+KLQ  S D L +KA    WG+Y+   F  L+   Q 
Sbjct: 424 ITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQG 483

Query: 523 WVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVY 582
           + +L+P       + ++FFA+Y+++ ++LV +  + CWY+   ++  +  VD+D+ R+  
Sbjct: 484 FTSLAP-----TFNVSNFFAAYISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSDRREV 537

Query: 583 DPE 585
           D +
Sbjct: 538 DAQ 540

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  288 bits (736), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 176/512 (34%), Positives = 280/512 (54%), Gaps = 17/512 (3%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           KK +++RHV M+++G  +GTGLL+  G  L+LAGPA+++IAY  V  + +F++   GEMA
Sbjct: 80  KKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMA 139

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211
              P L G F +Y++ +     GFA  + +  ++  ++P +L   A+ I+YW     ++P
Sbjct: 140 AYIP-LDG-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
            V++ I  V ++ I+F GV+ +GE E+  +A KI ++ G II  +V+ C           
Sbjct: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGF 257

Query: 272 XXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326
             W +PGAF     A +    RF       V A F+Y G EL  + V++ KNPRK+ P A
Sbjct: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317

Query: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA-SGGNGLHASPYVLAASIHGIKVVPHI 385
            K  +YRI+V YL+++ L+G  VP N   L+ A S      ASP+V+A    GI V+PHI
Sbjct: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHI 377

Query: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445
           +NA ILI + S ANS LY   R L  LA    APR  +  +++G P  +LL+  L  ++ 
Sbjct: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437

Query: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505
           +   S    EVFT+      +  L +W SI+ ++IRF +A ++Q     TL Y++    +
Sbjct: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497

Query: 506 GSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFT 565
           G++F + F IL+   + +    P   G   D  SF   Y+ +P +++ Y GY  WYK  T
Sbjct: 498 GAWFSLFFCILIGLIKNF----PAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK--T 551

Query: 566 VLTDLNQVDLDNHRKVYDPEFLRQEDLENKER 597
            +    +VDL + ++  D E   +  + ++ER
Sbjct: 552 KIIPSEEVDLVSFKEAVDLE-EEEGKMLDEER 582

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  286 bits (733), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 183/542 (33%), Positives = 286/542 (52%), Gaps = 21/542 (3%)

Query: 73  RADDSPDHND-LEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASL 131
           R +DS   +D ++     H   +K +K+RH+ M+++G  IGTGLL+  G  L  AGP S+
Sbjct: 65  RLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSM 124

Query: 132 VIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVL 191
            IAY  V  + +F + A GEMA +Y  L G F +Y S +     GFA  + +  ++L + 
Sbjct: 125 FIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILP 182

Query: 192 PLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIG 249
           P +L  AA+ I+YW     ++P V++ IF V ++ ++F GV+ +GE EF  +  K++++ 
Sbjct: 183 PNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMI 242

Query: 250 GFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFA----SSNGAS-RFKGICYNLVNAYFSYG 304
           G II   V+               +  PGAF     S +G+  +F      LV A F+Y 
Sbjct: 243 GLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYL 302

Query: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA-SGGN 363
           G EL  +   +  NPRKS P A K  +YRI+V YL+T+ L+G  V ++   L  A + G 
Sbjct: 303 GIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGT 362

Query: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423
           G  ASPYV+A    GIK +PHI NA +L+ + S  NS LY   R L  LA    AP+  +
Sbjct: 363 GAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
             +R G P  +LL+S+   ++ + + S    ++F +   +  +  L +W SI+ +++ F 
Sbjct: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFA 542
           RA+K QN       Y+A    +GSYF + F IL+ F   F V L+        D  +F  
Sbjct: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN-----HHFDYKNFIT 537

Query: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQE--DLENKERLRN 600
            Y+ +P++++ YFGY    K  T +    +VDL   +   D E  + +  D E +ERL+N
Sbjct: 538 GYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595

Query: 601 SS 602
           S 
Sbjct: 596 SK 597

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  286 bits (731), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 172/532 (32%), Positives = 283/532 (53%), Gaps = 20/532 (3%)

Query: 69  DSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128
           D+F   D   D ++ E     + E K+ +K RH+ M++LG  IGTGL +     L+ AGP
Sbjct: 63  DTFSMEDGIGDEDEGE---VQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGP 119

Query: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188
              +I+Y  +  + Y + Q+ GEMA   P +  SF  ++  F+S  FG A  +++   W 
Sbjct: 120 VGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWA 178

Query: 189 TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMI 248
               LEL      I++W   +    ++ IF+V +  ++ F V+ YGE EF   + K+L I
Sbjct: 179 ITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAI 238

Query: 249 GGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSY 303
            GF+I+   + C             W +PGA+     +      RF G   +L+NA F++
Sbjct: 239 IGFLIYCFCMVCGAGVTGPVGFRY-WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF 297

Query: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN 363
            G EL  ++  +  NPRKS P A K  V+RI+  Y+ +++ IG +VP+N  +L  ++  +
Sbjct: 298 QGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST--S 355

Query: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423
            +  SP+++A    G KV+PHI NAVIL  +IS ANS++Y G R+L  L++   AP+FLS
Sbjct: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
              + G P  A+ ++A  G + +  TS   ++VF WL  I+G++  F W  I  SHIRF 
Sbjct: 416 RTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS 543
           +A+K +  S D L +KA      +Y+   F  ++   Q + A +P     K +  SF A+
Sbjct: 476 QALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAA 530

Query: 544 YLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595
           Y+++ ++L  +  + C ++    +  +  VD+D+ R+  D E +  ED E K
Sbjct: 531 YISIFLFLAVWILFQCIFR-CRFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  285 bits (729), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 186/604 (30%), Positives = 302/604 (50%), Gaps = 45/604 (7%)

Query: 24  SNDYVHEQNHIIEGXXXXXXXXXXXHNLRS---------------RFDVQVKNRHLQG-- 66
           SN +  +QN+I E            H + +               +++ + K+  LQG  
Sbjct: 10  SNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYSIDEKQYNTKKKHGSLQGGA 69

Query: 67  ------FIDSFKRADDSPDHNDL-EKTTTAHQEQK---KTMKSRHVIMMSLGTGIGTGLL 116
                   +S  R        D+ E    AH E K   + +K RH+ M++LG  IGTGL 
Sbjct: 70  IADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIGTGLF 129

Query: 117 VSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFG 176
           V     LS AGP   +IAY  +  + YF+ Q+ GEMA   P +  S   ++  F+S  FG
Sbjct: 130 VGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAFG 188

Query: 177 FATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGET 236
            +  +++   W     +E+      I+YW   +    ++ IF+V +  ++FF V+ YGE 
Sbjct: 189 VSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEF 248

Query: 237 EFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKG 291
           EF   + K+L I G++I+A+++ C             W +PGA+     +S     RF G
Sbjct: 249 EFWVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRY-WRNPGAWGPGIISSDKSEGRFLG 307

Query: 292 ICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPH 351
              +L+NA F+Y G EL  ++  +  NPRK+ P A    V+RIV+ Y++++  IG +VP+
Sbjct: 308 WVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPY 367

Query: 352 NSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSS 411
           N S L  +S    + +SP+V++    G   +P I NAV+LI ++S ANS++Y G R+L S
Sbjct: 368 NDSRLSASS--AVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYS 425

Query: 412 LAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFT 471
           LA+ G AP+   YV R+G P   ++ +A +G++ F   +      F WL  IS L+ L  
Sbjct: 426 LARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCA 485

Query: 472 WTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNS 531
           W  I  +HIRF +A+K +  S D L +KA    +G+Y+   F  ++   Q + A  P   
Sbjct: 486 WLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP--- 542

Query: 532 GGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQED 591
                 + FF SY+++ +  V + G   +YK    +  L  +D+D+ R+  + E +  ED
Sbjct: 543 ---FKVSEFFTSYISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDRR--EIEAIIWED 596

Query: 592 LENK 595
            E K
Sbjct: 597 DEPK 600

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  280 bits (717), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 169/503 (33%), Positives = 281/503 (55%), Gaps = 22/503 (4%)

Query: 104 MMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSF 163
           M+S+G  +GTGL +  G+ L  +GP +L+I + +V    + +IQ+A E++  YP + GSF
Sbjct: 1   MISIGGTLGTGLFIGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSF 58

Query: 164 NAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLM 223
           +++ S FI    GF  +  + + WL   P EL+  AMTI YWN  I P V+V+I Y+ ++
Sbjct: 59  SSHVSRFIEPSLGFTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVI 118

Query: 224 FIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX--XXXXXXXXXXWHDPGAFA 281
            ++ F V+ + E+EF  +  K+L I  F+I  IV+ C               WHDPGAF 
Sbjct: 119 GLNLFAVRGFAESEFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR 178

Query: 282 SSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLT 341
                  F  +C   V+A F++GG EL +L+ N+ +   +S   AAK   +RI + Y+ T
Sbjct: 179 PPF----FSSLCQTFVSAAFTFGGAELVLLTANESRK-IESISRAAKGTFWRIAIFYIST 233

Query: 342 MILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGI--KVVPHIINAVILIALISVAN 399
           +I+IG +VP+ S  L G S    + ASP+V+A S  G     V H +NAVI+ A++SV N
Sbjct: 234 VIVIGCLVPYTSPALDGES----IRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCN 289

Query: 400 SSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTW 459
           S +YA  R++ SL   G  P    Y+D++GRPL  + + A+ G++ F   + + ++VF W
Sbjct: 290 SCVYAASRVIQSLGACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNW 349

Query: 460 LAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFA 519
           L A+  ++  F W  I  S +R+RRA+K+Q    + + Y++  G W    G   N L+  
Sbjct: 350 LFALCSIAAFFVWFCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLIC 409

Query: 520 AQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF-TVLTDLNQVDLDNH 578
            + +V++         D  +FF + +++P+ ++FYF +  + +D+ T L     +DL+  
Sbjct: 410 GEIYVSVK------DGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTG 463

Query: 579 RKVYDPEFLRQEDLENKERLRNS 601
           RK  D E ++ E + ++ R+ +S
Sbjct: 464 RKPEDLEMMKHELIVSRARIASS 486

>Scas_706.36d
          Length = 607

 Score =  283 bits (724), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 167/509 (32%), Positives = 269/509 (52%), Gaps = 17/509 (3%)

Query: 92  EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGE 151
           E K+ +K RH+ M++LG  IGTGL V     L+ +GP   +IAY  +  + Y + Q+ GE
Sbjct: 100 EVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGE 159

Query: 152 MAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDP 211
           MA   P +  S   ++  F+S  FG A  +++   W     +E+      I+YW   +  
Sbjct: 160 MATFIP-VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPL 218

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
             ++ IF+VF+  ++FF V+ YGE EF     K+L I G++++A+++ C           
Sbjct: 219 AAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGFR 278

Query: 272 XXWHDPGAFAS-----SNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326
             W +PG + +         SRF G   +L+NA F+Y G EL  ++  +  NPRKS P A
Sbjct: 279 Y-WRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 337

Query: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHII 386
               V+RI + Y++++  IG +VP++   L   S    + +SP+V++    G K++P I 
Sbjct: 338 INKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDS--AVVASSPFVISIQNAGTKILPDIF 395

Query: 387 NAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGF 446
           NA+++I +IS ANS++Y G R+L +LAQ G AP+  +YV R G P   +L +A +G++ F
Sbjct: 396 NAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAF 455

Query: 447 AATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWG 506
              +      F WL  IS L+ L  W  I  SHIRF +A+K +  S D L +KA    W 
Sbjct: 456 LVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWA 515

Query: 507 SYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTV 566
           +Y+   F  ++   Q + A SP       D  +FF +Y+++ I  V + G   +Y+    
Sbjct: 516 AYYATFFVTVIIFIQGFQAFSP-----HFDVTAFFTAYISLIILAVLFIGCQIYYR-CRF 569

Query: 567 LTDLNQVDLDNHRKVYDPEFLRQEDLENK 595
              L  +D+D  R+  + E +  ED E K
Sbjct: 570 FWKLEDIDIDTDRR--EIEEVIWEDDEPK 596

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  282 bits (722), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 179/544 (32%), Positives = 291/544 (53%), Gaps = 27/544 (4%)

Query: 56  DVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGL 115
           DVQV +       + +  A+      D  +T     E K+ +K RHV M++LG  IGTGL
Sbjct: 48  DVQVSS-------ELYDHAESEEGEGDFHET-----EVKRALKPRHVSMIALGGTIGTGL 95

Query: 116 LVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPF 175
            V   K LSL+GP   +IAY  +  V YF+ Q+ GEMA   P +  S   ++  F+S  F
Sbjct: 96  FVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIP-VTSSITVFSKRFLSPAF 154

Query: 176 GFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235
           G A  +++   W     +EL      I YW  ++    ++ IF+V L   +FF V+ YGE
Sbjct: 155 GVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGE 214

Query: 236 TEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGA-----SRFK 290
            EF   + K++ I G++++A+++ C             W +PG + +   A     +RF 
Sbjct: 215 FEFCVASIKVIAIVGYLLYALIIVCGGSSQGPIGFRY-WRNPGPWGTGTIAKNVNKARFL 273

Query: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350
           G   +LVNA F+Y G EL  ++  +  NPRK+ P A     +RI+V Y+ ++  +G +VP
Sbjct: 274 GWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVP 333

Query: 351 HNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLS 410
           +NS +L   S    + +SP+V++    G KV+P I NAV+L+ ++S  NS++Y G R+L 
Sbjct: 334 YNSPQL--ESNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLY 391

Query: 411 SLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELF 470
           SLA  G AP+  SYV ++G P   ++ +AL+G++ F AT+      F WL  IS L+ L 
Sbjct: 392 SLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLC 451

Query: 471 TWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530
            W  I  +HIRF + +KL+  S D+L +KA    WG+Y+   F  L+   Q + A +P  
Sbjct: 452 AWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP-- 509

Query: 531 SGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQE 590
              + D + FF +Y+++ + +V +     +Y+    LT +  +D+D+ R+  D      +
Sbjct: 510 ---RFDVSEFFTAYISLILLVVLFILCQLYYR-CRFLTKIEDIDIDSDRREIDAIIWEDD 565

Query: 591 DLEN 594
           + +N
Sbjct: 566 EPKN 569

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  281 bits (719), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 165/525 (31%), Positives = 279/525 (53%), Gaps = 18/525 (3%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           +D  +  D ++T     E K+ +K+RH+ M++LG  IGTGL +     L  AGP   ++A
Sbjct: 42  EDHTEEGDYQET-----EVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLA 96

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           Y  +  V Y + Q+ GEMA   P +  S   ++  F+S  FG A  +++   W     +E
Sbjct: 97  YIFIGTVVYSITQSLGEMATFIP-VTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVE 155

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
           L      I+YW   +    +++IF+V +  ++FF V+ YGE EF   + K+L I G++I+
Sbjct: 156 LSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIY 215

Query: 255 AIVVNCXXXXXXXXXXXXXWHDP--GAFASSNGASR---FKGICYNLVNAYFSYGGNELF 309
           A ++ C                P  GA ASS    +   F G   +L+ A F+Y G EL 
Sbjct: 216 AFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELV 275

Query: 310 VLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASP 369
            ++  +  NPRK+ P A     +RI+  Y+ +++ +G +VP++   L   S  + ++ASP
Sbjct: 276 GITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTD-VNASP 334

Query: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429
           +V++    G K++P I NAV+LI +IS ANS++Y G R+  SLA  G AP+ L++V ++G
Sbjct: 335 FVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQG 394

Query: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489
            P   +L+++L+G++ F   +      F WL  IS L+ L  W  I  +HIRF + +K +
Sbjct: 395 VPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHR 454

Query: 490 NKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPI 549
             S D L +KA    W +Y+   F  ++   Q + A +P     K D  +FF SY+++ +
Sbjct: 455 GISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP-----KFDVTTFFTSYISLFL 509

Query: 550 WLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN 594
            L+ + G   +YK    L  +  +D+D+ R+  D     +++ +N
Sbjct: 510 MLLVFIGCQIYYK-CRFLWAVEDIDIDSDRREIDAIVWEEDEPKN 553

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  278 bits (712), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 164/528 (31%), Positives = 284/528 (53%), Gaps = 19/528 (3%)

Query: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117
           ++  R  +  + S +  D + + ++L +    H + K+++K RH+ M++LG  IGTGL +
Sbjct: 35  ELGRRKRKTSVSSTQYEDLATEKDELLE----HHDVKRSLKQRHIGMIALGGTIGTGLFI 90

Query: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177
                L+ AGP   ++AY  +  V + + Q+ GEMA   P +  SF+ +   F+S   G 
Sbjct: 91  GIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIP-VTSSFSVFAQRFLSPALGA 149

Query: 178 ATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETE 237
           A  +++ + W     LEL      I++W   +    ++ IF+V L   + F V+ YGE E
Sbjct: 150 ANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFE 209

Query: 238 FIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGI 292
           F   + K+L + GF+I+++ + C             W +PGA      +S+ G +RF G 
Sbjct: 210 FWIASIKVLALMGFLIYSLCIVCGAGKTGPIGFRY-WRNPGAMGPGIISSNTGEARFLGW 268

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHN 352
             +L+NA F+Y G EL  ++  +  NPRK+ P A +  + RI++ Y+ ++  IG  VP+N
Sbjct: 269 VSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYN 328

Query: 353 SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412
             +L   S  + + +SP+++     G +V+PHI NAVIL  +IS  NS++Y G R+L S+
Sbjct: 329 DPKL--TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSM 386

Query: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472
           A+ G AP+FL+    +G P  ++L  +  G + +   S    + F WL  I+G++  F W
Sbjct: 387 AKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAW 446

Query: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG 532
             I  SH+RF +A+K +  S D L YKA    W +Y+ + F +++   Q + + +P  SG
Sbjct: 447 LLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSG 506

Query: 533 GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK 580
                  F A+Y+++ ++LVF+ G+   Y    ++  L  VD+D  R+
Sbjct: 507 -----RDFVAAYISVGLFLVFW-GFFQIYFRCRIIWKLEDVDIDTDRR 548

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  275 bits (704), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 173/530 (32%), Positives = 285/530 (53%), Gaps = 15/530 (2%)

Query: 56  DVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGL 115
           D Q    ++   I + ++ +D     + E +    +E K+ +K RH+ M++LG  IGTGL
Sbjct: 30  DEQYSGENVTKAITTERKVEDDA-AKETESSPQERREVKRKLKQRHIGMIALGGTIGTGL 88

Query: 116 LVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPF 175
           ++  G  L+ AGP   +I+Y  +  V Y + Q+ GEM VT+  +  SF+ +   F+S   
Sbjct: 89  IIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPAL 147

Query: 176 GFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235
           G    +++ + W     LEL      I+YW  ++    +++IF+  L  ++ F V+ YGE
Sbjct: 148 GATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGE 207

Query: 236 TEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFK 290
            EF   + K++ + GFIIF+  V C             W +PGA+     +S     RF 
Sbjct: 208 FEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFL 267

Query: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350
           G   +L+NA F+Y G EL  ++  +  NPRK+ P A K  V RI+V Y+L++  IG +VP
Sbjct: 268 GWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVP 327

Query: 351 HNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLS 410
           +N  +L   S G  + +SP++++    G KV+P I NAV+LI ++S  NS++Y G R+L 
Sbjct: 328 YNDPKL--DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLY 385

Query: 411 SLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELF 470
           SL++   APRFLS V R G P  ++L +++ G + F   S    + F WL  I+G++  F
Sbjct: 386 SLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFF 445

Query: 471 TWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530
            W  I FSHIRF +A++ +  S D L YKA    + +Y+   F  L+   Q + A +P  
Sbjct: 446 AWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAP-- 503

Query: 531 SGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK 580
                    F A+Y+++ ++L  +  +  W+K   +L  L  +D+D+ R+
Sbjct: 504 ---TFQPIDFVAAYISIFLFLAIWLSFQVWFK-CRLLWKLQDIDIDSDRR 549

>Kwal_33.13411
          Length = 560

 Score =  272 bits (696), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 166/542 (30%), Positives = 276/542 (50%), Gaps = 18/542 (3%)

Query: 58  QVKNRHLQGFIDSFKRADDSPDHND-LEKTTTAHQEQ--KKTMKSRHVIMMSLGTGIGTG 114
           + ++   Q ++ S +  +    HN   E      QE   K+ +K RHV M++LG  IGTG
Sbjct: 16  KTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDLQEGQVKRALKPRHVSMIALGGTIGTG 75

Query: 115 LLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKP 174
           L V     LS AGP   +IAY  +  + YF+ Q+ GEMA T+  +  S   +++ F+S  
Sbjct: 76  LFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA-TFIPVTSSITVFSNRFLSPA 134

Query: 175 FGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYG 234
           FG A  +++   W     +E+      I+YW  ++    ++ IF+V +   +FF V+ YG
Sbjct: 135 FGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYG 194

Query: 235 ETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRF 289
           E EF   + K++ I G++++A+++ C             W +PG +     +      RF
Sbjct: 195 EVEFWVASIKVIAIVGYLLYALIIVCGGSKQGPIGFRY-WRNPGPWGDGIISGDKDKGRF 253

Query: 290 KGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV 349
            G   +L+NA F+Y G EL  ++  +  NPRK+ P A     +RI+  Y+L++  +G +V
Sbjct: 254 LGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLV 313

Query: 350 PHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409
           P+N   L   +  + + +SP+V++    G +++P I NAV+L+ +IS ANS++Y G R+L
Sbjct: 314 PYNHPGLDKHT--SVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRIL 371

Query: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469
            SLA  G AP+  SYV  +G P   ++ +AL+G++ F        E F WL  IS L+ L
Sbjct: 372 FSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGL 431

Query: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529
             W  I  SHIRF + +K +  S D L +K+    +G+Y+   +  ++   Q + A  P 
Sbjct: 432 CAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCP- 490

Query: 530 NSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQ 589
               K     FF  Y+++ I L   F     Y        L  +D+D+ R+  D     +
Sbjct: 491 ----KFKVAEFFTGYISL-ILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREIDALIWEE 545

Query: 590 ED 591
           E+
Sbjct: 546 EE 547

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  272 bits (696), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 175/541 (32%), Positives = 280/541 (51%), Gaps = 29/541 (5%)

Query: 75  DDS---PDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASL 131
           DDS   PD  D       +   +K +K+RH+ M+++G  +GTGLL+  G  L   GP ++
Sbjct: 67  DDSFAVPDGKD------ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAM 120

Query: 132 VIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVL 191
           +IAY  V  + ++ +   GEMA +Y  L G F +Y S ++    GFA  + +  ++  + 
Sbjct: 121 LIAYAFVGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILP 178

Query: 192 PLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIG 249
           P +L  AA+ I+YW     ++P V++ IF V ++ I+  GV+ +GE EF  ++ K++++ 
Sbjct: 179 PNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVML 238

Query: 250 GFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYG 304
           G I+   ++               W DPGAF     A + G  +F       V + FSY 
Sbjct: 239 GLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYT 298

Query: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN- 363
           G EL  +  ++ +NPRKS P A K  VYRI+V YL T+ L+G  V +N   LL   G + 
Sbjct: 299 GIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSM 358

Query: 364 GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423
              ASP+V+A    GI+V+PHI NA +L+ + S  NS LY   R L +LA  G AP+  +
Sbjct: 359 SAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFA 418

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
              R G P  AL+LS L   + +   S    ++F +   +  +  + +W +I+  +I F 
Sbjct: 419 KTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFD 478

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFA 542
           +A + Q        Y A    +G+YF + F IL+     F V L     G K D  +F  
Sbjct: 479 KACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL-----GHKFDYKTFIT 533

Query: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFL--RQEDLENKERLRN 600
            Y+ +P++++ + GY   YK  T +     VDL   +++YD E    R +D E +ERL++
Sbjct: 534 GYIGLPVYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKS 591

Query: 601 S 601
           +
Sbjct: 592 N 592

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  270 bits (690), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 263/493 (53%), Gaps = 13/493 (2%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           DDS    D E +     E K+ +K RHV M++LG  IGTGL +S    L  AGP   +IA
Sbjct: 56  DDSSRMFDPEGSI-GQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIA 114

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           + L+  + Y + Q+ GEMA   P +  SF  ++  FIS   G A  +++   W     LE
Sbjct: 115 FMLIGTLAYSVTQSLGEMATFIP-VTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALE 173

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
           L      I+YW  ++  + ++ IF+V L+  + F V+ YGE EF   + K++ I GF+I+
Sbjct: 174 LSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIY 233

Query: 255 AIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELF 309
           ++ + C             W  PG +     A +   +RF G   +L++A F+Y G EL 
Sbjct: 234 SLCMVCGAGPEGPIGFRY-WRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELV 292

Query: 310 VLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASP 369
            ++  + KNPRK+ P A     +RI++ Y+ ++  IG +VP+N  +L G+  G+ +  SP
Sbjct: 293 GITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSP 352

Query: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429
           +++A       V+PHI NAVIL  +IS  NS++Y G R+L  L++   AP+F S   + G
Sbjct: 353 FLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHG 412

Query: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489
            P  A+L++A+ G + +   S   +EVF WL  I+ ++   TW  I  SHIRF + +K +
Sbjct: 413 VPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHR 472

Query: 490 NKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPI 549
             S D L YKA    + +Y+   F  ++   Q + A +P       + + FFA+Y+++ +
Sbjct: 473 GISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP-----HFNVSDFFAAYISVFL 527

Query: 550 WLVFYFGYMCWYK 562
           + + +  +   Y+
Sbjct: 528 FFIVWAIFQTIYR 540

>Scas_486.2
          Length = 597

 Score =  266 bits (680), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 172/537 (32%), Positives = 281/537 (52%), Gaps = 21/537 (3%)

Query: 74  ADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVI 133
           A+D  D  +++  T   +  KK ++ R V M+++G  +GTGLL+  G  L+ AGP S++I
Sbjct: 53  AEDQNDSYNVDGKTEGTR-LKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLI 111

Query: 134 AYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPL 193
           AY  V  + +F + + GEMA +Y  L G F +Y + +     GFA  + +  ++  + P 
Sbjct: 112 AYAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPN 169

Query: 194 ELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGF 251
           +L  AA+ I+YW     ++P V++ IF V ++ I+  GVQ +GE EF  ++ K+L++   
Sbjct: 170 QLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFAL 229

Query: 252 IIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGN 306
           II   ++               W  PGAF     A +    +F       V A F+Y G 
Sbjct: 230 IILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGT 289

Query: 307 ELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA-SGGNGL 365
           EL  + V + +NPRKS P A K  +YRI++ YL++++L+G  V ++   LL A +     
Sbjct: 290 ELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSA 349

Query: 366 HASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYV 425
            ASP+V+A    GIKV+PHI NA +L+ + S  NS LY   R L SLA    AP+  +  
Sbjct: 350 AASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFART 409

Query: 426 DRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRA 485
           +R G P  +L LS L  ++ + + S    ++F +   +  +  L +W  I+ +++ F RA
Sbjct: 410 NRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRA 469

Query: 486 MKLQNKSLDTLGYKANTGLWGSYFGVGF-NILVFAAQFWVALSPPNSGGKCDANSFFASY 544
           ++ Q     T  Y A    +G+YF + F +++     F V L     G + D  +F   Y
Sbjct: 470 VRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFL-----GHQFDYKTFITGY 524

Query: 545 LAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFL--RQEDLENKERLR 599
           + +P++ + YFGY   YK  T + D  +VDL   +   D E    + ED+  KER++
Sbjct: 525 IGIPVFFISYFGYKLIYK--TKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  263 bits (671), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 156/487 (32%), Positives = 263/487 (54%), Gaps = 15/487 (3%)

Query: 79  DHNDLEKTTTAHQ----EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           +HN  E  +   +    + K+ +K RHV M+SLG  IGTGL +     +  AGP   ++A
Sbjct: 31  NHNTSEVESLCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLA 90

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           Y  V+ + Y + Q+ GEMA   P +  SF  + S F+S   G A  +L+ + W     LE
Sbjct: 91  YIFVATMAYCVTQSLGEMATFIP-VTSSFTVFASRFVSPALGAANGYLYWLSWCITFALE 149

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
           +      I YW+ ++    ++ IF+V L  I+   V+ YGE EF   + K++ I  F+ +
Sbjct: 150 ISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFY 209

Query: 255 AIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELF 309
            +VV C             W DPG +     +     ++F G   +L+ A F++ G EL 
Sbjct: 210 GLVVVCGGSKLGRIGFRY-WKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELV 268

Query: 310 VLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASP 369
            ++  + KNPR++ P A  +  +RI++ Y+ ++++IG +V ++  +L+        +ASP
Sbjct: 269 GVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASP 328

Query: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429
           +V+A +  G KV+P I+N VI++ +IS  NS++Y G R+L  L + G AP F+S    RG
Sbjct: 329 FVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRG 388

Query: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489
            P  A+L +++ G +G+   S +   VF WL +I+ +S  FTW  I  SHIRF + +K +
Sbjct: 389 VPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKR 448

Query: 490 NKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS-YLAMP 548
             S D L +KA    +G+Y+   F I++   Q + A +P ++    D  +++ S ++ + 
Sbjct: 449 GISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFSA---VDFVAYYISAFIFVV 505

Query: 549 IWLVFYF 555
           IWL+F F
Sbjct: 506 IWLLFQF 512

>Kwal_33.15545
          Length = 576

 Score =  252 bits (644), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 164/520 (31%), Positives = 263/520 (50%), Gaps = 24/520 (4%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           KK +++RHV M+++G  +GTGLL+  G  L+ AGP S++I+Y  V  + Y ++   GEMA
Sbjct: 51  KKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMA 110

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211
              P L G F +Y S ++    GFA  + +  ++  V P +L   AM +++W     ++P
Sbjct: 111 AFIP-LDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNP 168

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
            V++ IF   ++ I+  GV+ +GE EF  ++ K+L++ G I+   ++             
Sbjct: 169 GVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGF 228

Query: 272 XXWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326
             W DPGAF     A S    +F         A F+Y G EL  +   + KNPR+S P A
Sbjct: 229 RFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRA 288

Query: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASG-GNGLHASPYVLAASIHGIKVVPHI 385
            K  +YRIVV Y++T++L+G  V +N   LL A        ASP+V+A     I V+PHI
Sbjct: 289 IKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHI 348

Query: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445
            N  +L+ + S  NS LY   R L  LA  G APR  +  ++ G P  +L LS L  ++ 
Sbjct: 349 FNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLA 408

Query: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505
           +   S    +VF +   +  +  L +W +I+ ++IRF +A+++Q     +L Y A    W
Sbjct: 409 YMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPW 468

Query: 506 GSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFT 565
            +Y  + F  L+   + +        G K D  +F + Y+ +P++L+ Y GY   Y+  T
Sbjct: 469 STYVALFFCCLIGLIKNYTVF----LGHKFDYKTFISGYIGIPVYLICYVGYKVVYR--T 522

Query: 566 VLTDLNQVDLDNHRKVYDP--------EFLRQEDLENKER 597
            L     VDL   +   D         E  R E++EN  +
Sbjct: 523 KLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENMENSPK 562

>Scas_377.2
          Length = 490

 Score =  249 bits (637), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 153/495 (30%), Positives = 257/495 (51%), Gaps = 17/495 (3%)

Query: 112 GTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFI 171
           G GL +     L  AGP   +IAY  ++ + Y + Q+ GEMA   P +  SF  ++  F+
Sbjct: 4   GXGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIP-VTSSFTVFSQRFV 62

Query: 172 SKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQ 231
           S  FG A  +++   W     LEL      I++W  ++    ++ IF+V L  ++ F V+
Sbjct: 63  SPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVK 122

Query: 232 AYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAF-----ASSNGA 286
            YGE EF     K++ I GF+I+   + C             W  PGAF     A     
Sbjct: 123 YYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGFRY-WRHPGAFGPGIIAKDKNQ 181

Query: 287 SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346
           +RF G   +L+NA F++ G EL  ++  +  NPRK+ P A K  V+RI+  Y+L++  IG
Sbjct: 182 ARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIG 241

Query: 347 FVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGP 406
            +VP++  +L   S  + + ASP+++A    G  V+PHI NAVI+  +IS  NS++Y G 
Sbjct: 242 LLVPYDDWKL--TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGS 299

Query: 407 RLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGL 466
           R++  L+    AP  LS   + G P  A+L+++L G + +  TS   ++ F WL  I+G+
Sbjct: 300 RIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGV 359

Query: 467 SELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVAL 526
           +  FTW  I  SHIRF +A++++  S D L +KA      +Y+GV F  L+   Q + + 
Sbjct: 360 AGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSF 419

Query: 527 SPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRK-VYDPE 585
            P N         F  +Y+++ +++  +  +  W++   ++  +  VD+D  R+ V +  
Sbjct: 420 CPWN------GIDFLTAYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAV 472

Query: 586 FLRQEDLENKERLRN 600
           ++ QE     ++  N
Sbjct: 473 WIEQEPRGFWDKFWN 487

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  250 bits (638), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 255/526 (48%), Gaps = 24/526 (4%)

Query: 59  VKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQ--------KKTMKSRHVIMMSLGTG 110
           V NR L+   +     +  P +N+  +  + ++E         K+ +K RH+ +++LG  
Sbjct: 14  VSNRGLKDAYNEVTEMEVDPKNNEYAEEQSLNREDTFDPDSGVKRQLKDRHISLLALGGI 73

Query: 111 IGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFF 170
           IG G L+  G  L++ GP +L++ +G++  + + M+++ GEM   YP+  G F   T  F
Sbjct: 74  IGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPS-GGGFTTLTRRF 132

Query: 171 ISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGV 230
            S        + + + +  VL  E  T +  +++W   +    +++IF+         GV
Sbjct: 133 HSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGV 192

Query: 231 QAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFK 290
            A+GETE+     KIL +  + IF+IV                W+DPGA   SNG   FK
Sbjct: 193 GAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGAL--SNG---FK 247

Query: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350
           GI    V     Y G E   L+  + KNPR++ P A +   +RI+++YL   I  G  VP
Sbjct: 248 GIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGVTVP 307

Query: 351 HNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLS 410
           +N   L  A+    +  SP  +A S  G     H++NA ILI  IS  N SLY G R L+
Sbjct: 308 YNDENLNFATK---VLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTLT 364

Query: 411 SLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELF 470
            LA +G AP+ L++ DRRG P+ A+ +   +G+I     S    + + ++  +SG+    
Sbjct: 365 HLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVFI 424

Query: 471 TWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530
            W  I  +H+RFR+A KLQ  + D L YKA          +  NI +   Q W    P  
Sbjct: 425 VWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP-- 482

Query: 531 SGGKCDANSFFASYLAMPIWLVFYFGYMCW-YKDFTVLTDLNQVDL 575
                DA +F  +Y+ +P  ++ Y G   W  K F    DL++V+L
Sbjct: 483 ----FDAKNFVDAYILIPAGIILYLGVSYWKTKGFLTAVDLSEVNL 524

>Scas_520.2*
          Length = 372

 Score =  228 bits (582), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 131/355 (36%), Positives = 197/355 (55%), Gaps = 16/355 (4%)

Query: 231 QAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFK 290
           +++GETEF+ +  +IL I GF I  IV+ C             W+ PG+F   N  ++FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 291 GICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVP 350
           G+C   V A FSY G E+  +S  + K+PR + P AAK            T +LIG  VP
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKR-----------TFVLIGCFVP 111

Query: 351 HNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLS 410
           +++  LL  +      +SP V+A    G K +  ++NA+ILI++ISVANS++Y   R + 
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 411 SLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELF 470
           ++   G  PR L+ VD +GRP+ A++ +   G++ F A S R+ +VFTWL+A+SGL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 471 TWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFG--VGFNILVFAAQFWVALSP 528
            W +I  SHIR R+AM  QN+SLD L + + TG+WGS++G  V F+ LV  A FW +L P
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLV--ASFWTSLFP 289

Query: 529 PNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
              G   DA  FF  +  +   +        + +    +  L  +DLD  R+  D
Sbjct: 290 LG-GTSADAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMD 343

>Kwal_26.9612
          Length = 543

 Score =  232 bits (591), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 145/491 (29%), Positives = 241/491 (49%), Gaps = 15/491 (3%)

Query: 90  HQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149
           H   K+ +K+RH+ +++LG  IG G L+  G  L+  GP +L++ +G++  V + ++++ 
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209
           GE+   YP+  G F      F S+     + + + + +  VL  E  T +  +++W   +
Sbjct: 99  GELVTLYPS-GGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQV 157

Query: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXX 269
               + +IF+ F +     GV A+GE E+     KIL +  F IF+IV            
Sbjct: 158 PIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPI 217

Query: 270 XXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKS 329
               W +PGA +       F+GI    V     Y G E   L+  + +NPRK+ P A + 
Sbjct: 218 GFQYWKNPGALSHG-----FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQ 272

Query: 330 NVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAV 389
             +RI+++YL      G  VP+N   L GA   +    SP  +A S  G     H++NA 
Sbjct: 273 TFWRILIVYLGISFFYGVTVPYNDPTL-GAQTKS--LKSPISIALSRAGWAGGVHLVNAF 329

Query: 390 ILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAAT 449
           IL+  IS  NSSLY G R LS LA +G APR L++ D+RG P+ AL++   +G+I     
Sbjct: 330 ILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNV 389

Query: 450 SPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYF 509
           S      + ++  +SG+     W++I  +H+RFR+A   Q +SL  L Y+A    W + F
Sbjct: 390 SVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIF 449

Query: 510 GVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTD 569
            +  NI +   Q W +L P        A  F  +Y+ +P   + Y G   W        +
Sbjct: 450 SLAANIFLALIQGWTSLVP------FVAKDFVDAYILLPAAGLLYVGINFWKNRNFKTVN 503

Query: 570 LNQVDLDNHRK 580
           ++ ++L+  ++
Sbjct: 504 IHGINLEEGQR 514

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  232 bits (592), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 152/503 (30%), Positives = 251/503 (49%), Gaps = 44/503 (8%)

Query: 82  DLEKTTTAHQEQ-----KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYG 136
           DLEK+ +   +      K+ ++SRHV +++LG  IGTGLLV     L   GPA L I+Y 
Sbjct: 90  DLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYI 149

Query: 137 LVSFVTYFMIQAAGEMAVTYP----TLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192
           ++S V Y ++ A GEM    P       GS     + ++    GFAT W +   ++ ++ 
Sbjct: 150 IISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVA 209

Query: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252
            E   A+  ++YW T++   V++ IF   ++ ++F  V+ YGE+EF F + KIL I G I
Sbjct: 210 AECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLI 269

Query: 253 IFAIVVNCXXXXXXXXXXXXXWHDPGAFA---SSNGASRFKGICYNLVNAYFSY-GGNEL 308
           I + ++               W  PGAFA   +      F  I   ++   F++  G EL
Sbjct: 270 ILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPEL 329

Query: 309 FVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGLH 366
             ++  +  + R++   A++  V+R++  Y+L  + I  +VP+N   L+ A   G  G  
Sbjct: 330 VCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAG 389

Query: 367 ASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVD 426
           +SP+V+     GIKV+PHIIN  IL +  S AN+ ++A  R L ++AQ G AP+ L  ++
Sbjct: 390 SSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRIN 449

Query: 427 RRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAM 486
           + G P  A+ +S L   + +   S    +VF W + IS +S    W     +++RFR+A+
Sbjct: 450 KWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAI 509

Query: 487 KLQNKSLDTLGYKANTGLWGSYFGVGFNILV------------FAAQFWVALSPPNSGGK 534
              N   D L +K     WG  + V F+++V            F  ++W           
Sbjct: 510 -FYNGLYDRLPFKT----WGQPYTVWFSLIVIGIITITNGYAIFIPKYW----------- 553

Query: 535 CDANSFFASYLAMPIWLVFYFGY 557
                F A+Y+ +PI+LV +FG+
Sbjct: 554 -RVADFIAAYITLPIFLVLWFGH 575

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  228 bits (581), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 149/528 (28%), Positives = 252/528 (47%), Gaps = 21/528 (3%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           D+ PD +  +  T      K+ +K+RH+ +++LG  IG G LV  G  L+  GP +L++ 
Sbjct: 35  DEDPDVSRYDPQTGV----KRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLG 90

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           + ++  + + ++++ GEM   YP+  G F      F S        + + + +  VL  E
Sbjct: 91  FSIIGIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANE 149

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
             T +  +++W   +    +++IF+         GV  +GETE+     KI+ +  + IF
Sbjct: 150 YNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIF 209

Query: 255 AIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVN 314
           +IV                W+ PGA   S+G   FKGI    V     Y G E   L+  
Sbjct: 210 SIVYISGDIRNRPAFGFHYWNSPGAL--SHG---FKGIAIVFVFCSTFYSGTESVALAAT 264

Query: 315 DQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAA 374
           + KNP K+ P A +  ++RI+V+Y+   +  G  VP +   L   S    +  SP  +A 
Sbjct: 265 ESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL---SASTKVLKSPIAIAI 321

Query: 375 SIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTA 434
           S  G     H++NA ILI  IS  N SLY G R L+ LA +G AP+ L++ DRRG P+ A
Sbjct: 322 SRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPA 381

Query: 435 LLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLD 494
           + +   +G+I     S      ++++  +SG+     W  I ++H+R R+A   Q +S++
Sbjct: 382 ITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIE 441

Query: 495 TLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFY 554
            L Y+A    W     +  NI +   Q W    P       DA +F  +Y+ +P+ ++ Y
Sbjct: 442 ELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP------FDAGNFVDAYILLPVGILLY 495

Query: 555 FGYMCWYKDFTVLTDLNQVDLDN-HRKVYDPEFLRQE-DLENKERLRN 600
            G   +  +     DL  ++LD   RK  + +   QE  L + E +++
Sbjct: 496 IGICVFKSNHFRTVDLRSINLDEGRRKDMEADLSDQESSLASSETMKD 543

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  228 bits (581), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 156/520 (30%), Positives = 255/520 (49%), Gaps = 27/520 (5%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           KK +++RHV M+++G  +GTGLL+  G  L  AGP S++IAY ++ +V + ++   GEMA
Sbjct: 60  KKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEMA 119

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211
              P L G F +Y + +     GFA  W +  ++L + P +L   A+ I++W     + P
Sbjct: 120 AYIP-LDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSP 177

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
            V++ +    ++ I+  GV+ +GE EF  ++ K+L++   +I  +V+             
Sbjct: 178 GVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGF 237

Query: 272 XXWHDPGAFAS--------SNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKST 323
             W DPGAF            G  +F       V A F+Y G EL  +   + K+PR++ 
Sbjct: 238 RYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNV 297

Query: 324 PAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELL-GASGGNGLHASPYVLAASIHGIKVV 382
           P A K  +YRIVV YL+T+ L+G  V +N   L+  +S      ASPYV+A     I V+
Sbjct: 298 PRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVL 357

Query: 383 PHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVG 442
           P++ NA +L  + S  NS LY G R L  LA  G AP+  +  ++ G P  AL    L  
Sbjct: 358 PNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFC 417

Query: 443 VIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANT 502
            + + + S      F +   ++ +  L +W SI+ ++I F RA + Q     TL Y A  
Sbjct: 418 CLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPC 477

Query: 503 GLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYK 562
             +  +  + F I V   + + A      G + D  +F   Y+ +PI++  + GY   +K
Sbjct: 478 QPYAGWVALIFCIFVALIKNFDAF----IGKEVDVPTFITGYIGLPIYIFCFIGYKIVHK 533

Query: 563 DFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSS 602
             T      +VDL   ++          DLE +E +R  +
Sbjct: 534 --TKWIPSKEVDLFTFKEAI--------DLEEEECIRERA 563

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  227 bits (579), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 163/564 (28%), Positives = 272/564 (48%), Gaps = 45/564 (7%)

Query: 60  KNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSN 119
           K   + G +D F  +  +  H+      T H E K+ +KSRHV +++LG  IGTGL V  
Sbjct: 43  KFGKMPGDVDVFSLSSSTEKHSPHYTDMTGH-ELKQGLKSRHVQLIALGGAIGTGLFVGT 101

Query: 120 GKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYP---TLPGSFNAY-TSFFISKPF 175
              L   GPA L I+Y ++S V Y ++Q  GEM    P   + P  F AY    ++ +  
Sbjct: 102 SSTLHTCGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESL 161

Query: 176 GFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGE 235
           GFA  W +   ++ ++  E   A+  ++YW TS+    ++ IF   ++ ++F  V+ YGE
Sbjct: 162 GFADAWNYYYCYVILVAAECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGE 221

Query: 236 TEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASS-NGAS--RFKGI 292
           +EF F + KIL I G II + ++               W +PG FA    G S   F  I
Sbjct: 222 SEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDI 281

Query: 293 CYNLVNAYFSY-GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPH 351
              ++   F++  G E+  ++ ++ ++ R++   AA+  V+R++  Y+L  + I  +V +
Sbjct: 282 YTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAY 341

Query: 352 NSSELLGASGGN--GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409
           N   L  A   N  G  +SP+V+     GIKV+PHIINA IL +  S  N+ ++   R L
Sbjct: 342 NDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSL 401

Query: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469
            ++AQ G APR  + V+R G P  A+ LS+ +  + +   S    +VF W + IS +S  
Sbjct: 402 LTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGF 461

Query: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGV----------GFNILVFA 519
             W  +  ++IRF +A+         L Y A    +  Y+ +          G+   VF 
Sbjct: 462 IGWICVCIAYIRFHKAILFHGMQ-SRLPYTARGMPYLIYWPLLVISIITLTNGYE--VFI 518

Query: 520 AQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQV-DLDNH 578
            +FW            DA +F A+Y+ +P++ V + G+  + +    L     + ++D  
Sbjct: 519 PRFW------------DAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVV 566

Query: 579 RKVYDPEFLRQEDLENKERLRNSS 602
             V        E++E K R  ++S
Sbjct: 567 TGV--------EEIEEKTRECDAS 582

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  224 bits (571), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 159/547 (29%), Positives = 275/547 (50%), Gaps = 30/547 (5%)

Query: 53  SRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIG 112
           S +DV+ +     G ++  +        + LE T       +K + SRH+ +++LG  IG
Sbjct: 14  SFYDVKSQGETYSGTLNQLE--------SQLEGTKCDENNLEKGLSSRHIQLIALGGCIG 65

Query: 113 TGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFIS 172
           TGL V     L   GP  L +++ ++SF+ Y ++    EM + Y    G+    TS ++ 
Sbjct: 66  TGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVD 124

Query: 173 KPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQA 232
              GFA  W +   +  ++  EL  AA  ++YW   +   V++ IF V ++ ++F  V+ 
Sbjct: 125 PSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKF 184

Query: 233 YGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFA---SSNGASRF 289
           YGE+EF F + KI+ I G +I +IV+               W++PG FA   +     RF
Sbjct: 185 YGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTGRF 244

Query: 290 KGICYNLVNAYFSY-GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFV 348
             I   ++ + F++    EL  L+  + K+ R++   A++  ++RI+  Y+ + + IGF+
Sbjct: 245 LDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFI 304

Query: 349 VPHNSSELLGA--SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGP 406
           +  +  +L+ A  S   G  +SP+V   S  GI V+ HIINAVIL +  S ANS +YA  
Sbjct: 305 LSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASS 364

Query: 407 RLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGL 466
           R + +LA+QG AP+  + ++R G P  A+ LS  V  + +   S    +VFTWL+ I  +
Sbjct: 365 RSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTI 424

Query: 467 SELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVAL 526
           S    W  I  +++RFR+A+   N   + + +K+    + +YF V F +L+     +   
Sbjct: 425 SGFIGWALIGITYLRFRKAI-FYNNLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATF 483

Query: 527 SPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYK--------DFTVLTDLNQVDLDNH 578
            P       +A+ F A+Y+ +PI+ + Y G+  W+K        +  V+T L   D +  
Sbjct: 484 IPK----YWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGL--ADAEEE 537

Query: 579 RKVYDPE 585
            K+  P 
Sbjct: 538 AKMTQPR 544

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  223 bits (569), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 153/543 (28%), Positives = 266/543 (48%), Gaps = 29/543 (5%)

Query: 68  IDSFKRADDSPDHNDL-EKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLA 126
           +D    ++DS  +  L  K  +     KK +KS H+ ++++G  IGTGL V     L   
Sbjct: 26  LDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKC 85

Query: 127 GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLP------GSFNAYTSFFISKPFGFATT 180
           GPA L I+Y ++S + Y ++ A  EM    P LP      GS +   + ++    GFA  
Sbjct: 86  GPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVG 145

Query: 181 WLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIF 240
           W +   ++ ++  E   A+  + YW T++    ++ IF   ++ ++   V+ YG +E IF
Sbjct: 146 WNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIF 205

Query: 241 NACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFA---SSNGASRFKGICYNLV 297
            + KI  I G II +IV+               W DPGA+A   +  GA R   I   ++
Sbjct: 206 CSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVI 265

Query: 298 NAYFSY-GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSEL 356
            A F++  G EL VL+  + ++ R++   AA+  V+R++  Y ++ +  G +V  N   L
Sbjct: 266 RAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVL 325

Query: 357 LGA--SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQ 414
           L A   G  G  +SP+V+     GIKV+PHIIN  IL +  S  NS +YA  R L SL+Q
Sbjct: 326 LNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQ 385

Query: 415 QGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTS 474
           +GYAP+  + V+R G P T +  +     + +   S    +VF W + IS +S    W  
Sbjct: 386 EGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWIC 445

Query: 475 IMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGK 534
              +++RFR+A+   N   D L +K     + ++F +    ++     + +    N    
Sbjct: 446 SGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESFVHWN---- 500

Query: 535 CDANSFFASYLAMPIWLVFYFGYMCWYKDFTV-LTDLNQVDLDNHRKVYDPEFLRQEDLE 593
                F A+Y+ +P++L+ + G+  + + ++  +  ++++D+           LR+ + E
Sbjct: 501 --YKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTG--------LREIEEE 550

Query: 594 NKE 596
            KE
Sbjct: 551 TKE 553

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  222 bits (565), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 162/533 (30%), Positives = 257/533 (48%), Gaps = 36/533 (6%)

Query: 73  RADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLV 132
           R+D  P+ N  E  T A       +  RH+ M+S+   IGTGL +S  K L   GPASL 
Sbjct: 33  RSDFDPEQNIREDLTRA-------LSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLF 85

Query: 133 IAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLP 192
           + Y ++  V Y  +   GEM+   P + GSF +Y   F S+ F  A  W +       + 
Sbjct: 86  MNYTIIGGVVYLTMLCLGEMSTFMP-ISGSFCSYARKFGSESFACALMWNYWFNDAVSVA 144

Query: 193 LELITAAMTIKYWNTSIDPDVF---VIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIG 249
            +L    + + YW+T+     +    +IF+ F++F++   V+ YGE E+     K++ I 
Sbjct: 145 SDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIV 204

Query: 250 GFIIFAIVVNCXXXXXXXXXXXXXW-HDPGAFASSNGASRFKGICYNLVNAYFSYGGNEL 308
            F I +I+VN              W H    F   NG   FKG     V+A F+YGG E 
Sbjct: 205 IFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFV--NG---FKGFASLFVSACFAYGGTES 259

Query: 309 FVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS 368
             L+  +  NP ++TP   K+  +RI++ Y+L+   IG  +P++   L   S    +  S
Sbjct: 260 ITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS----VMTS 315

Query: 369 PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAP-RFLSYVDR 427
           P+ L   + G +     +NAVIL ++IS  N +L+AG R++ ++A  GY P + +   +R
Sbjct: 316 PFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNR 375

Query: 428 RGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMK 487
              P  A+L++  VG +   A+      ++TWL  I G+S    W  I  + IRFR+ ++
Sbjct: 376 YKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLE 435

Query: 488 LQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAM 547
           +Q K+ D L +K  T  +G YF V F + +   Q W A  P           FF+ YL +
Sbjct: 436 VQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP------WSVTDFFSVYLEL 488

Query: 548 PIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
            ++   Y  +  W +D+ V  +    D+D     Y P    +E +E  ERL N
Sbjct: 489 FVFPFVYIIWWLWKRDWFVKYE----DMDFVTDRYIPT---KEIVELNERLDN 534

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  215 bits (548), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/543 (26%), Positives = 266/543 (48%), Gaps = 34/543 (6%)

Query: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117
           +VK  H +  ++  +      ++N L K           ++SRH+ +++LG  IGTGL V
Sbjct: 21  KVKTPHSRTSLEELETQSAGSEYNTLHKG----------LQSRHIQLIALGGCIGTGLFV 70

Query: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGF 177
                L   G A L++++ L+S + Y ++ +  EM + Y    GS     S ++    GF
Sbjct: 71  GTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSRYVDPSLGF 129

Query: 178 ATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETE 237
           AT W +   +  ++  EL  AA  + YW+  +    ++ IF V ++ ++F  V+ YGE E
Sbjct: 130 ATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAE 189

Query: 238 FIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASS---NGASRFKGICY 294
           F F + K++ I G ++ ++V+               W +PG FA S       RF  +  
Sbjct: 190 FWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGSTGRFLDVWR 249

Query: 295 NLVNAYFSY-GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNS 353
            ++ + F++    EL  ++  + ++ R++T  A++  +YRI+  Y+   ++IG ++    
Sbjct: 250 AVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTD 309

Query: 354 SELLGA--SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSS 411
            +L+ A  +G  G  +SP+V   +  GI V+ H+IN  IL +  S  NS +YA  R++ +
Sbjct: 310 PKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLA 369

Query: 412 LAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFT 471
           LA++G AP+FL+ ++R G P  A+++  LV  + +         VF WL+ I  +S    
Sbjct: 370 LAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIG 429

Query: 472 WTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSPPN 530
           W ++  + IRFRR +   N     + Y+     + +Y+     ++V     F V L    
Sbjct: 430 WFAMGIAFIRFRRGIVFNNLQ-SRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLK--- 485

Query: 531 SGGKCDANSFFASYLAMPIWLVFYFGYMCWYK--------DFTVLTDLNQVDLDNHRKVY 582
             G+ +   F A+Y+ +PI+LV Y G+  W++           V+T L  V+ +   K+ 
Sbjct: 486 --GRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGL--VEAEEESKMT 541

Query: 583 DPE 585
            P 
Sbjct: 542 PPR 544

>Kwal_23.2817
          Length = 580

 Score =  214 bits (546), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 163/554 (29%), Positives = 267/554 (48%), Gaps = 40/554 (7%)

Query: 61  NRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNG 120
           N+     I + ++  +    +D++ T     E  + +KSRHV  ++LG  IGTGL + +G
Sbjct: 33  NQKKDAIITAVEQDIERGSLSDID-TIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSG 91

Query: 121 KGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPG--SFNAYTSFFISKPFGFA 178
             LS  GPA L+I+Y ++SF  + ++    EM V  P L G  S  +    ++++P  F 
Sbjct: 92  TALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIP-LSGESSMASLAGTYLNRPSSFM 150

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
             W        V+P E+   A+ I+YW T  +  +FV IF +    +    V+ +GE+EF
Sbjct: 151 CGWNCFYAMSMVVPTEITACALLIEYW-TDANAAIFVTIFMILATLLSLLPVKIFGESEF 209

Query: 239 IFNACKILMIGGFIIFAIVVN-CXXXXXXXXXXXXXWHDPGAFAS-----SNGASRFKGI 292
             +  KIL I G I+  +V+                W+ PGAF S     S GA  F  +
Sbjct: 210 CVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGA--FLAV 267

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKN-PRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPH 351
              ++ + F++        S + +   PRK+ P A +  VYR+ V Y+L  ++IG +V +
Sbjct: 268 WKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGY 327

Query: 352 NSSELLGA--SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLL 409
           ++  L  A  SG     ASP+V+     GI+++PHIINA IL +  S + S LY   R+L
Sbjct: 328 DNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVL 387

Query: 410 SSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSEL 469
            SLA +G AP+F S V++ G P  ++  ++L GV+ +   S     VF WL+ I+ +S  
Sbjct: 388 HSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGF 447

Query: 470 FTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPP 529
             W  +  +++RFR+      K  D + Y+            G   L +A+  + AL   
Sbjct: 448 VNWVFVSITYLRFRKITDYL-KINDRVPYRRR----------GQRALAYASAIFFALLAI 496

Query: 530 NSG------GKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
            +G      G  + + FF  Y+ +    V + G   +YK++T   D++ V  +   K+  
Sbjct: 497 TNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWT-FRDMDVVGREIMPKI-- 553

Query: 584 PEFLRQEDLENKER 597
                Q D E KE 
Sbjct: 554 ----DQADQEEKEE 563

>Scas_84.1
          Length = 213

 Score =  203 bits (517), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 1/209 (0%)

Query: 247 MIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYGGN 306
           M+ GF I  IVV C             WH+PG+F       RFKG+   L NA F++G  
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 307 ELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLH 366
           E   ++ ++Q NPRK+ P+AAK+ +YRI+ IYL ++ ++G++VP++S +LLG SG     
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTSGA-ATK 119

Query: 367 ASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVD 426
           ASPYVLA S+HG++VVPH I+AVIL++++SV NS+ Y+  R L  L+Q GYAP FL+YVD
Sbjct: 120 ASPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVD 179

Query: 427 RRGRPLTALLLSALVGVIGFAATSPREEE 455
           R GRP+ A  +S L GVI + ATSP E +
Sbjct: 180 RNGRPMKAYCVSPLAGVIAYCATSPEEAK 208

>Kwal_8.590
          Length = 629

 Score =  214 bits (546), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 144/502 (28%), Positives = 236/502 (47%), Gaps = 26/502 (5%)

Query: 68  IDSFKRAD-DSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLA 126
           ID F   + DSP    L   +   +  ++ +  R V M+ +G  IGT L VS G  +   
Sbjct: 94  IDDFVLQNRDSPKSQSL---SLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQG 150

Query: 127 GPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQ 186
           GP SL+IA+ L S V +  +     + VTY  + GSF  +T  F+ +  GFA  W + + 
Sbjct: 151 GPGSLLIAFCLWS-VVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVC 209

Query: 187 WLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKIL 246
               +  E+    + ++YW   I     + +  +    ++ + V  +GE EF  +  K++
Sbjct: 210 QAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVV 269

Query: 247 MIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFA---SSNGASRFKGICYNLVNAYFSY 303
           +  G IIF +VV               W +PGAFA   S     RF G    LV A + +
Sbjct: 270 LAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVF 329

Query: 304 GGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SG 361
            G +    + ++  NPRK  P++ +    R+++ Y+   I +G ++P+N   ++ A   G
Sbjct: 330 WGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEG 389

Query: 362 GNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421
             G  ASPYV A    GI+V+PHI+N +IL ++IS  NSSLY+  R+L  LA    APR 
Sbjct: 390 AVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRI 449

Query: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481
                ++G P+   +   ++  + + + S     V TW   +   +    +  I  S+++
Sbjct: 450 FKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQ 509

Query: 482 FRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSG------GKC 535
           FR+    QN  L +L Y +++             L + + FW+ L    +G      G  
Sbjct: 510 FRKGCLAQNVDLKSLPYYSSS----------LPYLAWHSLFWLVLMLLVNGYTVFLKGSW 559

Query: 536 DANSFFASYLAMPIWLVFYFGY 557
           D  SF  SY  +P +LVF FG+
Sbjct: 560 DTQSFVFSYFMIPFFLVFLFGH 581

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  212 bits (540), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 149/535 (27%), Positives = 265/535 (49%), Gaps = 28/535 (5%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
            D   ++D+E      Q+  + +K+RH+ +++LG+ IGTGL + +G  LS+ GPA L+IA
Sbjct: 38  SDQGSYSDIENFKPP-QKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIA 96

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYT--SFFISKPFGFATTWLFCIQWLTVLP 192
           Y ++SF  + ++    EM    P LPG  + Y+    +++ P  F   W        ++P
Sbjct: 97  YIIISFFVWSIMNQMTEMVCLIP-LPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVP 155

Query: 193 LELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFI 252
            E+   A+ ++YW T  +  +F+ IF V  + +    V+ +GE+EF  ++ KIL I G I
Sbjct: 156 AEITACALLVQYW-TDANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLI 214

Query: 253 IFAIVVN-CXXXXXXXXXXXXXWHDPGAF---ASSNGASRFKGICYNLVNAYFSYGGNEL 308
           I  IV+                W +PGAF    +     RF  +   ++ + FS+     
Sbjct: 215 IVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVPE 274

Query: 309 FVLSVNDQK-NPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGL 365
            V S + +   PR++ P A +  +YR+ + Y++  +++G +V  N+  L+ A  SG +  
Sbjct: 275 TVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDA 334

Query: 366 HASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYV 425
            ASP+V+     GIK++PHIINA IL +  S     LY   R L S+A +G AP+  + V
Sbjct: 335 AASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKV 394

Query: 426 DRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRA 485
           +R G P  +  L++L   + +   S     VF WL+ I+ +S   +W  +  ++IRFR+ 
Sbjct: 395 NRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKV 454

Query: 486 MKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYL 545
           +   + + D + ++    +  +Y   GF  ++     +         G  + + FFASY+
Sbjct: 455 INALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVK----GNWNVSDFFASYV 509

Query: 546 AMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRN 600
            +   +  Y     +YK +T   D  ++++         E L + D+ ++E  RN
Sbjct: 510 TIGFVIFLYLVGSFYYKQWT-FRDFKEIEV---------EILPKIDIADEEE-RN 553

>Kwal_26.6940
          Length = 570

 Score =  210 bits (534), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 145/506 (28%), Positives = 248/506 (49%), Gaps = 38/506 (7%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           K+ ++SRH+ +++LG  IGTGL V     LS  GPA L+ +Y ++S V Y ++ A GEM 
Sbjct: 50  KQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMV 109

Query: 154 VTYP----TLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209
              P       GS +   S +     GFAT W +   ++ ++  E   A+  + YW T +
Sbjct: 110 CYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTVV 169

Query: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXX 269
               ++ IF   +  ++F  V+ YGE+EF F   KIL I G +  + ++           
Sbjct: 170 PKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRL 229

Query: 270 XXXXWHDPGAFA---SSNGASRFKGICYNLVNAYFSY-GGNELFVLSVNDQKNPRKSTPA 325
               W  PGAFA   ++    RF  +   ++   F++  G EL  ++ ++  + R++   
Sbjct: 230 GFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEK 289

Query: 326 AAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGLHASPYVLAASIHGIKVVP 383
           A++   YR++  Y+ + + IG +V  N   L  A  SG  G  +SP+V+A     IK++P
Sbjct: 290 ASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILP 349

Query: 384 HIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGV 443
           HIINA IL +  S  NS ++A  R L S+A+ G AP+    ++R G P  A+ +SA    
Sbjct: 350 HIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSC 409

Query: 444 IGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTG 503
           + +   S    + FTW + IS +S    W  I  +++RFR+A+  +    D + +K+   
Sbjct: 410 LAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQ 468

Query: 504 LWGSYFGVGFNILV-----------FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552
            +G+YF   F I+V           F  +FW                F A+Y+ +P+++V
Sbjct: 469 PYGTYF---FIIVVSIICLTNGYATFIPRFW------------KGADFVAAYITLPVFVV 513

Query: 553 FYFGYMCWYKDF-TVLTDLNQVDLDN 577
            + G+  + +   T +  + +VD+  
Sbjct: 514 LWVGHKIYTRTLSTWVIPVAEVDVTT 539

>Scas_552.3
          Length = 558

 Score =  201 bits (510), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 155/531 (29%), Positives = 249/531 (46%), Gaps = 38/531 (7%)

Query: 80  HNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVS 139
             D +      ++ ++ +K RH+ M+S+   IGTGL +S  K L   GPASL + Y ++ 
Sbjct: 41  EEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMG 100

Query: 140 FVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAA 199
            V Y  +   GEM+ TY  + GSF +Y   F S+ F  A  W +       +  ++    
Sbjct: 101 GVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQ 159

Query: 200 MTIKYWNTSID------PDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFII 253
           + + YW+T           +      V L  IH   V+ YGE E+     K++ I  F I
Sbjct: 160 LVMDYWDTEASGFPYWAASLLFWFLVVLLNVIH---VRFYGEAEYWLAMLKVIAIIIFFI 216

Query: 254 FAIVVNCXXXXXXXXXXXXXW-HDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLS 312
            +IVVN              W H    F        FKG     V+A F+YGG E   L+
Sbjct: 217 LSIVVNVGHNPQHEYIGFKNWNHGEAPFVDG-----FKGFASLFVSASFAYGGTESITLT 271

Query: 313 VNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVL 372
             +  NP ++TP   K+  +RI+V Y+ +   I   +P++   L   S    +  SP+ L
Sbjct: 272 NGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS----VVTSPFTL 327

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAP-RFLSYVDRRGRP 431
              + G K     +NAVI+ ++IS  N +L+AG R++ ++  +G+ P + +S  +R   P
Sbjct: 328 VFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVP 387

Query: 432 LTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNK 491
             ++L+++ +G++ F A+      V+TWL  I G+S    W  I  + IRFR+ ++ Q K
Sbjct: 388 YVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGK 447

Query: 492 SLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWL 551
           + + L YK  T  +G YF V F   +   Q W A  P       D  +FF+ YL +    
Sbjct: 448 THE-LRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP------WDVTNFFSYYLDL---F 497

Query: 552 VFYFGYMCWY---KDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLR 599
           VF F ++ W+   +D  V   L  +D    R +   E +  E  EN + L+
Sbjct: 498 VFPFCFIIWWLYKRDRFV--KLEDMDFVTDRYIPTKEII--ELNENLDHLK 544

>Kwal_26.8097
          Length = 544

 Score =  191 bits (485), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 158/531 (29%), Positives = 250/531 (47%), Gaps = 29/531 (5%)

Query: 73  RADDSPDHNDLEKTTTAHQEQ--KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPAS 130
           R   S    D E     H  +   +++  RH+ M+S+   IGTGL +  GK L+  GPAS
Sbjct: 18  RTSSSDVQYDSEGQEADHVREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKGGPAS 77

Query: 131 LVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL-- 188
           LVI Y ++  V Y  +   GEM+   P + GSF +Y   F S    F    L C  W   
Sbjct: 78  LVINYSIIGLVVYLTMLCLGEMSTFMP-ISGSFCSYAKKFGSGSLAFT---LMCNYWFND 133

Query: 189 -TVLPLELITAAMTIKYWNTSIDPDVF---VIIFYVFLMFIHFFGVQAYGETEFIFNACK 244
              +  +L    + + +W TS     +    +IF+  L+ ++   V+ YGE E+     K
Sbjct: 134 AVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAMLK 193

Query: 245 ILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNGASRFKGICYNLVNAYFSYG 304
           ++ I  F I +IVVN              W   G     NG   FKG     V++ F+YG
Sbjct: 194 VIAIIIFFIISIVVNAGHNQDHSYIGFKNW-SVGEAPFVNG---FKGFASLFVSSSFAYG 249

Query: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNG 364
           G E   L+  + KNP ++TP   K+  +RI++ Y+ T   IG  VP+N  +L   S    
Sbjct: 250 GTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKLSEKS---- 305

Query: 365 LHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGY-APRFLS 423
           +  SP+ +   + G K     +NAVIL ++IS  N +L+AG R+L +L  +GY  P  ++
Sbjct: 306 VMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSIIT 365

Query: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483
             +R   P  A+L++   G + F ++      ++TWL  I G+S    W  I    IRFR
Sbjct: 366 KTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRFR 425

Query: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFAS 543
           R +  Q K+ + L +   T  +G YF V F   +   Q W + +P N         FF+ 
Sbjct: 426 RGLAKQGKTHE-LQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAPWN------VTDFFSY 478

Query: 544 YLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN 594
           Y+ + +++  Y  +  W +D  V ++      D +   ++ E L  E+L+N
Sbjct: 479 YIELIVFVALYVFWWLWKRDAFVRSEDMDFVTDKYISPHE-EVLLNEELDN 528

>Kwal_23.4026
          Length = 534

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 111/421 (26%), Positives = 212/421 (50%), Gaps = 10/421 (2%)

Query: 84  EKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTY 143
           E    + Q  ++  K RHV M+++   IGTGL++  G  L   GP SL+IA+     +  
Sbjct: 37  EAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLI 96

Query: 144 FMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIK 203
            ++ +  EMA ++  +  SF+ Y + ++    GFAT W + +++   L  EL    + ++
Sbjct: 97  GVLMSLAEMA-SFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQ 155

Query: 204 YWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX 263
           YW   +   +F+++F V L+ ++F  ++ YGE EF     K L++    +  +V+ C   
Sbjct: 156 YWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGG 215

Query: 264 XXXXXXXXXXWHD----PGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNP 319
                     W +    P     + G  RF G    ++ + ++Y G+E   +   +  NP
Sbjct: 216 PSKETIGFRYWREYAFVPYLVKGTTG--RFLGWWACVIQSCYAYIGSETIGVVFGEAPNP 273

Query: 320 RKSTPAAAKSNVYRIVVIYLLTMILIGFVV-PHNSSELLGASGGNGLHASPYVLAASIHG 378
           +K+ PAA ++ ++RI   Y++ ++++G ++ PH+ +  L  +  +    SP+V+A +  G
Sbjct: 274 KKTIPAATRNVIFRITGFYIVGVLILGLIISPHDKT--LANAKTSDASGSPFVIAFTNAG 331

Query: 379 IKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLS 438
           IK +P  INA++++ + S AN++LY   R    LA+ G AP+     +R G P    LL+
Sbjct: 332 IKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLA 391

Query: 439 ALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGY 498
            L+ ++ F   S     +F +L +   +     W S++ S+I + RA    +   D + +
Sbjct: 392 GLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPF 451

Query: 499 K 499
           +
Sbjct: 452 R 452

>Scas_460.3
          Length = 584

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 127/525 (24%), Positives = 221/525 (42%), Gaps = 22/525 (4%)

Query: 21  LSKSNDYVHEQNHIIEGXXXXXXXXXXXHNLRSRFDVQVKNRHLQGFIDSFKRADDSPDH 80
           +SK +  + +Q  I E             N   + D  + +     FI +  R   S   
Sbjct: 1   MSKYDTTIKQQTIIDEESLTSHRRTPFADNKGGKVDTDLDSDDF--FIPTTSRGTTSVSS 58

Query: 81  NDLEKTT--TAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLV 138
            D +  T   A    K+ + +RHV ++++   IGT + V+ GK L   GPA L++A+ + 
Sbjct: 59  QDNDSKTFLVASHTTKRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIW 118

Query: 139 SFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLF----CIQWLTVLPLE 194
                 +  +  EM    P +   F    +  +        +W F    C+Q    +P E
Sbjct: 119 CIPILCITVSTAEMVCFMP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQ----IPYE 173

Query: 195 LITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIF 254
           ++T    I YW       + ++I  +  + I    V+ YGE EF   + KI++  G   F
Sbjct: 174 IVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCF 233

Query: 255 AIVVNCXXXXXXXXXXXXXWHD-------PGAFASSNGASRFKGICYNLVNAYFSYGGNE 307
             +                +HD       P      + A  F+G    L+ A F+  G E
Sbjct: 234 TFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGE 293

Query: 308 LFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGL 365
              +   + + PR+  P A K    R+ +++L + + +G +   N S L  A      G 
Sbjct: 294 YISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGA 353

Query: 366 HASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYV 425
            +SPYV+A +  GI+++P I+N  ++ A  S  N+  Y   R L  +A  GYAP+  +  
Sbjct: 354 GSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRC 413

Query: 426 DRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRA 485
           +++G P+ A+ +S L   I     +     V  WL  I   S+L  +  +  +++ FRRA
Sbjct: 414 NKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRA 473

Query: 486 MKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530
             LQ   L  L +K+    + + FG+   +++   Q +    P N
Sbjct: 474 YLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFPKN 518

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  164 bits (416), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 151/602 (25%), Positives = 254/602 (42%), Gaps = 96/602 (15%)

Query: 69  DSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128
           DSF      P  +   K        ++ +K RH+ M+SLG  IG GL +++GK  S+AGP
Sbjct: 207 DSFIEGPHHPSWS--RKKLQGQVTIQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGP 264

Query: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188
               + Y   +      + +  E+    P + G  +   S FI   FGF+  W     + 
Sbjct: 265 LGTFLGYLFGALTILATLLSFAEIVALIPLITG-ISGLCSRFIGDAFGFSVGWCHWASYA 323

Query: 189 TVLPLELITAAMTIKYWNT--SIDPD-----VFVIIFYVFLMFIHFFGVQAYGETEFIFN 241
              P ELI  A+ + Y+    SI  +       ++I    L  ++   V+ YGE E+  +
Sbjct: 324 FGFPSELIATAIMLSYYTNLQSISTNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFAS 383

Query: 242 ACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDP---------GAF-----------A 281
             K++++   II  IVVNC             W            GAF            
Sbjct: 384 TIKLIVVALLIILMIVVNCGGLNNGYIGFRY-WDKNKSKSEHITFGAFRPTFDLKDTGDG 442

Query: 282 SSNGASRFKGICYNLVN----AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVI 337
           + NG   F G+  + +     A FSY G+E+  ++  + +NPRK+ P+  K    R+VV 
Sbjct: 443 ARNGIGGFGGVLLSCIASTLVAVFSYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVF 502

Query: 338 YLLTMILIG------------FVVPHNSS----------ELLGASGG------------- 362
           YLL++ ++G            +  P ++           +L+ + GG             
Sbjct: 503 YLLSIFVVGLNFYSGDPRLLRYYSPEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFV 562

Query: 363 -NGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRF 421
               + SP+V+A        +  I+N V +    S A+S LYA  R L S+A Q  AP  
Sbjct: 563 NESSNQSPWVIALKSFKQCTLSSIVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSV 622

Query: 422 LSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIR 481
            ++ +R G P  +++  A +G +     + +  +VF     I  +  +  W S+  S +R
Sbjct: 623 FTWCNRHGVPYMSVIFCAFLGFLSLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLR 682

Query: 482 FRRAMKLQ----NKSLDTLGYKANTGLWGSYFG-VGFNILVFAAQF-----WVALSPPNS 531
           F  A+K +    ++      YK+    + S FG V   ILV    F     W        
Sbjct: 683 FYYALKRRPDIISRDSKEYPYKSPLQPYLSIFGMVSTAILVLFNGFQNFFYW-------- 734

Query: 532 GGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQED 591
               +  +F +SY  + +++V YFGY  W+K  + +  L  +DLD+ R+  D   + +ED
Sbjct: 735 ----NTKNFISSYCTVVLFVVLYFGYN-WFKH-SQINKLENIDLDSGRREMD-SIIWKED 787

Query: 592 LE 593
           ++
Sbjct: 788 VD 789

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  160 bits (405), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 135/528 (25%), Positives = 222/528 (42%), Gaps = 34/528 (6%)

Query: 69  DSFKRADDSPDHNDLEKTTT---AHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSL 125
           DS+  ++ S +  D   +      +    + +++RHV ++ +   IGT L VS GK L  
Sbjct: 26  DSWVPSEHSSEVGDEASSAGFAGKYHSTYRKLENRHVQLIGISGVIGTALFVSIGKALYR 85

Query: 126 AGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLF-- 183
            G  SL++ + L       +  +  EM V Y  L   F    S  ++        W F  
Sbjct: 86  GGSVSLLLGFALWCVPILCITVSTAEM-VCYLPLNSPFLRLASRCVNDSLTVMAGWNFWF 144

Query: 184 --CIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFN 241
             C+Q    +P E++     I YW       + +++  +  + I  F V+ YGE EF   
Sbjct: 145 LECVQ----IPFEIVAVNSIIHYWRDDYSAAITLVVQVMLYLLISLFAVRYYGEIEFWLA 200

Query: 242 ACKILMIGGFIIFAIVVNC-------XXXXXXXXXXXXXWHDPGAFASSNGASRFKGICY 294
           + K+L+  G   F  V                        + P     S+ A  F+G   
Sbjct: 201 SFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRYIGEAPFKQYSPTMEPISSSAGYFQGFLA 260

Query: 295 NLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSS 354
            L+ A F+  G +   +   + K PRK  P A K    R+ V++L   + +G V   N  
Sbjct: 261 CLIQASFTIAGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSANDP 320

Query: 355 ELLGASGGN--GLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSL 412
           +L  A   +  G  +SPYV+A +  GIK++P I+NA ++ A  S  N+  Y   R L  L
Sbjct: 321 DLTAAINASRPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSRSLYGL 380

Query: 413 AQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTW 472
           A  GYAP      +R G P+ A+ +S +  V+     +     V  WL ++   S+L  +
Sbjct: 381 ALDGYAPAIFKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITASQLINF 440

Query: 473 TSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQ----FWVALSP 528
             +   ++ FRRA   Q  +L  L +K+    + +Y G+   +L+   Q    F+ AL  
Sbjct: 441 GVLCVVYLYFRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFYSALW- 499

Query: 529 PNSGGKCDANSFFASYLAMPIWLVFYFGYM-CWYKDFTVLTDLNQVDL 575
                  +   F   YL + I +  Y GY   W +    +    +VDL
Sbjct: 500 -------NVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDL 540

>Scas_377.1
          Length = 148

 Score =  145 bits (367), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 64/137 (46%), Positives = 94/137 (68%), Gaps = 1/137 (0%)

Query: 464 SGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFW 523
           SGLS+LFTW SI  SH+RFRRAM++Q +S+  +G+K+  G++GS +     +L+  AQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 524 VALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
            AL P    GK D  +FF +YLAMPI++V YFG+  W KD+ +      +DL +HR+++D
Sbjct: 61  TALVPVGE-GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 119

Query: 584 PEFLRQEDLENKERLRN 600
            E L+QED E + +LR+
Sbjct: 120 EELLKQEDEEYRRKLRD 136

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  157 bits (396), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 133/558 (23%), Positives = 231/558 (41%), Gaps = 29/558 (5%)

Query: 53  SRFDVQVKNRHLQGFIDSFKRA----DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLG 108
           S F+  ++ R  +   D   R+    +D    ND            + + +RHV  +++ 
Sbjct: 15  SAFEEGIEERFFES--DDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAIS 72

Query: 109 TGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTS 168
             IGT L V+ GK L   GPA+L++A+ L       +  +  EM V++  +   F     
Sbjct: 73  GVIGTALFVAIGKPLYRGGPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPFLRLAK 131

Query: 169 FFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFF 228
             + +  G   +W F       +P E+++    I YW     P + ++I  V  + I   
Sbjct: 132 KCVDESLGVTASWNFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVC 191

Query: 229 GVQAYGETEFIFNACKILMIGGFIIFAIVV--------NCXXXXXXXXXXXXXWHDPGAF 280
            V+ YGE EF   + KI++  G   F  +         +              +   G  
Sbjct: 192 AVKYYGEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNE 251

Query: 281 ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLL 340
            +   A  F+G    L+ A F+  G E   +   + K PRK  P A K    R+ VI+L 
Sbjct: 252 GAGKSAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLG 311

Query: 341 TMILIGFVVPHNSSELLGA--SGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVA 398
           + + +G V   N S L  A      G  +SPYV+A +   I+V+P I+N  ++ A  S  
Sbjct: 312 SCLCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAG 371

Query: 399 NSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFT 458
           N+  Y   R L  +A  GYAP+  +  ++ G P+ A+ +S    ++     +     V  
Sbjct: 372 NAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLN 431

Query: 459 WLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVF 518
           WL  +   S+L  +  +   ++ FRRA   Q + L  L +K+    +    G+   +++ 
Sbjct: 432 WLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVSVLIMI 491

Query: 519 AAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNH 578
             Q +    P    G+     +   +L + I++   F    WYK    +   N +D    
Sbjct: 492 LLQGYTVFFPKLWNGRDFIFCYLMVFLDIGIYV---FTKFIWYKGKDPVKSPNSID---- 544

Query: 579 RKVYDPEF--LRQEDLEN 594
              + PE   + Q +LE+
Sbjct: 545 ---FVPELKEIEQHELEH 559

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  155 bits (392), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/497 (22%), Positives = 207/497 (41%), Gaps = 15/497 (3%)

Query: 92  EQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGE 151
           E ++ +++RHV ++++   IGT L V+ GK L   GPASL++A+ L       +  +  E
Sbjct: 83  ETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAE 142

Query: 152 MAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDP 211
           M   +P +   F    +  +        +W F       +P E+++    I YW      
Sbjct: 143 MVCFFP-VSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSA 201

Query: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXX 271
            + + +  V  + I    V+ YGE EF   + KI++  G   F  +              
Sbjct: 202 GIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGF 261

Query: 272 XXWHD-------PGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTP 324
             + +       P        +  F+G    L+ A F+  G E   +   + K PRK  P
Sbjct: 262 RNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLP 321

Query: 325 AAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGLHASPYVLAASIHGIKVV 382
            A K    R+  ++L + + +G V   N  +L  A      G  +SPYV+A +   I+++
Sbjct: 322 KAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRIL 381

Query: 383 PHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVG 442
           P I+N  ++ A  S  N+  Y   R    +A  GYAP+  +  +R G P+ ++ +S +  
Sbjct: 382 PDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWA 441

Query: 443 VIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANT 502
           ++     +     V  WL  +   S+L  +  +   ++ FRRA  +Q  SL  L +++  
Sbjct: 442 LVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRS-- 499

Query: 503 GLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGY-MCWY 561
             WG  +     ++  +A   +           +   F  SYL + I +  Y GY   W 
Sbjct: 500 --WGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWK 557

Query: 562 KDFTVLTDLNQVDLDNH 578
           +      + +++D    
Sbjct: 558 RGKDHFKNPHEIDFSKE 574

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  154 bits (388), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 129/511 (25%), Positives = 217/511 (42%), Gaps = 25/511 (4%)

Query: 84  EKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTY 143
           + ++  +    + +++RHV ++ +   IGT L VS GK L   GP SL++ + L      
Sbjct: 44  DNSSYFNNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPIL 103

Query: 144 FMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIK 203
            +  +  EM V Y  +   F        +        W F       +P E++     + 
Sbjct: 104 CITVSTAEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILH 162

Query: 204 YWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXX 263
           YW     P + + +  +  + I  F V+ YGETE    + KIL+  G  +F  +      
Sbjct: 163 YWRDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGN 222

Query: 264 XXXXXXXXXXWHDPG---AFASSNGASR---FKGICYNLVNAYFSYGGNELFVLSVNDQK 317
                       D      F ++ G+S    F+G    ++ A F+  G +   +   + K
Sbjct: 223 PKHDRYGFRYITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECK 282

Query: 318 NPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--SGGNGLHASPYVLAAS 375
            PRK  P A K    R+ V++L   + +G V   N   L     +   G  +SPYV+A +
Sbjct: 283 LPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMN 342

Query: 376 IHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTAL 435
             GIKV+P ++NA ++ A  S  N+  Y   R L  L+  GYAP+   Y  + G P+ A+
Sbjct: 343 NLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAV 402

Query: 436 LLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKS--L 493
           L+S     I           V  WL  +   S+L  ++ +   ++ FRRA   Q+ S  L
Sbjct: 403 LVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGEL 462

Query: 494 DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLA----MPI 549
             L +K+    + +Y G+    L+   Q +         G  +  SF   YL     + I
Sbjct: 463 PELPFKSWGQPYTAYCGLFAVTLMIGVQGYTVF----LHGSWEVQSFLFCYLMVFIDLGI 518

Query: 550 WLVFYFGYM----CWYK--DFTVLTDLNQVD 574
           +L+ +F Y      W K  D  +LT +++V+
Sbjct: 519 FLLCFFVYKRTRDPWVKPEDADLLTGMDEVE 549

>Kwal_23.3847
          Length = 579

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 113/446 (25%), Positives = 186/446 (41%), Gaps = 16/446 (3%)

Query: 70  SFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPA 129
           +F+  D SP     +   T    +K  +  RHV+++ +   IGT L VS GK L   G A
Sbjct: 42  AFESLDLSPPLEGKQSLDTDATHRK--LHERHVMLIGISGVIGTALFVSIGKALYHGGSA 99

Query: 130 SLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLT 189
            L++   +       +  +  EM V Y  L   F   T+  +      A  W F      
Sbjct: 100 FLLLGMAVWCIPMLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECV 158

Query: 190 VLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIG 249
            +P E++     I YW       + +++  V    I  F V+ YGE EF   + KI++  
Sbjct: 159 QIPFEIVAVNTIIHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKIILAL 218

Query: 250 GFIIFAIVVNCXXXXXXXXXXXXXWHD-------PGAFASSNGASRFKGICYNLVNAYFS 302
           G   F +V                + D       P     +  A  F+G    L+ A F+
Sbjct: 219 GLFTFTLVAMLGGNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGFLACLIQASFT 278

Query: 303 YGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGA--S 360
             G +   +   +   PRK  P A K    R+ V++L + + +G +   N  +L  A   
Sbjct: 279 IAGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPDLTAAINE 338

Query: 361 GGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR 420
              G  +SPYV+A    GI+ +P ++NA ++ A  S  N+  +   R L  +A  G APR
Sbjct: 339 ARPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDGNAPR 398

Query: 421 FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI 480
                +R G P+ A+ +S    ++     +     V  WL  +   S+L  +  +  +++
Sbjct: 399 IFRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLCLTYL 458

Query: 481 RFRRAMKLQNKSLDTLGYKANTGLWG 506
            FRRA   Q  +L +L +K+    WG
Sbjct: 459 YFRRAYLSQQHNLPSLPFKS----WG 480

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  150 bits (378), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 153/666 (22%), Positives = 275/666 (41%), Gaps = 95/666 (14%)

Query: 5   DLLSEVKVSSSEDSQILSKSN--DYVHEQNHIIEGXXXXXXXXXXXHNLRSRFDVQVKNR 62
           DL  E+  + S D+ I+   N  ++  + +H+              H L S   V   + 
Sbjct: 182 DLSFEMLTTHSGDTHIIDMENHGEWPIDHDHL---------GKSGTHKLESWISVSKCSN 232

Query: 63  HLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKG 122
           +  G   S K++     +N L+ +   H   ++ +++RH+ M++ G+ +G GL +++GK 
Sbjct: 233 NNSG---SRKQSKFIKKYNALKGS---HHSVQRKLEARHIQMIASGSSLGVGLFLTSGKA 286

Query: 123 LSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWL 182
            ++AGP   ++ Y L   +      +  E+    P   G F+   S F+   FGFA  WL
Sbjct: 287 FTIAGPFGALLGYVLCGSIVMASTLSFTELCALIPLTSG-FSGLASRFVEDAFGFALGWL 345

Query: 183 FCIQWLTVLPLELITAAMTIKYWN----TSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238
           +   ++  +P +++ + M + Y+     +S     FV +F VF +FI+   V+ +G   +
Sbjct: 346 YWFSFIIAVPSQVVASTMLLNYYQSLNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVY 405

Query: 239 IFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFAS---------------- 282
                KI+     I   IV+N              + D G  A                 
Sbjct: 406 FVTIIKIIFTIVMIFVMIVLNSGGAALGHDRVGFRFWDAGKSAPGLFYGLFRPTFNLKDE 465

Query: 283 --------SNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRI 334
                   S    R   I  +++ A F+Y G E+  ++  + +NP+K+ P+A K  +Y +
Sbjct: 466 GSEIISGISGAKGRLLAIFLSMLIAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIM 525

Query: 335 VVIYLLTMILIGFVVPHNSSEL-------LGASGGNGLH--------------------- 366
           ++IY +++ ++G  +      L         +S  N +H                     
Sbjct: 526 LLIYTISIFVVGLNIYSGDPRLPRFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGS 585

Query: 367 ------ASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPR 420
                  S +V+A    G      ++N +++    +   SSLY     L S+A QG APR
Sbjct: 586 LLSDGNRSAWVIALRSFGRCTFASVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPR 645

Query: 421 FLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHI 480
                   G P  A+L+S + GVI + A        F  LA IS  +    W  +  S +
Sbjct: 646 ICKACTSYGVPWIAVLVSGIFGVISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFL 705

Query: 481 RFRRAMKLQ----NKSLDTLGYKANTGLWGSYFGV-GFNILVFAAQFWVALSPPNSGGKC 535
           RF  A+K++    ++      Y++    + SY+G+ G  +++F A F          G  
Sbjct: 706 RFFYALKIRPDIMSRDDPMFPYRSPFQPYLSYYGLFGSLVMIFFAGFTSFFH-----GFW 760

Query: 536 DANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLEN- 594
           +   FF+ Y  +  ++V Y GY  +    + L  L+Q+D+D  R   D     Q+     
Sbjct: 761 NIKIFFSCYGGLVFFIVLYIGYKLF--GTSKLQRLDQIDMDIGRIELDRTIWNQQTEYQG 818

Query: 595 --KERL 598
             KERL
Sbjct: 819 NWKERL 824

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  144 bits (363), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 140/581 (24%), Positives = 238/581 (40%), Gaps = 84/581 (14%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           D+ P  N   + +  +   ++ +K RH+ M+SLG  IG GL +++G+  S+AGP    I 
Sbjct: 204 DEVPIDNHHRRKSRHNTSLQRKLKIRHLQMISLGATIGVGLFLNSGRAFSIAGPMGAFIG 263

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           +   + V    + +  EM    P + G  +   S F+   FGF   W   + +    P E
Sbjct: 264 FLYGALVILATLFSFAEMVAFIPLITG-ISGLCSRFVGDSFGFTVGWCHWLSYAVAFPSE 322

Query: 195 LITAAMTIKYWN--TSIDPD-----VFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILM 247
           LI +A+ I Y+     +  D     + V I  + L  I+   V+ Y E E+I +  K+ +
Sbjct: 323 LIASAIMISYYTPFEKVATDNLYLGLTVTILIIVLTGINLLDVRIYAELEYIMSVFKLAV 382

Query: 248 IGGFIIFAIVVNCXXXXXXXXXXXXXWHDP--------GAF-----------ASSNGASR 288
           +   ++  +++NC               D         G F            S  G   
Sbjct: 383 VLFLLVLVLILNCGGFRNGYLGFKFWTKDRSPSPDVTFGPFRPTFDLNDYGSGSKQGIGG 442

Query: 289 FKGICYNL----VNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMIL 344
           F G+  +     V++ FSY G+E+  ++  + +NPRK+ P+  K    R+V+ YLL++ +
Sbjct: 443 FGGVLLSCITCSVSSIFSYIGSEIGFIAAPEAENPRKAVPSVTKRIFVRVVLFYLLSIFM 502

Query: 345 IGFVVPHNSSELLGASGGN-------------------GLHA----------------SP 369
           +G V+      LL     N                   G++                 SP
Sbjct: 503 VGTVIYAGDPRLLRIISDNSKVTDQNLEKFMLIIDQLGGMNCNTRLQNDNIFQESSNQSP 562

Query: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRG 429
           +V+A        + ++IN V +   IS A+S LYA  R L S+A Q  AP   ++    G
Sbjct: 563 WVIAFKAVKQCDLANVINGVFVCIGISAASSQLYASSRTLYSMATQNKAPSVFTWCTNGG 622

Query: 430 RPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ 489
            P  ++L    +G +       R  E      +I     +  W  +  S +RF  A+K +
Sbjct: 623 VPYVSILFCGSLGFLSLLCFDLRSTEALLLFISIGITGSVVMWFGMNLSFLRFYMALKRR 682

Query: 490 NKSLD----TLGYKANTGLWGSYFGVG---FNILVFAAQFWVALSPPNSGGKCDANSFFA 542
              +D       YK+    +   FG+    F +L+   Q +      N         F +
Sbjct: 683 PDIIDRNSKEYPYKSPFQPYLCIFGMASTTFLLLMNGIQNFFVWKTAN---------FIS 733

Query: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
           SYL + I++V Y GY       + +  L Q+DLD+ R+  D
Sbjct: 734 SYLIIVIFIVLYSGYNVVRT--STINRLEQIDLDSGRREMD 772

>Scas_682.30
          Length = 845

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 134/594 (22%), Positives = 244/594 (41%), Gaps = 86/594 (14%)

Query: 64  LQGFIDSFKRADDSPDHNDLEKT-----TTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118
           +  F D  +R    P   DLEK       T +  Q+K ++ RH+ M+S+GT    G  ++
Sbjct: 238 MTSFTDRERRKSILP--FDLEKMFNDPGNTKYYVQRK-LRVRHIQMLSIGTCFSVGFFLT 294

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178
           +G+  S+AGP   ++ + L   +    + +  E++   P   G F+   S F+   FGF 
Sbjct: 295 SGRAFSIAGPFGTLLGFALAGSIVLATLLSFTELSTLIPVSSG-FSGLASRFVEDAFGFG 353

Query: 179 TTWLFCIQWLTVLPLELITAAMTIKYWN----TSIDPDVFVIIFYVFLMFIHFFGVQAYG 234
             W +    +   P E+ ++   + Y+     T      FV +F  + + I+   V+  G
Sbjct: 354 LGWTYWFSCMIAFPSEVASSTFYLSYYQHLNLTRGAIAGFVTLFSSYSIIINLLDVRILG 413

Query: 235 ETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDP---------GAF----- 280
           E  +I    KIL+    I   +++N              + D          G F     
Sbjct: 414 EATYIIGLSKILITIVIIFVMVIINAGHGYKIHNQVGFRFWDSSKSVGDLTYGLFRPTFD 473

Query: 281 ------ASSNG----ASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSN 330
                  S+NG      RF  +   ++ + F++ G E+  ++  +  NPRK+ P++ K  
Sbjct: 474 LGDVGRGSTNGIPGATGRFLAVILVMLISTFAFSGVEMTFMASGEAINPRKTIPSSIKRT 533

Query: 331 VYRIVVIYLLTMILIGFVVPHNSSELLG-------------------------------- 358
              ++ +Y+L +  +G  +      LL                                 
Sbjct: 534 FSIVLTVYMLAIFAVGINIYSGDPRLLSYFAKYSSERYTSTINGIGTDWQLSDRCKGVYT 593

Query: 359 ---ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQ 415
               S  + ++ SP+VLA    G+      +N +++    +   SSLY   R + +++ Q
Sbjct: 594 EREHSTSHAIYTSPWVLALQSFGLCTFASALNGILIFFTSTAGVSSLYNSSRTIYAMSVQ 653

Query: 416 GYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSI 475
             AP      ++RG P  A++ S +  +I + A +      F  L  IS  S    W+ +
Sbjct: 654 RKAPLIFQRCNKRGVPYVAVIFSGVFYIIAYLAVNVGSSRNFDVLVNISSASTSIIWSGL 713

Query: 476 MFSHIRFRRAMKLQNKSL-----DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPN 530
             S IRF  A+K Q K L      T  YK+    + S++G+ F  L+F     + +  PN
Sbjct: 714 NISFIRFYFALK-QRKDLISRNDKTYPYKSPFQPYLSFYGL-FGCLIFV----IFMGFPN 767

Query: 531 -SGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
              G+    SFF++Y  + ++ + Y G+       + +  L+Q+D+D  R+  D
Sbjct: 768 FIKGQWSTRSFFSAYGGLFLFAILYAGFKII--GTSKIQRLDQIDMDTGRREMD 819

>Kwal_53.19461
          Length = 565

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 133/576 (23%), Positives = 239/576 (41%), Gaps = 96/576 (16%)

Query: 104 MMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSF 163
           M++ G  +G GL +++GK LS+ GP   ++ + +   +    + +  E+A   P L    
Sbjct: 1   MIATGAAMGVGLFLNSGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIATLIP-LSSGI 59

Query: 164 NAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNT----SIDPDVFVIIFY 219
           +   S F+   FGFA  W + + +   L  +++ +   + Y+ T    +     FV  F 
Sbjct: 60  SGLASRFVEDAFGFALGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFL 119

Query: 220 VFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDP-- 277
           VF +  +   V    E  + F   KI++    I   +++N              + D   
Sbjct: 120 VFAIAGNLLDVNILAELAYGFTFFKIVITATMIFAMVILNAGAGRHKHPRVGFRFWDASK 179

Query: 278 -------GAF-----------ASSNG----ASRFKGICYNLVNAYFSYGGNELFVLSVND 315
                  G F            + NG      RF  +   ++ + FS+ G E+  ++  +
Sbjct: 180 SPENLTYGLFRPTFDLQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGE 239

Query: 316 QKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVV-----------------PHNSS---- 354
             NPR+S P+A K  +  ++++Y++++ +I   V                 P  SS    
Sbjct: 240 AANPRRSLPSATKRTIMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAF 299

Query: 355 -------------ELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSS 401
                        E++  +       SP+VLA    G+     + NA+++I  ++   SS
Sbjct: 300 NNNWQTDQVCTAHEIVSTTDFTNGSQSPWVLALESFGLCTFSSVFNAMLVIFGVTSELSS 359

Query: 402 LYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLA 461
           LYA  R L S++ QG AP       R+G P  A++ S L G + +   + +  E+F  LA
Sbjct: 360 LYASSRTLYSMSIQGKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALA 419

Query: 462 AISGLSELFTWTSIMFSHIRFRRAMKLQ----NKSLDTLGYK-------ANTGLWGSYFG 510
            ISG +    W     S +RF  A+K +    ++   +  Y+       A  GL+GS+  
Sbjct: 420 NISGATISIIWFGFNLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLI 479

Query: 511 V---GFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVL 567
           V   GF+   F   FW            +   FF+SY  + ++++ Y GY       + +
Sbjct: 480 VVLMGFS--NFLDGFW------------NTKMFFSSYGGLIVFILCYAGYRLL--GTSKI 523

Query: 568 TDLNQVDLDNHRKVYDPEFL---RQEDLENKERLRN 600
             L+Q+DLD+ R+  D       R+     +ER+R 
Sbjct: 524 QRLDQLDLDSGRREMDRMIWTEHREYTNSVRERIRK 559

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 133/571 (23%), Positives = 234/571 (40%), Gaps = 78/571 (13%)

Query: 83  LEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVT 142
           L  +T    + ++ +K RH+ M+++   +  G+ +++GK  S+AGP   ++ + +   V 
Sbjct: 265 LHDSTRRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVV 324

Query: 143 YFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTI 202
              + +  E+A   P   G F+   S F+   FGFA  W +    +  LP +++++    
Sbjct: 325 IATMMSFAELATLIPVSSG-FSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYF 383

Query: 203 KYWN----TSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVV 258
            +++    T      FV +F +F + ++ F V+  GE  +I    K+L+    +I  +V+
Sbjct: 384 SHYDHLKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVIVMLVL 443

Query: 259 NCXXXXXXXXXXXXXWHDP----------------------GAFASSNG----ASRFKGI 292
           N              + D                           S NG      RF  +
Sbjct: 444 NAGHGFDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRGRFIAV 503

Query: 293 CYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKS------------------NVY-- 332
              ++ + F++ G E+  ++  + KNPRK+ P+A K                   N+Y  
Sbjct: 504 VSVMLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSINIYTG 563

Query: 333 --RIVVIY----------LLTMILIGFVVPHNSSELLGASGGNGLHA---SPYVLAASIH 377
             R++  Y          +   +   + V +   E+L       + A   SP+VLA    
Sbjct: 564 DPRLLSYYTGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVLALENF 623

Query: 378 GIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLL 437
           G        NAV++    S   SSLYA  R L +++ Q  AP      DRRG P  A+  
Sbjct: 624 GFCSFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPYVAIGF 683

Query: 438 SALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNK--SLDT 495
           S+L  ++ + A        F  L  IS  +    W  +  + +RF  A+K +    S D 
Sbjct: 684 SSLFAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDIISRDD 743

Query: 496 LGYKANTGL--WGSYFG-VGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLV 552
           + Y   +    + S FG +G +I V    F   +      G  +  SFF+SY  + ++ V
Sbjct: 744 VFYPYRSPFQPYLSMFGLLGCSIFVLFMGFINFIH-----GYWNTKSFFSSYGGLILFGV 798

Query: 553 FYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
            Y GY       + +  L+Q+DLD  R+  D
Sbjct: 799 CYLGYKLIST--SKIQRLDQLDLDTGRREID 827

>Kwal_27.11900
          Length = 726

 Score =  130 bits (326), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 111/482 (23%), Positives = 200/482 (41%), Gaps = 72/482 (14%)

Query: 75  DDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           ++SP  N   K+       ++ ++ RH+ M+SLG  IG GL +++GK  S+AGP   +I 
Sbjct: 217 ENSPPSN---KSVPQQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIG 273

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           + +   +    + +  EM    P + G  +   S F+   FGF+  W   + +    P E
Sbjct: 274 FTIGGTLILATLFSFAEMVALIPLITG-ISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSE 332

Query: 195 LITAAMTIKYWNT--SIDPDVF-----VIIFYVFLMFIHFFGVQAYGETEFIFNACKILM 247
           +I + + + Y+     I  + +     +    V L  I+   V+ YGE E+  +  K+ +
Sbjct: 333 VIASTIMLSYYKNLEQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAI 392

Query: 248 IGGFIIFAIVVNCXXXXXXXXXXXXXWH--------------------DPGAFASSNGAS 287
           +   II  IV+N              W+                    + G   S  G  
Sbjct: 393 VVFLIILMIVMNVGGLHNDYIGFRY-WNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVP 451

Query: 288 RFKGICYNLVNA----YFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMI 343
            F G+  + + +     F+Y G+E+  ++  + KNPRK+ P+  K    R+++ YLL++ 
Sbjct: 452 GFGGVLLSCIASTLVSVFAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVIMFYLLSIF 511

Query: 344 LIGFVVPHNSSELLGASGGNGL------------------------------------HA 367
           ++G  +      LL    G+ +                                    + 
Sbjct: 512 VVGLNIYSGDPRLLRYDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENIFLVDNPNQ 571

Query: 368 SPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDR 427
           SP+V+A        +  +IN V +   IS A+S LYA  R L S+A Q  AP   ++  +
Sbjct: 572 SPWVIAMQSLNQCTLSSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAPALFTWCTK 631

Query: 428 RGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMK 487
            G P   +L   L+G +     +    EVF    +I  +  +  W  +  S++RF  A+K
Sbjct: 632 GGVPYMCVLFCGLLGFLSLLCLNMDSAEVFFIFVSIGAMGSVIVWFGMNLSYLRFYYALK 691

Query: 488 LQ 489
           ++
Sbjct: 692 VR 693

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  129 bits (323), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 129/583 (22%), Positives = 240/583 (41%), Gaps = 96/583 (16%)

Query: 81  NDLEK------TTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIA 134
           +D+EK       T  +  Q+K +K RH+ M+S+G     GL +++GK  S+AGP   ++ 
Sbjct: 260 HDIEKVFNRSRATRKYHIQRK-LKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPFGTLLG 318

Query: 135 YGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLE 194
           +GL   +    + +  E++   P   G F+   S F+   FGFA  W + I  +  LP +
Sbjct: 319 FGLTGSIILATMLSFTELSTLIPVSSG-FSGLASRFVEDAFGFALGWTYWISCMLALPAQ 377

Query: 195 LITAAMTIKYWNT-SIDPDV---FVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGG 250
           + ++   + Y+N  +I   V   F+ +F  F + ++   V   GE  ++    K+++   
Sbjct: 378 VSSSTFYLSYYNNVNISKGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGISKVIIAIL 437

Query: 251 FIIFAIVVNCXXXXXXXXXXXXXWHDP--------------------GAFASSNGAS--- 287
            +   I++N              + D                         S  G S   
Sbjct: 438 MVFTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGEGSKKGISGPK 497

Query: 288 -RFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346
            RF      ++ + F++ G E+  L+  +  NPRK+ P+A K     +++ Y+  +  +G
Sbjct: 498 GRFLATASVMLISTFAFSGVEMTFLASGEAINPRKTIPSATKRTFSIVLISYVFLIFSVG 557

Query: 347 FVVPHNSSELL----GAS--------GGNGL----------------------HASPYVL 372
             +      LL    G S         G G+                      ++SP+V+
Sbjct: 558 INIYSGDPRLLSYFPGISEKRYEAIIKGTGMDWRLRTNCRGGIDYRQISVGTGYSSPWVV 617

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432
           A    G+       NA+++    +   SSL++  R L +++ Q  AP       +RG P 
Sbjct: 618 ALQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGVPY 677

Query: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ--- 489
            +++ S+L  VI + A      E F  LA +S  S    W  +  S +RF  A+K +   
Sbjct: 678 VSVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRKDI 737

Query: 490 -NKSLDTLGYKANTGLWGSYFG-VGFNILV-------FAAQFWVALSPPNSGGKCDANSF 540
            +++  +  YK+    + + +G VG ++ V       F   FW               +F
Sbjct: 738 ISRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFW------------STKAF 785

Query: 541 FASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
           F++Y  +  + + Y  Y       + +  L+Q+D+D+ R+  D
Sbjct: 786 FSAYGGLMFFFISYTAYKVL--GTSKIQRLDQLDMDSGRREMD 826

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  125 bits (313), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 133/576 (23%), Positives = 241/576 (41%), Gaps = 82/576 (14%)

Query: 76  DSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAY 135
           ++P    L K    H ++K  +K RH+ M+++G  IG GL +++G   ++AGP   ++ +
Sbjct: 264 NNPLCESLRKPDRYHIQRK--LKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGF 321

Query: 136 GLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLEL 195
            +   V    + +  E++   P   G F+   S F+   FGFA  W + + +    P ++
Sbjct: 322 SICGTVCLATMLSFTELSTLIPISSG-FSGLASRFVEDAFGFALGWSYWLSFTVTFPSQI 380

Query: 196 ITAAMTIKYWN----TSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGF 251
           I +   + Y+     T I     V +F+++    +   V+ + E  +I    K+L+    
Sbjct: 381 IASVFMLSYYEKVVATRISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILA 440

Query: 252 IIFAIVVNCXXXXXXXXXXXXXW---------------------HDPGAFASSNG----A 286
           +I  + +N              +                     HD G   S NG     
Sbjct: 441 MILMLFLNVRGVDGKSGAIGFRFWNSSSSETELTYGLFRPTFDLHDTGQ-GSLNGIGGAR 499

Query: 287 SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346
            RF  I   ++ + +S+ G E+  ++  +  NPRK+ P+A K    +IV +Y+L++  +G
Sbjct: 500 GRFLAIILVVLISTYSFNGVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVG 559

Query: 347 F------------------VVPHNSS----------------ELLGASGGNGLHASPYVL 372
                              VV  N+                 +L     GN    SP++L
Sbjct: 560 LNMYSGDPRLLRYGVDVPTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGN---RSPWIL 616

Query: 373 AASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPL 432
           A    G+  +    N V++   IS A+SSL+A  R L S+A Q  AP+        G P 
Sbjct: 617 ALQSFGLCSLASAFNGVLVFFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPW 676

Query: 433 TALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQ--- 489
            A+L S   G+I + + +      F  L++I+  +    W  +  S +RF  A+K +   
Sbjct: 677 IAILFSGSFGIIAYISVAESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDI 736

Query: 490 -NKSLDTLGYKANTGLWGSYFG-VGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAM 547
            ++   T  Y++    + S++G +G  ++V    F   L      G     SF +SY  +
Sbjct: 737 ISRDDPTYPYRSPMQPFLSFYGLIGSGLVVIFMGFTNFLH-----GFWSTRSFLSSYGGL 791

Query: 548 PIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583
             ++  YF Y  +    + +  L Q+D+D  R+  D
Sbjct: 792 IFFITSYFAYKLF--GASKIQSLEQLDMDTGRREMD 825

>Scas_619.2*
          Length = 471

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 120/469 (25%), Positives = 210/469 (44%), Gaps = 48/469 (10%)

Query: 146 IQAAGEMAVTYP----TLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMT 201
           + A GEM    P       GS       ++ +  GFA++W +   ++ ++  E   AA  
Sbjct: 1   MNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGV 60

Query: 202 IKYWNTS--IDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVN 259
           ++YW  +  +    ++ IF   ++ ++   V  YGE+EF F + KIL I G II + ++ 
Sbjct: 61  VEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILF 120

Query: 260 CXXXXXXXXXXXXXWHDPGAFA---SSNGASRFKGICYNLVNAYFSYG-GNELFVLSVND 315
                         W  PGAFA   +      F  +   ++   F++  G EL  L+ ++
Sbjct: 121 WGGGPSHDRLGFRYWQRPGAFADHITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSE 180

Query: 316 QKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGN--GLHASPYVLA 373
             + R++   A++  V+R+++ Y+L  + I  +V +N   L  A   +  G  +SP+V+ 
Sbjct: 181 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 240

Query: 374 ASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLT 433
               GIKV+PHIIN  I+ +  S  N+ ++A  R L ++A  G+AP+F S ++R    + 
Sbjct: 241 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRLRCSIR 300

Query: 434 ALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSL 493
              L  L+ +         + + F  +   S +S    W     ++IRFR+A+ + N   
Sbjct: 301 GSWLFLLILLFSLLKRLLIDSKRFQLVFKHSTISGFIGWICACVAYIRFRKAI-IFNDLY 359

Query: 494 DTLGYKANTG---LWGSYFGVGFNIL-----VFAAQFWVALSPPNSGGKCDANSFFASYL 545
           D L YK       +W S F V    L     +F  +FW            D   F A+Y+
Sbjct: 360 DRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFW------------DYKDFIAAYI 407

Query: 546 AMPIWLVFYFGYMC-------WY---KDFTVLTDLNQV-----DLDNHR 579
            +P+++V + G+         WY       V T L ++     +LD  R
Sbjct: 408 TLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKR 456

>Scas_642.22
          Length = 237

 Score =  102 bits (253), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/188 (31%), Positives = 96/188 (51%), Gaps = 2/188 (1%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           ++ +K RH+ M++LG  IGTGL +     L  AGP   +IAY  ++ + Y + Q+ GEMA
Sbjct: 18  RRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA 77

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDV 213
            T+  +  SF  ++  F+S  FG A  +++   W     LEL      I++W  ++    
Sbjct: 78  -TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 136

Query: 214 FVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXX 273
           ++ IF+V L  ++ F V+ YGE EF     K++ I GF+I+   + C             
Sbjct: 137 WISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPMSFRY 195

Query: 274 WHDPGAFA 281
           W  PGAF 
Sbjct: 196 WRHPGAFG 203

>Scas_485.4*
          Length = 237

 Score =  100 bits (249), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 96/188 (51%), Gaps = 2/188 (1%)

Query: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153
           ++ +K RH+ M++LG  IGTGL +     L  AGP   +IAY  ++ + Y + Q+ GEMA
Sbjct: 18  RRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMA 77

Query: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDV 213
            T+  +  SF  ++  F+S  FG A  +++   W     LEL      I++W  ++    
Sbjct: 78  -TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAA 136

Query: 214 FVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXX 273
           ++ IF++ L  ++ F V+ YGE EF     K++ I GF+I+   + C             
Sbjct: 137 WISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVGFRY 195

Query: 274 WHDPGAFA 281
           W  PGAF 
Sbjct: 196 WRHPGAFG 203

>Scas_476.4
          Length = 237

 Score =  100 bits (248), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 97/191 (50%), Gaps = 2/191 (1%)

Query: 91  QEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAG 150
           +  ++ +K RH+ M++LG  IGTGL +     L  AGP   +IAY  ++ + Y + Q+ G
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 151 EMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSID 210
           EMA T+  +  SF  ++  F+S  FG A  +++   W     LEL      I++W  ++ 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 211 PDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXX 270
              ++ IF++ L  ++ F V+ YGE EF     K++ I GF+I+   + C          
Sbjct: 134 LAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVC-GAGVTGPVG 192

Query: 271 XXXWHDPGAFA 281
              W  PGAF 
Sbjct: 193 FRYWRHPGAFG 203

>CAGL0B02838g complement(274984..276762) highly similar to sp|P50276
           Saccharomyces cerevisiae YGR055w MUP1, High-affinity
           methionine permease, hypothetical start
          Length = 592

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 81/413 (19%), Positives = 158/413 (38%), Gaps = 36/413 (8%)

Query: 56  DVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGL 115
            + + N+    F  S K  DD+ D    ++  T   + +K +     I +     +GTG+
Sbjct: 30  QLNIFNKENYKFSSSEKSEDDTSDFETGQQFATELDQGEKRLGLISCIGLICNRMLGTGV 89

Query: 116 LVSNGKGLSLAGPASL-VIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKP 174
              +    +L+G   L +I + + + +    +    E     P   G  N   + F  KP
Sbjct: 90  FAVSSTIYTLSGSIGLALILWAVGALIALAGLYVYMEFGTAIPRNGGEKNYLEAIF-KKP 148

Query: 175 FGFAT----TWLFCIQW-----LTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFI 225
             F T    +++F + W     +    + L  A   +  WN         ++F+ F   +
Sbjct: 149 KFFITCMYASYVFFLGWAAGNSVNTAVMFLTAANTEVTKWNQR--GIGVAVVFFCFA--V 204

Query: 226 HFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSNG 285
           +   V+A    + +    K+    G +IF  +                 +   AF  +N 
Sbjct: 205 NSINVRAGLYIQNVLGVFKL----GIVIFISITGWVALAGGLKHGYQSHNFHNAFEGTNK 260

Query: 286 ASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILI 345
           A+ + G+   L N  +S+ G      ++ + KNP ++   A  +++  + +IY+   I  
Sbjct: 261 ATAY-GVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSLICLAIIYIFVNIAY 319

Query: 346 GFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIIN-AVILIALISVAN--SSL 402
             VVP +            L +S  +LAA    I    H    A  L+ L ++ N  S +
Sbjct: 320 FAVVPKDK-----------LISSKLILAADFFDICFGGHAKRVAAALVGLSALGNVMSVI 368

Query: 403 YAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSPRE 453
           ++  R++  L ++G  P   F +       P+  L    ++ +I   A  P +
Sbjct: 369 FSQGRIIQQLGREGVLPFSNFFATSKPFNSPMVGLFQHFIICMITILAPPPGD 421

>Scas_233.1
          Length = 141

 Score = 38.9 bits (89), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 5/58 (8%)

Query: 65  QGFIDSFKRADD---SPDHNDLEK--TTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117
           Q F DSFK+A+D    P+  + E+    TA    + T+K R   M+++G  IG+GL V
Sbjct: 84  QKFKDSFKKAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFV 141

>Sklu_2305.6 YGL077C, Contig c2305 10656-12281
          Length = 541

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 5/104 (4%)

Query: 65  QGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGT-----GLLVSN 119
           Q  I    + +D   H +  K+ T   E+   ++    +   LG G G      G+  S 
Sbjct: 15  QNGIQHLLKEEDQLQHTNTVKSCTLEGERGAELRKSFSLWSILGVGFGLTNSWFGISASM 74

Query: 120 GKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSF 163
             G+S  GP  +V    +++ V+  +  + GE++  YP   G F
Sbjct: 75  VTGISSGGPMMIVYGIIIIALVSVCIGISLGELSSAYPHAGGQF 118

>CAGL0K04367g 412204..413952 highly similar to sp|P50276
           Saccharomyces cerevisiae YGR055w high-affinity
           methionine permease, hypothetical start
          Length = 582

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 17/180 (9%)

Query: 279 AFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
           AF  +N A+ + G+   L N  +S+ G      ++ + K+P ++   A  +++  + +IY
Sbjct: 242 AFEGTNKATAY-GVVNALYNVIWSFVGYSNVNYALGEVKDPVRTLKIAGPTSMVCLAIIY 300

Query: 339 LLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIIN-AVILIALISV 397
           +   I    VVP              L +S  +LAA    I    H    A  L+ L ++
Sbjct: 301 IFVNIAYFAVVPKEK-----------LISSKLILAADFFDICFGGHSKRVAAALVGLSAL 349

Query: 398 AN--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSPRE 453
            N  S +++  R++  L ++G  P   F +       P+  L    ++ +I   A  P +
Sbjct: 350 GNVMSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIICMITIIAPPPGD 409

>Scas_670.14
          Length = 585

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 77/180 (42%), Gaps = 19/180 (10%)

Query: 274 WHDPGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYR 333
           +HD  AFA +  A+ + GI   L N  +S+ G      ++ + K+P ++   A  +++  
Sbjct: 242 FHD--AFAGTENATAY-GIVTALYNVIWSFVGYSNVNYALGEVKDPVRTLKIAGPTSMVF 298

Query: 334 IVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIIN-AVILI 392
           I ++Y+   +    VVP              L +S  VLAA    I    H    A   +
Sbjct: 299 IAIVYIFVNVAYFAVVPKEK-----------LISSKLVLAADFFDIVFGEHGKKAAAAFV 347

Query: 393 ALISVAN--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAA 448
            L ++ N  S +++  R++  L ++G  P   F +       P+  L    ++ +I F A
Sbjct: 348 GLSALGNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFDSPMVGLFQHMIICLITFLA 407

>YJR041C (YJR041C) [2935] chr10 complement(510153..513677) Protein of
            unknown function, has weak similarity to uncharacterized
            C. albicans Orf6.9153p [3525 bp, 1174 aa]
          Length = 1174

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 17/117 (14%)

Query: 136  GLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLEL 195
             L+   TY  I+  G     Y +    FNA   F +SKP+ F+    +CI+ L  LP  L
Sbjct: 945  ALLEAYTYCDIEKFG-----YKSYLLLFNAIKEFLVSKPWLFSQ---YCIEML--LPFCL 994

Query: 196  ITAAMTIKYWNTSIDPDVFVIIFYVF--LMFIHFFGVQAYGETEFIFNA--CKILMI 248
             T A  + + +T    + F+ I  V   ++ +H F    +     +FN+  C+IL I
Sbjct: 995  KTLAFIVNHESTDEINEGFINIIEVIDHMLLVHRFK---FSNRHHLFNSVLCQILEI 1048

>Scas_711.22*
          Length = 1018

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 370 YVLAASIHGIKVVPHIINAVILIALISVANSSLYAGP-RLLSSLAQQGYAPRFLSYVDRR 428
           ++L+ S    + + HI N  +L  L+ V +S     P R++  L +QG  PR L  +   
Sbjct: 269 FILSQSTLVARFLKHIDNPPLLDFLLKVISSDKPDAPTRVIQCLKEQGLIPRLLDCLSHE 328

Query: 429 GRPLT----ALLLSALVGVIG 445
             P T    A  L A V + G
Sbjct: 329 YDPSTQTAAADFLKAFVTISG 349

>Kwal_47.18050
          Length = 506

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 17/184 (9%)

Query: 279 AFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
           AF  +  A+ + GI   L N  +S+ G      ++ + KNP ++   A  +++  + V+Y
Sbjct: 171 AFEGTENATAY-GIVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSLLFLAVVY 229

Query: 339 LLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAV-ILIALISV 397
           +   I    VVP +            L +S  +LAA    I        A  + + L +V
Sbjct: 230 IFVNIAYFAVVPKDK-----------LISSKLILAADFFDIVFGGQAKKAASVFVGLSAV 278

Query: 398 AN--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSPRE 453
            N  S +++  R++  L ++G  P   F +       PL  L    +V ++   A  P +
Sbjct: 279 GNVMSVIFSQGRIIQQLGREGVLPFSSFFATSRPFDSPLVGLFQHFIVCLVTILAPPPGD 338

Query: 454 EEVF 457
              F
Sbjct: 339 AYNF 342

>AEL125C [2381] [Homologous to ScYKL174C - SH] (387763..389490)
           [1728 bp, 575 aa]
          Length = 575

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 13/89 (14%)

Query: 75  DDSP---DHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGT---GLLVSNGKGLSLAGP 128
           DD P   +H   E      Q+  +T+ SR  ++  LG G+ +   G+  + G GL   GP
Sbjct: 35  DDEPVEVEHFQYE------QKLDRTLLSRRSVI-GLGFGLMSPVLGMSTTLGIGLVHGGP 87

Query: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYP 157
            +++ A+ L   +++    A GE+   YP
Sbjct: 88  PTILGAFALCGLMSWLTALAIGEVVSKYP 116

>CAGL0M08272g complement(823019..824884) highly similar to sp|P36029
           Saccharomyces cerevisiae YKL174c, start by similarity
          Length = 621

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 71  FKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGT---GLLVSNGKGLSLAG 127
           + + D+  D  +  +     QE  K++ SR+ ++  LG G+ +   G+  S G G+   G
Sbjct: 35  YVQEDEVTDEPEEVEHFNYKQELDKSLLSRNSVI-GLGFGLMSPVLGMCTSMGIGMLNGG 93

Query: 128 PASLVIAYGLVSFVTYFMIQAAGEMAVTYP 157
           P S+++ + +   + +F   + GE+   +P
Sbjct: 94  PLSIMLGFFISGILIWFSSLSLGEIVSKFP 123

>AFL081W [3112] [Homologous to ScYGL077C (HNM1) - SH]
           complement(286339..287967) [1629 bp, 542 aa]
          Length = 542

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 9/105 (8%)

Query: 68  IDSFKRADDSPDHNDLEKT----TTAHQEQKKTMKSRHVIMMSLGTGIGT-----GLLVS 118
           +D  KR        D EK+    TT   ++ + ++    +   LG G G      G+ VS
Sbjct: 9   MDLVKRHPSGQCCEDGEKSNVGMTTCQVDEGQLLRKSFSLWSVLGVGFGLTNSWFGISVS 68

Query: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSF 163
              G+   GP  +V    +++ V+  +  +  E++  YP   G F
Sbjct: 69  MITGIGSGGPMMIVYGIVIIALVSVCVGVSLAELSSAYPHAGGQF 113

>Sklu_2147.4 YKL174C, Contig c2147 6541-8247 reverse complement
          Length = 568

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 91/222 (40%), Gaps = 20/222 (9%)

Query: 49  HNLRSRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLG 108
            +LR      V    LQ +  +  + +D  D  ++ +     Q+  K++ SR  ++  LG
Sbjct: 9   ESLRGGLPSLVPESLLQNW-HTIMQENDEDDGPEVVEQFQYEQKLDKSLLSRGSVI-GLG 66

Query: 109 TGIGT---GLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNA 165
            G+ +   G+  +   GL   GP ++V  + +V F T+    + GE+   +P      + 
Sbjct: 67  FGLMSPVLGMSTTMSIGLLNGGPLTIVAGFMVVGFATWLCSLSLGEIVSKFPI---ELHG 123

Query: 166 YTSFFISKP----FGFATTWLFCI-QWLTVLPLELITAAMTIKYW---NTSIDPDVFVII 217
            ++   +K     F + T WL  +  W     +    A + I      N S+ P   VI 
Sbjct: 124 GSAMLAAKKHRLVFSWYTGWLMLLGNWTMSTSITFAGAQLVISLISLANDSLVPKDSVIF 183

Query: 218 F--YVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIV 257
           +   VF   +   GV       FI    K+ +   +II+AI+
Sbjct: 184 YTVVVFYAIVTVVGVVNLKFARFIETINKVCVY--WIIYAII 223

>Kwal_26.7070
          Length = 1315

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 55/136 (40%), Gaps = 32/136 (23%)

Query: 109  TGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAV--------TYPTLP 160
            T IG+ L   NG  L+  G  +   A+G VS  T  +I   G+ A+        T   +P
Sbjct: 1107 TFIGSTLFYRNGNVLNSHGETADHWAWG-VSIYTCSVIIVIGKAALVTNQWTKFTAFAIP 1165

Query: 161  GSFNAYTSFF-------------------ISKPFGFATTWLFCIQWLTVLPLELITAAMT 201
            GS   +  FF                   +S  +G AT WL CI    VLP   +   + 
Sbjct: 1166 GSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCI----VLPTFALMRDLV 1221

Query: 202  IKYWNTSIDPDVFVII 217
             KY+  +  P+ + ++
Sbjct: 1222 WKYYKRTYTPESYHVV 1237

>ABL003C [589] [Homologous to ScYGR055W (MUP1) - SH]
           (390867..392552) [1686 bp, 561 aa]
          Length = 561

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 158/424 (37%), Gaps = 53/424 (12%)

Query: 58  QVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLV 117
           Q+K R  +  +  F+   D+ D    E   T   +  K +     I +     +GTG+ V
Sbjct: 9   QLKIRKKRQEVAFFESNADANDVEAGEHFITELDKGDKRLGLFSSIGLICNRMLGTGIFV 68

Query: 118 SNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAG-----EMAVTYPTLPGSFNAYTSFFIS 172
              K   L G  S+  A GL  +V   +I  AG     E     P   G  N Y  F   
Sbjct: 69  VPAKIFQLTG--SVYFALGL--WVLGALIALAGLYVYMEFGTAIPRNGGEKN-YLEFIFK 123

Query: 173 KPFGFATT----WLFCIQWL---TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFI 225
           KP  F T+    ++  + W    +V+   +   A  ++            +IF+ FL  +
Sbjct: 124 KPKFFITSMYSAYVIFLGWAAGNSVMAAAMFLDAGKVEATRWRERGLGVAVIFFCFL--V 181

Query: 226 HFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCXXXXXXXXXXXXXWHDPGAFASSN- 284
           +   V+A    + I    KI    G IIF  +                 H  GA  + N 
Sbjct: 182 NSLSVKAGLYFQNILGVFKI----GTIIFIAITGLVALGG---------HIDGAPGTENF 228

Query: 285 --GASRFKGICYNLVNAYF----SYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
               S      Y +VNA +    S+ G      ++ + KNP ++   A  S++  +  +Y
Sbjct: 229 RHSPSDLSPSAYTIVNALYQVIWSFVGYSNVNYALGEVKNPVRTLKIAGPSSLAVLGTLY 288

Query: 339 LLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVA 398
           LL  +    VVP    E+L  +G N L    + +A      +       + I I L ++ 
Sbjct: 289 LLVNVAFFAVVPM---EILKDAGMN-LTPKFFDIAFGDKARRA------SAIFIGLSALG 338

Query: 399 N--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSPREE 454
           N  S +++  R++  L ++G  P   F +       P+  L    ++  I   A  P + 
Sbjct: 339 NVCSVIFSQGRIVQQLGREGVLPFTSFFASSKPFNSPMAGLFQHMIICAITILAPPPGDA 398

Query: 455 EVFT 458
             F 
Sbjct: 399 YDFV 402

>YGR055W (MUP1) [2018] chr7 (599419..601143) High-affinity
           methionine permease [1725 bp, 574 aa]
          Length = 574

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 74/180 (41%), Gaps = 17/180 (9%)

Query: 279 AFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
           AF  +  A+ + GI   L +  +S+ G      ++ + KNP ++   A  +++  + +IY
Sbjct: 244 AFEGTETATAY-GIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIY 302

Query: 339 LLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIIN-AVILIALISV 397
           +   I    VVP +            L +S  +LAA    I         A  L+ L ++
Sbjct: 303 IFVNIAYFAVVPKDK-----------LISSKLILAADFFDIVFGGQAKRAAAALVGLSAL 351

Query: 398 AN--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSPRE 453
            N  S +++  R++  L ++G  P   F +       P+  L    +V  +   A  P +
Sbjct: 352 GNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGD 411

>Scas_531.2*
          Length = 1053

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 503 GLWGSYFGVGFNILVFAAQFWVALSPPNSG 532
           G WGS FG+  N + F+A+F     PP +G
Sbjct: 457 GYWGSLFGMVINEVSFSAEFTSFFVPPTTG 486

>KLLA0B13233g complement(1159097..1160833) highly similar to
           sp|P50276 Saccharomyces cerevisiae YGR055w MUP1 high
           affinity methionine permease, start by similarity
          Length = 578

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 67/345 (19%), Positives = 132/345 (38%), Gaps = 58/345 (16%)

Query: 279 AFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIY 338
           AF  +  A+ + GI   L N  +S+ G      ++ + KNP ++   A  +++  + ++Y
Sbjct: 244 AFEGTGNATAY-GIVNALYNVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSLIFLAIVY 302

Query: 339 LLTMILIGFVVPHN---SSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALI 395
           +   I    VVP     +S+L+       L A  + LA      K       A +L+ L 
Sbjct: 303 IFVNIAYFAVVPKEVFRTSKLI-------LVADFFELAFKSDSAKKA-----ASVLVGLS 350

Query: 396 SVAN--SSLYAGPRLLSSLAQQGYAP--RFLSYVDRRGRPLTALLLSALVGVIGFAATSP 451
           ++ N  S +++  R++  L ++G  P   F +       P   L    +V  +   A   
Sbjct: 351 ALGNVMSVIFSQGRIIQQLGREGVLPFSNFFATSKPFDSPCVGLFQHFIVCTVTIIAPPA 410

Query: 452 REEEVFTWLAAIS---GLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSY 508
            +   F  L  IS    +   F    +++ H   ++                   +W   
Sbjct: 411 GDAYNFV-LNLISYPMNIVNFFISAGLLWIHWERKKGRT----------------MWDPP 453

Query: 509 FGVGFNILVF--AAQFWVALSP--PNSGGKCDANSFFASYLAMPIWL-------VFYFGY 557
              G  ++ F   A  ++ ++P  P S G+       + Y ++P W+       +F  G 
Sbjct: 454 IKAGIPVIAFFMLANLYLIVAPYIPPSNGE-------SVYQSLPYWIHCVVAWGIFAVGG 506

Query: 558 MCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSS 602
           + W     VL  + + +L +   + +  F RQ+  + K    N+ 
Sbjct: 507 IYWVVWAVVLPKIGKYELVHEEVLGEDGFWRQKIAKRKINEANAE 551

>Sklu_1731.2 YBR283C, Contig c1731 1517-2449
          Length = 310

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 463 ISGLSELFTWTSIMFSHI-RFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQ 521
           I GLS LF++  + + HI  F     + N S +++ YK      G Y  V  N L++  Q
Sbjct: 110 IGGLSVLFSYIMLFYIHIVAFALIQLVANNSPESVIYKVT----GGYAPV--NNLLYVPQ 163

Query: 522 FWVA-LSPPNSGGKC 535
           F ++ L+PP S  +C
Sbjct: 164 FPLSLLTPPKSLYEC 178

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.138    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,230,077
Number of extensions: 738434
Number of successful extensions: 3044
Number of sequences better than 10.0: 137
Number of HSP's gapped: 2703
Number of HSP's successfully gapped: 151
Length of query: 602
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 495
Effective length of database: 12,891,983
Effective search space: 6381531585
Effective search space used: 6381531585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 64 (29.3 bits)