Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H08217g32532016170.0
YOR026W (BUB3)3413336071e-76
Scas_617.63303225912e-74
AEL226W3243195293e-65
Kwal_55.199263122945268e-65
Sklu_1927.13453175289e-65
KLLA0A07106g3103194762e-57
CAGL0G03399g3692902022e-17
KLLA0E20779g3712741994e-17
Scas_510.53622851923e-16
YER107C (GLE2)3652611914e-16
AGL301C3612761881e-15
Sklu_2332.73672641862e-15
Kwal_27.107853672891747e-14
KLLA0E23529g82661860.011
CAGL0M05335g80682850.014
KLLA0D16390g936294840.023
AGR207C32088800.045
Kwal_27.1205375579780.10
YBR198C (TAF5)79869770.13
Scas_631.1747441760.16
Sklu_2423.1944101760.18
YPR178W (PRP4)46556740.32
AFR199C33452730.35
AEL246C81559730.37
AER255C46764720.57
Scas_713.50983294710.67
Kwal_23.535147441710.76
Sklu_2431.1274969700.92
YDR267C33069690.95
AGL196C935218691.2
AAR102C59149691.4
KLLA0F04884g121261691.5
ACR091W32879681.5
Scas_721.3282282681.7
Scas_619.9725150681.8
KLLA0F07403g347244672.1
Kwal_56.24526121061672.2
Scas_702.16816131672.3
Kwal_26.8975445109662.6
YNR043W (MVD1)39696662.6
Scas_629.1140094662.8
Kwal_27.11550407101653.8
KLLA0B01958g890118654.0
KLLA0E04741g45941644.2
YDL145C (COP1)120165654.3
CAGL0G09845g500189644.3
Scas_680.11347222644.8
Sklu_2416.2135398644.9
Kwal_33.1547578366645.3
KLLA0F02497g757103636.1
KLLA0A08866g42377636.7
YPL009C103822637.1
KLLA0F10285g39773627.5
YIR039C (YPS6)53784628.2
AFL118W832125628.4
YDR364C (CDC40)45563628.5
KLLA0B02827g942101628.9
Sklu_2318.1711133629.7
Scas_605.1842472619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H08217g
         (320 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H08217g complement(806660..807637) similar to sp|P26449 Sac...   627   0.0  
YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein ...   238   1e-76
Scas_617.6                                                            232   2e-74
AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH] complement(...   208   3e-65
Kwal_55.19926                                                         207   8e-65
Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement          207   9e-65
KLLA0A07106g complement(640536..641468) similar to sp|P26449 Sac...   187   2e-57
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    82   2e-17
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    81   4e-17
Scas_510.5                                                             79   3e-16
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    78   4e-16
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    77   1e-15
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       76   2e-15
Kwal_27.10785                                                          72   7e-14
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    38   0.011
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    37   0.014
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    37   0.023
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    35   0.045
Kwal_27.12053                                                          35   0.10 
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    34   0.13 
Scas_631.17                                                            34   0.16 
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             34   0.18 
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    33   0.32 
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    33   0.35 
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    33   0.37 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    32   0.57 
Scas_713.50                                                            32   0.67 
Kwal_23.5351                                                           32   0.76 
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      32   0.92 
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    31   0.95 
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    31   1.2  
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    31   1.4  
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    31   1.5  
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    31   1.5  
Scas_721.32                                                            31   1.7  
Scas_619.9                                                             31   1.8  
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    30   2.1  
Kwal_56.24526                                                          30   2.2  
Scas_702.16                                                            30   2.3  
Kwal_26.8975                                                           30   2.6  
YNR043W (MVD1) [4626] chr14 (701894..703084) Mevalonate diphosph...    30   2.6  
Scas_629.11                                                            30   2.8  
Kwal_27.11550                                                          30   3.8  
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    30   4.0  
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    29   4.2  
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    30   4.3  
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    29   4.3  
Scas_680.11                                                            29   4.8  
Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement          29   4.9  
Kwal_33.15475                                                          29   5.3  
KLLA0F02497g complement(226225..228498) weakly similar to sp|P39...    29   6.1  
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    29   6.7  
YPL009C (YPL009C) [5428] chr16 complement(535815..538931) Protei...    29   7.1  
KLLA0F10285g complement(952632..953825) similar to sp|P32377 Sac...    28   7.5  
YIR039C (YPS6) [2703] chr9 complement(430494..432107) Yapsin 6, ...    28   8.2  
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    28   8.4  
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    28   8.5  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    28   8.9  
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          28   9.7  
Scas_605.18                                                            28   9.9  

>CAGL0H08217g complement(806660..807637) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3, hypothetical
           start
          Length = 325

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/320 (95%), Positives = 305/320 (95%)

Query: 1   MRVEIKDVPREYXXXXXXXXXXXXXXXVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTS 60
           MRVEIKDVPREY               VSYDGTLSVYTVDRELKQVNLTVRLQYESSLTS
Sbjct: 1   MRVEIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTS 60

Query: 61  VAQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDG 120
           VAQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDG
Sbjct: 61  VAQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDG 120

Query: 121 SIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHIL 180
           SIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHIL
Sbjct: 121 SIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHIL 180

Query: 181 DSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPIN 240
           DSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPIN
Sbjct: 181 DSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPIN 240

Query: 241 AIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDS 300
           AIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDS
Sbjct: 241 AIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDS 300

Query: 301 FKTNAVIDSNLELEPSRIYV 320
           FKTNAVIDSNLELEPSRIYV
Sbjct: 301 FKTNAVIDSNLELEPSRIYV 320

>YOR026W (BUB3) [4839] chr15 (379780..380805) Checkpoint protein
           required for cell cycle arrest in response to loss of
           microtubule function [1026 bp, 341 aa]
          Length = 341

 Score =  238 bits (607), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 196/333 (58%), Gaps = 16/333 (4%)

Query: 3   VEIKDVPREYXXXXXXXXXXXXXXXVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVA 62
           V+I+  P++Y                S+DG+L+VY  D + K V+L   L+Y+  L    
Sbjct: 4   VQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCN 63

Query: 63  QLNIQGRQFIYAGSVDGQLLSVDLENS-LFVKVDQIESSAGISCIAMHGD-RVIAGSWDG 120
            ++    Q IY G+V G++L VDL  S  F  +   E++ GI  I  +GD ++IA SWDG
Sbjct: 64  FIDNTDLQ-IYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDG 122

Query: 121 SIYVVNPKS--NSLEFTLELPSE----YKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPT 174
            I V++P++  + +     L S       K F +   + +L++     ++  F+LPL   
Sbjct: 123 LIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCED 182

Query: 175 TKPHILDSGQIFQIRDSQLTP-EGDGFVCTGIDGRVSVEYFDD------TSKRFAFRCHK 227
               I +SG  +QIRD  L P E +G+ C+ IDGRV+VE+FDD      +SKRFAFRCH+
Sbjct: 183 DNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHR 242

Query: 228 YDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLAC 287
            +L DT + YP+N+I F P     YT GSDG +S W+L  + KIK   K+NE+SVV++AC
Sbjct: 243 LNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIAC 302

Query: 288 NENILCVATSDDSFKTNAVIDSNLELEPSRIYV 320
           ++NILC+ATSDD+FKTNA ID  +EL  S IY+
Sbjct: 303 SDNILCLATSDDTFKTNAAIDQTIELNASSIYI 335

>Scas_617.6
          Length = 330

 Score =  232 bits (591), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 194/322 (60%), Gaps = 4/322 (1%)

Query: 2   RVEIKDVPREYXXXXXXXXXXXXXXXVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSV 61
           +VE+++ P EY                ++DG+LS +  +  LK+V L  ++ +E +L   
Sbjct: 6   KVEVQNGPSEYISDIVLIDEKSQFLVTAWDGSLSQFEYNPNLKKVKLIKKVVHEYALLCC 65

Query: 62  AQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGD-RVIAGSWDG 120
               + G+  +Y G+V G++  VD ENS F  V    +  G+S +   G+   IA SWDG
Sbjct: 66  CYAFVLGKLRVYVGTVQGEIFLVDFENSDFKPVLGNSTQLGVSKMVNVGNYTFIASSWDG 125

Query: 121 SIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHI- 179
            +  ++ + N++  T +L +   K   +    + L+++    KI    LPL    +  + 
Sbjct: 126 ILQEIDMQDNAVIRTTKLENN-TKVLAMDCVNNLLILALTGKKIRWLNLPLNNNDRGEVT 184

Query: 180 -LDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYP 238
            +++G  +Q+RD +LT EGDG+V + IDGRV+VEYF+D S+ FAFRCH+ +L D    +P
Sbjct: 185 EVETGLKYQVRDIKLTLEGDGYVTSSIDGRVAVEYFEDDSRNFAFRCHRMNLVDMQFVFP 244

Query: 239 INAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSD 298
           +N++ F P +   +TGGSDGCVS W+L    KIKQ PK+NENSVV+LACNE+IL V TSD
Sbjct: 245 VNSLAFSPASHLLFTGGSDGCVSLWNLETHKKIKQFPKFNENSVVKLACNEDILVVGTSD 304

Query: 299 DSFKTNAVIDSNLELEPSRIYV 320
           DSFKTNAV+   LEL+ SR+YV
Sbjct: 305 DSFKTNAVVAEPLELQSSRLYV 326

>AEL226W [2280] [Homologous to ScYOR026W (BUB3) - SH]
           complement(204812..205786) [975 bp, 324 aa]
          Length = 324

 Score =  208 bits (529), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/319 (37%), Positives = 184/319 (57%), Gaps = 14/319 (4%)

Query: 3   VEIKDVPREYXXXXXXXXXXXXXXXVS-YDGTLSVYTVDRELKQVNLTVRLQYESSLTSV 61
           VE+KDV ++Y               VS +DGT S+Y  ++  +      RL +E  LTSV
Sbjct: 16  VELKDVSKDYLSGVCLVDEEGSQLIVSSWDGTASLYDWEKNKRMG----RLSHEWPLTSV 71

Query: 62  AQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGS 121
           A     G +  Y GS  G++L +D E+   V +  ++   GIS +  +G  V+ GSWDGS
Sbjct: 72  AV--CAGTRRAYVGSAQGEVLELDWESERMVALQGVQCGLGISAMGSYGQFVVVGSWDGS 129

Query: 122 IYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILD 181
           + VV+ + N++     L     K   L   A +++  T    + +F+        P   +
Sbjct: 130 LAVVDTRRNTVRHIRRLTG---KILSLDCGAARVVCMTTD-GVYVFRTS-DIDAAPERRE 184

Query: 182 SGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINA 241
           SG  +Q R  +L P+ +G+V + +DGRV+VEYF D  ++FAFRCH+ +L DT + +P+NA
Sbjct: 185 SGLKYQSRCVRLVPDEEGYVQSSVDGRVAVEYFGDEGRKFAFRCHRMNLKDTQLVFPVNA 244

Query: 242 IRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSF 301
           + F P T+  YTGGSDG V AW+L  + K ++LPK  E+SVV+L CN   L +A SDDSF
Sbjct: 245 LCFHPKTALLYTGGSDGRVFAWNLTTRKKAEELPKV-EDSVVKLCCNRRALVIAASDDSF 303

Query: 302 KTNAVIDSNLELEPSRIYV 320
           KT+AV++ ++ L+ SR+YV
Sbjct: 304 KTSAVVE-DIALQRSRVYV 321

>Kwal_55.19926
          Length = 312

 Score =  207 bits (526), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 175/294 (59%), Gaps = 18/294 (6%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLEN 88
           ++DGTLS+Y  +      +L +R++Y  +LTS A   +  +  I+ GSV G++L VD E+
Sbjct: 30  AWDGTLSLYNYEDN----DLVLRMRYNDALTSCAYSEVGSK--IFVGSVSGEVLEVDFES 83

Query: 89  SLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKCFKL 148
             F  + +  +  GIS +    + +IAGSWDGS+ +V+ +S    F   L      C  L
Sbjct: 84  ERFNLISE-PAELGISALCCSQNNIIAGSWDGSLQIVDSRSGDRWFRERL----DNCKIL 138

Query: 149 SVQA---HKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTGI 205
            +     +KL++S    K+AI+ L      KP I +SG  FQ RD +L P  +G+V + +
Sbjct: 139 GMDCADNNKLVVSLTGGKVAIYDL--RNMIKPQIRESGLKFQTRDIKLMPAANGYVQSSL 196

Query: 206 DGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHL 265
           DGRV+VEYFD  S RFAFRCH+ +L DT   +P+N++ F  N    YTGGSDG V  W+L
Sbjct: 197 DGRVAVEYFDQESSRFAFRCHRMNLPDTQFVFPVNSLCFNSNDGTLYTGGSDGRVYGWNL 256

Query: 266 HKKTKIKQLPKYNENSVVQLACNENILCVATSDDSFKTNAVIDSNLELEPSRIY 319
             + K  + PK+ E+S+V+LA   ++LCVAT DDSFKT   ++   E++P ++Y
Sbjct: 257 STRKKSHEFPKF-EDSIVKLAYKNDVLCVATGDDSFKTLPTVEG-AEIQPGKVY 308

>Sklu_1927.1 YOR026W, Contig c1927 98-1135 reverse complement
          Length = 345

 Score =  207 bits (528), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 184/317 (58%), Gaps = 15/317 (4%)

Query: 4   EIKDVPREYXXXXXXXXXXXXXXXVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQ 63
           +++DV ++Y                S+DG++S+Y  D     +N    L+++  L S   
Sbjct: 41  KLQDVTKDYISDLVLLESYSHIVCTSWDGSISMYDYD----SMNRLTSLRHKFPLLSTGV 96

Query: 64  LNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIY 123
           ++  G+  IY GSV G++L VDLE+  F  V +  +  GIS I +    VIAGSWDGS+ 
Sbjct: 97  VH-NGK--IYVGSVQGEMLEVDLESEKFGTVSE-SAELGISSICIQDASVIAGSWDGSLR 152

Query: 124 VVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSG 183
           +V+ ++N  +F   L     K   +    +KL IS    ++ IF L       P    +G
Sbjct: 153 IVDSRNNDTQFETALG---HKVLSMDCHENKLCISLTAGEVKIFDL--RKLGAPVSRKAG 207

Query: 184 QIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIR 243
             FQ RD ++ P  +G+V + +DGRV+VEYFD   K+FAFRCH+  L D    +P+N I 
Sbjct: 208 LKFQARDIKIMPSYEGYVQSSLDGRVAVEYFDQEEKKFAFRCHRMSLQDAQFVFPVNTIC 267

Query: 244 FIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSFKT 303
           F P++S  +TGGSDG + AW+L  + K  +LPK  ++SVV++ACN+ ++  ATSDDSFKT
Sbjct: 268 FKPHSSTLFTGGSDGRIYAWNLSTRKKSDELPKL-DSSVVKVACNDRVVVAATSDDSFKT 326

Query: 304 NAVIDSNLELEPSRIYV 320
           +A ++ +L L+PS IY+
Sbjct: 327 SATVE-DLPLQPSDIYI 342

>KLLA0A07106g complement(640536..641468) similar to sp|P26449
           Saccharomyces cerevisiae YOR026w BUB3 cell cycle arrest
           protein, start by similarity
          Length = 310

 Score =  187 bits (476), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/319 (34%), Positives = 180/319 (56%), Gaps = 19/319 (5%)

Query: 4   EIKDVPREYXXXXXXXXXXXXXXXVSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQ 63
           +++ VP++Y                 +DG+LS++    ++ Q  L ++LQ+   LTS   
Sbjct: 6   KLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLF----DITQQQLLMKLQHSWPLTS-CH 60

Query: 64  LNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIY 123
           ++  GR  I+AGSV G++L  D E+   +  D +  S G+S I      +IA SWDGS+ 
Sbjct: 61  VSKDGR--IWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGITSIDHFIIASSWDGSLI 118

Query: 124 VVNPKSNSL--EFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILD 181
           V++   N +  ++  E     +K F+L     +++ S    K+ + + P    T+    +
Sbjct: 119 VLDYLRNQIVKQWKFE-----EKIFQLCASEVRVMCSLSSGKVKLIQFPSWDITET---E 170

Query: 182 SGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINA 241
           SG  +Q R   L P   GFV   +DGRVSVE+FDD S +FAFRCH+ +L+D  M +P+ A
Sbjct: 171 SGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMNLEDVQMVFPVTA 230

Query: 242 IRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDDSF 301
           + F PN+   +TGG+DG + +W+L  + K ++  K  ++++++L C E+ L +A SDDSF
Sbjct: 231 LAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKL-DDTIMKLCCTEDYLVIAVSDDSF 289

Query: 302 KTNAVIDSNLELEPSRIYV 320
           KT AV   ++EL PS IY+
Sbjct: 290 KTCAV-PQDIELHPSAIYI 307

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 132/290 (45%), Gaps = 31/290 (10%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSV-AQLNIQGRQFIYAGSVDGQLLSVDLE 87
           S+DG + ++     + Q     + QYE +   +  + ++ G + I +G  D  +   D+ 
Sbjct: 55  SWDGKVRIWDAQNGVPQG----KAQYEHNGPVLCTRWSLDGAR-IASGGCDNTVKLYDVA 109

Query: 88  NSLFVKV----DQIESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYK 143
           +    ++    D ++S   + C   + + ++ GSWD +I   + +      T+ +P   +
Sbjct: 110 SGQSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPITTIAMP---E 166

Query: 144 KCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQI---FQIRDSQLTPEGDGF 200
           + + +  +   L++ T +  IAI  L   PTT   I  S Q    +Q R      EGDG+
Sbjct: 167 RVYTMDNKQQLLVVGTAERHIAIINL-ANPTT---IFKSSQSPLKWQTRVVACYNEGDGY 222

Query: 201 VCTGIDGRVSVEYFDDTSKR---FAFRCHKYDLDDTV-------MTYPINAIRFIPNTSE 250
               ++GR +++Y DD +++   F+F+CH+    +         + YP+N+I F P    
Sbjct: 223 AIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAFHPIYGT 282

Query: 251 FYTGGSDGCVSAWHLHKKTKIKQLPKYNEN-SVVQLACNENILCVATSDD 299
           F T G DG    W  +++ ++K  P    +  V     N +IL  A S D
Sbjct: 283 FVTAGGDGSFHFWDKNQRHRLKGFPSMQGSIPVCNFNRNGSILAYAVSYD 332

>KLLA0E20779g complement(1841092..1842207) similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2 required for
           nuclear pore complex structure and function, start by
           similarity
          Length = 371

 Score = 81.3 bits (199), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 116/274 (42%), Gaps = 39/274 (14%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVA-QLNIQGRQFIYAGSVDGQLLSVDLE 87
           S+D  + ++ V     Q     R QY+     +  + +I G + + +G  D  L   D+ 
Sbjct: 55  SWDSKVRIWDVQSGSPQG----RAQYDHQAPVLTTRWSIDGTK-VASGGCDNVLKVFDVT 109

Query: 88  NSLFVKVDQ----IESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEY- 142
                ++ Q    ++S   +SC   + + +  GSWD ++   + +S     TL++P    
Sbjct: 110 TGQAQQIGQHNSAVQSLRFVSCGPTNQECIATGSWDKTVKYWDLRSPQPIMTLQMPERVY 169

Query: 143 -----KKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEG 197
                +K   + +    + +  +     IFK  L+P            +Q R      EG
Sbjct: 170 CMDASQKLMVVGMAERHIAVIDLNNPGQIFKTSLSPLK----------WQTRSISCYNEG 219

Query: 198 DGFVCTGIDGRVSVEYFDDTSKR---FAFRCHKYDLDDT----------VMTYPINAIRF 244
           +GF    I+GR +V+Y D+  +R   F+F+CH+  + +           V  YP+N+I F
Sbjct: 220 NGFAIGSIEGRCAVQYIDEQEQRKDGFSFKCHRQQVQNNGAAGGRTSTEVQVYPVNSIVF 279

Query: 245 IPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYN 278
            P    F T G DG    W  + + ++K  PK N
Sbjct: 280 HPIHGTFATAGGDGSFHFWDKNHRHRLKGFPKLN 313

>Scas_510.5
          Length = 362

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 124/285 (43%), Gaps = 22/285 (7%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLEN 88
           S+DG + ++ V   + Q     R QYE +   ++         + +G  D  +   D+ +
Sbjct: 54  SWDGKVRIWDVQGGVAQG----RSQYEHAGPVLSTRWSNDGSKVASGGCDNIVKLFDVAS 109

Query: 89  SLFVKVDQ----IESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKK 144
               ++      +++   ++C   + + ++ GSWD SI   + +      T+ +P    +
Sbjct: 110 GQSQQIGMHDAPVKAVRFVNCGPSNTECLVTGSWDKSIKYWDMRQPQAISTVIMPD---R 166

Query: 145 CFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTG 204
            + +  +   L++ T +  IAI  L   P +      S   +Q R      EGDG+    
Sbjct: 167 VYTMDSKQQLLVVGTAERHIAIINLN-NPGSIFKTTLSPLKWQTRVVSCYNEGDGYAIGS 225

Query: 205 IDGRVSVEYFDDTSKR---FAFRCHKYDLDDTV------MTYPINAIRFIPNTSEFYTGG 255
           I+GR ++ Y DD  ++   F+F+CH+ +  +        + YP+N+I F P    F T G
Sbjct: 226 IEGRCAIRYVDDEMQKKSGFSFKCHRQNNPNRTAGSQQSLVYPVNSIAFHPIYGTFATAG 285

Query: 256 SDGCVSAWHLHKKTKIKQLPKYNEN-SVVQLACNENILCVATSDD 299
            DGC   W  + + ++K  P    +  VV    N ++   A S D
Sbjct: 286 GDGCFHFWDKNHRHRLKAFPSLRSSIPVVNFNRNGSVFAYALSYD 330

>YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear pore
           protein required for poly(A)+ RNA export, has WD (WD-40)
           repeats, functions in the nuclear export of the small
           ribosomal subunit [1098 bp, 365 aa]
          Length = 365

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 115/261 (44%), Gaps = 22/261 (8%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLEN 88
           S+DG + ++ V   + Q     R Q+ESS   +          + +G  D  L   D+ +
Sbjct: 56  SWDGKVRIWDVQNGVPQG----RAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIAS 111

Query: 89  SLFVKVDQ----IESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKK 144
               ++      I+    + C   + + ++ GSWD +I   + +      T+ +P   ++
Sbjct: 112 GQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMP---ER 168

Query: 145 CFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTG 204
            + +  +   L+++T +  IAI  L   PTT      S   +Q R      E DG+    
Sbjct: 169 VYSMDNKQSLLVVATAERHIAIINL-ANPTTIFKATTSPLKWQTRCVACYNEADGYAIGS 227

Query: 205 IDGRVSVEYFDDTSKR---FAFRCHKYDLDDTV-------MTYPINAIRFIPNTSEFYTG 254
           ++GR S+ Y DD  ++   F+F+CH+    +         + YP+N+I F P    F T 
Sbjct: 228 VEGRCSIRYIDDGMQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTA 287

Query: 255 GSDGCVSAWHLHKKTKIKQLP 275
           G DG  + W  +++ ++K  P
Sbjct: 288 GGDGTFNFWDKNQRHRLKGYP 308

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 117/276 (42%), Gaps = 24/276 (8%)

Query: 28  VSYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLE 87
            ++D T+ ++ V   + Q     R QYE     +          + +G  D  L   D+ 
Sbjct: 52  AAWDNTVRIWDVQNGMTQG----RAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVA 107

Query: 88  NSLFVKVDQIESSAG----ISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYK 143
           +    ++   +S+      + C   + + ++ GSWD +I   + +      T+ +P   +
Sbjct: 108 SGQAQQIGSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQPISTVAMP---E 164

Query: 144 KCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCT 203
           + + L  +   L++ T +  I +  L   P        S   +Q R      EG+GF   
Sbjct: 165 RVYALDSKQKLLVVGTAERHIVVIDLN-NPAQVFRTSMSPLKWQTRTVACYIEGNGFAIG 223

Query: 204 GIDGRVSVEYFDDTSKR---FAFRCHKYD------LDDTVMTYPINAIRFIPNTSEFYTG 254
            ++GR +++Y D+  +R   F+F+CH+             + YP+N+I F P    F T 
Sbjct: 224 SVEGRCAIQYVDEQEQRKNGFSFKCHRQQQPASGRASSESLVYPVNSIVFHPQYGTFATA 283

Query: 255 GSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNEN 290
           G DG  + W  +++ ++K  P  N +  V   CN N
Sbjct: 284 GGDGSCNFWDKNQRHRLKGFPSMNASIPV---CNFN 316

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 113/264 (42%), Gaps = 25/264 (9%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLEN 88
           S+D  + ++ V+  + Q     R QYE     +          + +G  D  +   D+++
Sbjct: 55  SWDNKVRIWDVNGGMAQG----RAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQS 110

Query: 89  SLFVKVDQIESSAG----ISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKK 144
               +V   +S+      I C   + + ++ GSWD +I   + +      TL +P    +
Sbjct: 111 GQAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMRQPQPVSTLMMPD---R 167

Query: 145 CFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTG 204
            + +  +   L+++T +  IAI  L   P T      S   +Q R      EG+G+    
Sbjct: 168 VYAMDSKQKLLVVATAERHIAIIDLN-NPATIFKTATSPLKWQTRSVSCYIEGNGYAIGS 226

Query: 205 IDGRVSVEYFDDTSKR---FAFRCHKYDLDDTVMT----------YPINAIRFIPNTSEF 251
           I+GR +++Y D+  +R   F+F+CH+     T             YP+N+I F P    F
Sbjct: 227 IEGRCAIQYVDEQEQRKSGFSFKCHRQQQQSTGTAGGRSNTESHVYPVNSIVFHPVYGTF 286

Query: 252 YTGGSDGCVSAWHLHKKTKIKQLP 275
            T G DG    W  +++ ++K  P
Sbjct: 287 ATAGGDGSFHFWDKNQRHRLKGFP 310

>Kwal_27.10785
          Length = 367

 Score = 71.6 bits (174), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 117/289 (40%), Gaps = 26/289 (8%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLEN 88
           S+D  + V+ V+    Q     R +Y+     +A         I +G  D  ++  D+ +
Sbjct: 55  SWDKKVRVWDVNGGQAQC----RAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVSS 110

Query: 89  SLFVKVDQ----IESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKK 144
               +V      ++S   + C   + + ++ GSWD +I   + +      TL +P   ++
Sbjct: 111 GQSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLRQPQPVSTLAMP---ER 167

Query: 145 CFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTG 204
            + +  +   L++ T +  I +  L   P        S   +Q R      EG+G+    
Sbjct: 168 VYTMDSKQKLLVVGTAERHIVVIDLN-NPAAIFKTTTSPLKWQTRSVSCYIEGNGYAVGS 226

Query: 205 IDGRVSVEYFDDTSKR---FAFRCHKYDLDDT----------VMTYPINAIRFIPNTSEF 251
           I+GR +++Y DD  +R   F+F+CH+     T             YP+N+I F P    F
Sbjct: 227 IEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTGAAGGRSSTESQVYPVNSIVFHPIYGTF 286

Query: 252 YTGGSDGCVSAWHLHKKTKIKQLPKYNEN-SVVQLACNENILCVATSDD 299
            T G DG    W  + + ++K  P       V     N +I   A S D
Sbjct: 287 ATAGGDGSFHFWDKNLRHRLKGFPSLKATIPVCNFNRNGSIFAYALSYD 335

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 29/61 (47%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVA 295
           T P+ A+   P+     TG  DG +  W +    +IKQ+  + +N +  +  N+   C+ 
Sbjct: 679 TSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLV 738

Query: 296 T 296
           T
Sbjct: 739 T 739

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNE--NILC 293
           T P+ + +  P+     TG  DG +  W +    +IKQ+  + +N+V  L+ N+  N+L 
Sbjct: 659 TAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLI 718

Query: 294 VATSDDSFKTNAVIDSNLELEP 315
              +D S +   V     E  P
Sbjct: 719 SGGADHSVRVWDVKHGTTEQGP 740

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 116/294 (39%), Gaps = 47/294 (15%)

Query: 28  VSYDGTLSVYTVDRELKQVNLTVR--LQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVD 85
           +S DG L     + ELK  NLT +  ++  S   ++    + G   +  G+  G+L   D
Sbjct: 391 ISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFD 450

Query: 86  LENSLFVKVDQIESSAGISC-IAMHGDRVIAGS-------WDGSI---YVVNPKSNSL-- 132
           L +S  +   +  ++A  S  +  +G R++ GS       WD  +    V   K   +  
Sbjct: 451 LASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQ 510

Query: 133 -----EFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQ 187
                + TLEL  +     K+S +   L +S +   + +F      + K ++   G    
Sbjct: 511 LKLVHDTTLELTDDIL-AVKISSEDRYLAVSLLDNTVKVF---FFDSLKFYLSLYGHKLP 566

Query: 188 IRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHK--YDLDDTVMTYPINAIRFI 245
           +     + +    + +  D  + +   D     F   CHK  +   D++M     ++RF 
Sbjct: 567 VLSIDFSVDSKMLITSSADKNIKIWGVD-----FG-DCHKSIFAHQDSIM-----SVRFE 615

Query: 246 PNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDD 299
            +T  F++ G DG V  W   K   I++L  +             + C+A S D
Sbjct: 616 ADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGH----------QSEVWCIAVSPD 659

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 225 CHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSV-V 283
           C +Y+   T  T PIN I + P+++   +G  D  V   HL +  ++ +L  ++   + V
Sbjct: 47  CARYE---TTHTEPINDICWSPDSACVASGSEDFTVEITHL-EYGRLHKLRGHSAPVLSV 102

Query: 284 QLACNENILCVATSDDSFKTNAVIDSNL 311
              C  N+LC A+ D+S K   V+   L
Sbjct: 103 VFNCKGNLLCTASVDESIKQWDVLSGTL 130

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 254 GGSDGCVSAWHLHKKTKIKQLPKYNENS-VVQLACNENILC 293
           GG DG +  W+   K   + L   +E+S V+ ++C E ++C
Sbjct: 259 GGEDGNICVWNAQSKAVAQTLKGQHEDSPVIAVSCKETLVC 299

>Kwal_27.12053
          Length = 755

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNE--NILC 293
           T P+ +    P+     TG  DG ++ W +    ++KQ+  + +N+V  L+ ++  ++L 
Sbjct: 608 TAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLI 667

Query: 294 VATSDDSFKTNAVIDSNLE 312
              +D S +   V  S  E
Sbjct: 668 SGGADHSVRVWDVKKSTAE 686

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNE--NILC 293
           T P+ +I   P+     TG  DG ++ W +    ++KQ+  + +N++  L+ ++  N+L 
Sbjct: 651 TAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLI 710

Query: 294 VATSDDSFK 302
              +D + +
Sbjct: 711 SGGADHTVR 719

>Scas_631.17
          Length = 474

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 238 PINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYN 278
           PI ++ + P+     TGG DG ++ W + K T+  +L  +N
Sbjct: 361 PIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHN 401

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 42/101 (41%), Gaps = 3/101 (2%)

Query: 68  GRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNP 127
           G  F    SV       D  N   + V + E+ + ISC+A H   V AG +   I V   
Sbjct: 51  GTTFYIVTSVGKTFQIYDANNLHLLFVSEKETQSNISCLATHFHHVFAG-FGNKIGVY-- 107

Query: 128 KSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFK 168
           K   LEF +ELP E      L V    L  +T    + ++K
Sbjct: 108 KRGRLEFCIELPEEDDIVEHLCVFGDYLCAATSNNAVYVYK 148

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 9/56 (16%)

Query: 238 PINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILC 293
           PI  + + PN  +  TGG DG ++ W + K+         +E  + Q+  + NI+ 
Sbjct: 351 PIYTVAWSPNGYQVATGGGDGIINVWDIRKR---------DEGQLNQILAHRNIVT 397

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 246 PNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATS 297
           P+ S F + G DG +  W+L++KT +  L   +E   V  + N   L  AT+
Sbjct: 221 PDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAFSPNRYWLTAATA 272

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 246 PNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNE--NILCVATSDDSFK 302
           P+     TG  DG +  W +    +IKQ+  + +++V  L+ N+  NIL    +D S +
Sbjct: 678 PDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVR 736

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 32.3 bits (72), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 239 INAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSV--VQLACNENILCVAT 296
           INA+R+ P+ S+F +   D  +  W       IKQ+   ++     +QL    N     +
Sbjct: 308 INALRYFPDGSKFISSSDDKSIRIWENQINIPIKQISDTDQYPAPWIQLHPEHNQFAAQS 367

Query: 297 SDDS 300
            D+S
Sbjct: 368 MDNS 371

>Scas_713.50
          Length = 983

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 111/294 (37%), Gaps = 36/294 (12%)

Query: 28  VSYDGTLSVYTVDRELKQVNLTVRL---QYESSLTSVAQLNIQGRQFIYAGSVDGQLLSV 84
           +S D  L     +  LK  NL  +L    +E       +  + G   +  G+  G+L   
Sbjct: 437 ISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKF-LPGGMLVIIGTRAGELQLF 495

Query: 85  DLENSLFVKVDQIESSAGISCIAM--HGDRVIAGSWDGSIYVVNPK-------SNSLEFT 135
           DL +S  +   +    A I  + +   G R+I GS D S+   N +         S +F 
Sbjct: 496 DLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFV 555

Query: 136 LELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIF--------Q 187
            +L   +    +LS     + +S     +A+    L  T K   LDS + F         
Sbjct: 556 PKLGLHHDTTLELSDDILSVRVSPEDKFLAVS--LLDNTVKVFFLDSMKFFLSLYGHKLP 613

Query: 188 IRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHK--YDLDDTVMTYPINAIRFI 245
           +    ++ +    + +  D  + +   D     F   CHK  +   D++M      ++F+
Sbjct: 614 VLSIDISFDSKMIITSSADKNIKIWGLD-----FG-DCHKSLFAHQDSIMN-----VKFV 662

Query: 246 PNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVATSDD 299
           P +  F++   DG +  W   K   I++L  +          N+    V++S D
Sbjct: 663 PESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHD 716

>Kwal_23.5351
          Length = 474

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 238 PINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYN 278
           PI  + + PN     TG  DG V  W + K  K   +  +N
Sbjct: 357 PIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHN 397

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 31.6 bits (70), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 34/69 (49%), Gaps = 2/69 (2%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNE--NILC 293
           T P+ +    P+     TG  DG ++ W +    ++KQ+  + +N+V  L+ ++   +L 
Sbjct: 602 TAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLV 661

Query: 294 VATSDDSFK 302
              +D S +
Sbjct: 662 SGGADHSVR 670

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 13/69 (18%)

Query: 204 GIDGRVSV-EYFDDTSKRFAFR--CHKYDLDDTVMTYPINAIRFIPNTSE--FYTGGSDG 258
           G DG ++V E  D   K FA R  CH          Y IN ++++    +    TGG DG
Sbjct: 268 GADGVLAVYEEVDGEWKVFAKRALCHG--------VYEINVVKWLELNGKTILATGGDDG 319

Query: 259 CVSAWHLHK 267
            V+ W L K
Sbjct: 320 IVNFWSLEK 328

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 84/218 (38%), Gaps = 34/218 (15%)

Query: 66  IQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAM--HGDRVIAGS------ 117
           + G   +  G+  GQL   DL +S  ++  +   +A I  + +   G R++  S      
Sbjct: 433 LPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVK 492

Query: 118 -WD---------GSIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIF 167
            WD         G++    PK   +  T     E   C K+S +   L +S +   + +F
Sbjct: 493 FWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRFLAVSLLDNTVKVF 552

Query: 168 KLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHK 227
            L    + K  +   G    +    ++ +    + +  D  + +   D     F   CHK
Sbjct: 553 FLD---SMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLD-----FG-DCHK 603

Query: 228 --YDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAW 263
             +   D++M      ++F+P +  F++   DG V  W
Sbjct: 604 SLFAHQDSIMN-----VKFLPESHNFFSCSKDGTVKYW 636

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 24/49 (48%)

Query: 222 AFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTK 270
           A R  +   +     Y I A+  +P ++ F++G  +G +  W LH+  +
Sbjct: 476 AVRTQQAQGNRLAQPYWITALHAVPYSNVFFSGSWNGTMKVWKLHENMR 524

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNEN-SVVQLACNENILCV 294
           T  ++++ F P  +   + G D  V  W L K+T IKQ  + N+   +V+   N N+   
Sbjct: 253 TNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGA 312

Query: 295 A 295
           A
Sbjct: 313 A 313

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 193 LTPEGDGFVCT-GIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPNTSE- 250
           ++   DG + + G DG ++V Y +  + R+     + D   TV  Y IN ++++      
Sbjct: 254 VSWSADGLIASVGSDGVLAV-YKEVQAGRWEV-VARVDCAHTV--YEINVVKWLALDGRV 309

Query: 251 -FYTGGSDGCVSAWHLHKK 268
              TGG DGCV+ W L ++
Sbjct: 310 LLVTGGDDGCVNVWELREE 328

>Scas_721.32
          Length = 822

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLA-CNE-NILC 293
           T P+      P+     TG  DG ++ W +    ++K +  + +N++  L+ C E N+L 
Sbjct: 675 TAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLV 734

Query: 294 VATSDDSFKTNAVIDSNLELEP 315
              +D S +   +  S  E  P
Sbjct: 735 SGGADHSVRVWDLKKSTAEPGP 756

>Scas_619.9
          Length = 725

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 66/150 (44%), Gaps = 14/150 (9%)

Query: 72  IYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNS 131
           IY  S + +L S+ L+NSL V V  + + +  S +     RV+A  W+  I  VNP + S
Sbjct: 343 IYTKSKNVELNSIFLKNSLLVAVANLPADSRASRLK----RVMA-VWNSLIKPVNPNAAS 397

Query: 132 LEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRD- 190
               ++  +E +   +L +     + ST+K    + +  LT      I D  + F +++ 
Sbjct: 398 YAALIKAVNESRNLDELKIIWKNDIPSTVKEDAIVKEAYLTAI----INDPAEKFNVKEL 453

Query: 191 ----SQLTPEGDGFVCTGIDGRVSVEYFDD 216
                 L+      +    D  V+ E FD+
Sbjct: 454 PENIQSLSLINAILIKLAADSEVTKESFDE 483

>KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces
           cerevisiae YMR146c TIF34 translation initiation factor
           eIF3, p39 subunit singleton, start by similarity
          Length = 347

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 93/244 (38%), Gaps = 49/244 (20%)

Query: 32  GTLSVYTVDRELKQVNLTVRLQYESSLTS--------VAQLNIQGRQFIYAGSVDGQLLS 83
           G++ VY++ R      + V+ + +  +T+        VA  +  G+ +I AG  DGQ+ +
Sbjct: 120 GSIVVYSLIRNENGEIVNVKEEPDYEITTIEQATKVFVASWSYNGK-YIIAGHEDGQISA 178

Query: 84  VDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYK 143
              EN  FV+  +I   + I  I    DR          Y +    +S+   +++ +   
Sbjct: 179 YYGENGEFVQAKKIHEKS-IKDIQFSPDRT---------YFITSSRDSVASLVDVDT--- 225

Query: 144 KCFKLSVQAHKLLISTIKCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCT 203
             F++        + T K    +    +TP  +  IL  GQ    +D   T   +G    
Sbjct: 226 --FEV--------LKTYKADCPLNSASITPLKEFVILGGGQ--DAKDVTTTSAREG---- 269

Query: 204 GIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAW 263
             + R+  + F D   R                 P+N +   P  + + +GG DG +   
Sbjct: 270 KFEARIYHKVFQDEIGRVKGHFG-----------PLNYVAVSPTGTSYASGGEDGYIRLH 318

Query: 264 HLHK 267
           H  K
Sbjct: 319 HFDK 322

>Kwal_56.24526
          Length = 1210

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNEN-SVVQLACNENILCV 294
           T  ++++ F P+ +   + G D  V  W L K+T +KQ  + N+   +V+   N N+   
Sbjct: 253 TNNVDSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGA 312

Query: 295 A 295
           A
Sbjct: 313 A 313

>Scas_702.16
          Length = 816

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 52/131 (39%), Gaps = 11/131 (8%)

Query: 188 IRDSQLTPEGDGFVCTGIDGRVSVEYFDDTS-------KRFAFRCHKYDLDDTVMTYPIN 240
           I D Q TP+G     T +D  +++  F+D         ++   + H+Y +D   + +P +
Sbjct: 347 ITDMQWTPDGTMLFLTSLDSSITILVFEDNELGKIIPLEKNIEQLHRYGVDKDSLDFPES 406

Query: 241 AIRFI-PNTSEFYTGGSDGCVSAWHLHKKTKIKQLP-KYNENSVVQLACNE--NILCVAT 296
             + I   T            S   L +K     LP K ++ S  +L  NE  NIL    
Sbjct: 407 VEQLIFEETVNKLKKPKLSSTSNLQLQEKKPDSLLPAKSSKGSESRLLTNETINILIPKR 466

Query: 297 SDDSFKTNAVI 307
             D    N ++
Sbjct: 467 KKDGKPNNKIV 477

>Kwal_26.8975
          Length = 445

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 22/109 (20%)

Query: 29  SYDGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLL-----S 83
           SYDG +  + +  ++++       QY     +V  +       + +G+ D  L      +
Sbjct: 119 SYDGIVRTWNLSGKVEK-------QYAGHSGAVRAVKYISSTRLVSGANDRTLRLWKTKN 171

Query: 84  VDLENSLFVKVDQIESSAGISCIAMH----------GDRVIAGSWDGSI 122
            +L+N+L  + D +E    ++ +  H          GDR+I+GS+D SI
Sbjct: 172 DELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSI 220

>YNR043W (MVD1) [4626] chr14 (701894..703084) Mevalonate diphosphate
           (MVAPP) decarboxylase (MVA-5-pyrophosphate
           decarboxylase) [1191 bp, 396 aa]
          Length = 396

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 18/96 (18%)

Query: 196 EGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYD--LDDTVMTYPINAIRFIPNTSEFYT 253
           + + F  T +D    + Y +DTSKR    CH  +    +T++ Y  +A    PN   +Y 
Sbjct: 256 DSNSFHATCLDSFPPIFYMNDTSKRIISWCHTINQFYGETIVAYTFDA---GPNAVLYYL 312

Query: 254 GGSD-----------GCVSAWHLHKKTKIKQLPKYN 278
             ++           G V  W   KK   +QL  +N
Sbjct: 313 AENESKLFAFIYKLFGSVPGW--DKKFTTEQLEAFN 346

>Scas_629.11
          Length = 400

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 196 EGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYD--LDDTVMTYPINAIRFIPNTSEFYT 253
           + + F  T +D    + Y +DTSK+    CH  +    +T++ Y  +A    PN   +Y 
Sbjct: 257 DSNSFHATCLDSFPPIFYMNDTSKKIIKLCHLINEFYKETIVAYTFDA---GPNAVLYYL 313

Query: 254 GGSDGCVSAWHLHKKTKIKQL-PKYNENSVVQLA 286
             ++G + A+  H   K++    KY+++ + Q +
Sbjct: 314 EENEGKLFAFVYHLFNKVEGWEKKYSQDQLNQFS 347

>Kwal_27.11550
          Length = 407

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 38/101 (37%), Gaps = 13/101 (12%)

Query: 171 LTPTTKPHILDSGQIFQIRDSQLTPE-GDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYD 229
           L   T+PH  D G I Q        +   GF+ TG       E      K   F     D
Sbjct: 224 LEEPTEPHPKDFGDIRQSWGCDYVVDVYPGFIATGKSQEGQGEV-----KLIPFTGEDLD 278

Query: 230 LDDTVM---TYPINAIR--FIPNTSE--FYTGGSDGCVSAW 263
           LD  V     +    +R   +P   E   YT G DGCV+AW
Sbjct: 279 LDSAVTIPSAHGDEVVRDVLVPFQHEDMLYTCGEDGCVNAW 319

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 7/118 (5%)

Query: 31  DGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLENSL 90
           D T+ V+++ +++   N T++      +  V    +Q + ++   S DG +   D +   
Sbjct: 162 DHTIKVWSIGQDVP--NFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTK- 218

Query: 91  FVKVDQIESS-AGISCIAMHGDR--VIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKC 145
              V  +E   A +S    H     +I+GS DG++ + N  +  LE TL +  E   C
Sbjct: 219 -SNVATLEGHMANVSYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLNIGLERSWC 275

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/41 (24%), Positives = 21/41 (51%)

Query: 238 PINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYN 278
           PI ++ +  N  +  +G  DG +  W + KK  ++ +  +N
Sbjct: 349 PIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHN 389

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 29.6 bits (65), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 236 TYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLACNENILCVA 295
           T  ++++ F P+ +   + G D  +  W L K+T +KQ  + N+   + +A + +I    
Sbjct: 253 TNNVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWL-IAAHPHINLFG 311

Query: 296 TSDDS 300
            + DS
Sbjct: 312 AAHDS 316

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 80/189 (42%), Gaps = 22/189 (11%)

Query: 96  QIESSAGISCIAM--HGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAH 153
           Q+ S+  IS +    +G+ V +GSW+G + +++  SN+LE T  L +   K   ++  ++
Sbjct: 208 QVVSTRPISTVTFCNNGNYVASGSWNGEVSIID--SNTLEVTQTLQNHDGKVGGIAWTSN 265

Query: 154 -KLLISTIKCKIAIFKLPLTPTTKPHILDS----GQIFQIRDSQLTPEGDGFVCTGIDGR 208
             +LI+  +  +    + ++  +    + S    G   +I D Q+ P G  F+ T     
Sbjct: 266 DSVLITGGEDHL----ITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGK-FIGT----- 315

Query: 209 VSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKK 268
                FD T + +     K  L     +  +  + F  + +   T G+D     W L   
Sbjct: 316 ---SSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSG 372

Query: 269 TKIKQLPKY 277
             + QL  +
Sbjct: 373 KAVSQLQGH 381

>Scas_680.11
          Length = 347

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 44/222 (19%), Positives = 87/222 (39%), Gaps = 42/222 (18%)

Query: 73  YAGSVDGQLLSVDLENSLFVK-----VDQIESSAGISCI-----AMHGDRVIAGSWDGSI 122
           Y GS++   L  + E +  ++     + +IE+  G+S       +  G  +IA   +G +
Sbjct: 118 YPGSINIYQLKRNPETNEIIEFVEEPIHKIETQEGLSAAVSADWSTEGKFIIAAHKEGEV 177

Query: 123 --YVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIK-CKIAIFKLPLTPTTKPHI 179
             Y V+   N L+F              S++ HK LI+ ++      + +  +  +  HI
Sbjct: 178 SKYDVD---NGLQFVE------------SIKLHKALITDLQFSPDRTYFITSSRDSHAHI 222

Query: 180 LDSGQIFQIRDSQL---------TPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDL 230
           +D   +  ++D ++         TP  +  +  G      V     +  +F  R H    
Sbjct: 223 VDVETLAVLKDFEIDCPLNTACITPLKEFVILGGGQDARDVTTTSASEGKFEARFHHKIF 282

Query: 231 DDTVMTY-----PINAIRFIPNTSEFYTGGSDGCVSAWHLHK 267
           ++ +        P+N +   P  + + +GG DG V   H  K
Sbjct: 283 EEEIGRVKGHFGPLNCVAVSPQGTSYVSGGEDGLVRLHHFEK 324

>Sklu_2416.2 YOL138C, Contig c2416 613-4674 reverse complement
          Length = 1353

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 25/98 (25%)

Query: 236 TYPINAIRF-IPNTSEFYTGGSDGCVSAWHLHKKTK------------------IKQLPK 276
           T  IN++ F +  T+   +GG DGC+  W L    +                  IK +P 
Sbjct: 229 TRSINSVDFNMSQTNLLISGGQDGCIKVWDLRSSQRSTNRSDININTGSDSIRDIKWMPS 288

Query: 277 YNENSVVQLACNENILCVATSDDSFKTNAVIDSNLELE 314
           Y+       A N+       S+  FK  ++ DS L L+
Sbjct: 289 YD------FATNDVNNSNGISNRGFKFASIHDSGLLLK 320

>Kwal_33.15475
          Length = 783

 Score = 29.3 bits (64), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 239 INAIRFIPNTSEFYTGGSDGCVSAWHLHKK----TKIKQLPKYNENSVVQLACNENILCV 294
           +  ++F+P T+   +   D  V  W   +K     K  Q+  ++++++  L+   NIL V
Sbjct: 59  VTCVKFVPGTNLMVSSSEDSQVRLWAFEEKDQDALKCVQVIDHHKHTITSLSVISNILSV 118

Query: 295 ATSDDS 300
             +D S
Sbjct: 119 GCADGS 124

>KLLA0F02497g complement(226225..228498) weakly similar to sp|P39732
           Saccharomyces cerevisiae YAL031c FUN21 hypothetical
           protein singleton, hypothetical start
          Length = 757

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 43/103 (41%), Gaps = 23/103 (22%)

Query: 129 SNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFKLP------------------ 170
           S ++E  +EL S+++ C      A  L +ST   K+ +  +P                  
Sbjct: 78  SAAIEKRIELLSQFRSC---KANATNLPLSTTSLKLEVDLVPVEEDSVLFVSKFYNKELQ 134

Query: 171 --LTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSV 211
             L  T +    DS QI+Q R  QLT E +    T + GR ++
Sbjct: 135 SQLLTTLQRVAEDSLQIYQARIRQLTMERNSNRPTDLSGRTTI 177

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 28.9 bits (63), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 30/77 (38%), Gaps = 9/77 (11%)

Query: 187 QIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIP 246
            I  +Q  P G GF+ + ID R+ +      ++   F  H   ++D  M         + 
Sbjct: 160 HITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAM---------VD 210

Query: 247 NTSEFYTGGSDGCVSAW 263
               F +  SDG +  W
Sbjct: 211 RGRNFVSASSDGSLKLW 227

>YPL009C (YPL009C) [5428] chr16 complement(535815..538931) Protein
           of unknown function, has moderate similarity to
           uncharacterized C. albicans Ypl9p [3117 bp, 1038 aa]
          Length = 1038

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 49  TVRLQYESSLTSVAQLNIQGRQ 70
            V+ +YES +T + QLNIQG++
Sbjct: 187 AVQAKYESDITVIKQLNIQGKE 208

>KLLA0F10285g complement(952632..953825) similar to sp|P32377
           Saccharomyces cerevisiae YNR043w MVD1 mevalonate
           pyrophosphate decarboxylase singleton, start by
           similarity
          Length = 397

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 196 EGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYD--LDDTVMTYPINAIRFIPNTSEFYT 253
           + + F  T +D    + Y +DTSK+    CH  +   ++TV+ Y  +A    PN   +Y 
Sbjct: 256 DSNSFHATCLDSYPPIFYLNDTSKKVIKLCHAINEFYNETVVAYTFDA---GPNAVLYYL 312

Query: 254 GGSDGCVSAWHLH 266
             S+  + A+  H
Sbjct: 313 EQSEDKLFAFLYH 325

>YIR039C (YPS6) [2703] chr9 complement(430494..432107) Yapsin 6,
           GPI-anchored aspartyl protease [1614 bp, 537 aa]
          Length = 537

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 11/84 (13%)

Query: 177 PHILDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMT 236
           P +LDSG  F    +++       +    DG  S    DD  + + F C K  ++DT+++
Sbjct: 320 PVMLDSGTTFSYLPTEIAEA----IGKSFDGEYSS---DD--QGYIFDCSK--VNDTLLS 368

Query: 237 YPINAIRFIPNTSEFYTGGSDGCV 260
                     N S F T   D CV
Sbjct: 369 VDFGGFNISANISNFVTSAKDRCV 392

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 9/125 (7%)

Query: 31  DGTLSVYTVDRELKQVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLENSL 90
           D T+ ++++ +E    N T+R   E  +  V     Q + ++   S D  +   D +   
Sbjct: 162 DHTVKIWSLGQETS--NFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKS 219

Query: 91  FVKVDQIESSAGISCIAMHG--DRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKCFKL 148
            V   +   S  +S    H     +I+GS DG++ + N  +  LE TL L  E   C   
Sbjct: 220 CVATLEGHLS-NVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWC--- 275

Query: 149 SVQAH 153
            V AH
Sbjct: 276 -VAAH 279

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 31/63 (49%), Gaps = 2/63 (3%)

Query: 239 INAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSV--VQLACNENILCVAT 296
           I A+++ P+ S+F +   D  V  W       IKQ+    ++S+  + +  ++N  C  +
Sbjct: 296 ILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTAQHSMPFLNVHPSQNYFCAQS 355

Query: 297 SDD 299
            D+
Sbjct: 356 MDN 358

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 41/101 (40%), Gaps = 3/101 (2%)

Query: 68  GRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAGISCIAMHGDRVIAGSWDGSIYVVNP 127
           G  F    SV       D  N   + V   E+   I+C+A H   V A S+   + +   
Sbjct: 47  GTTFYIVTSVGKSFQIFDANNLHLLFVSDKETEGDITCLAAHFHYVYA-SFKNKVGIY-- 103

Query: 128 KSNSLEFTLELPSEYKKCFKLSVQAHKLLISTIKCKIAIFK 168
           K   LE  +ELP       K++V    L+ ST    + I+K
Sbjct: 104 KRGKLEHLIELPDPNTVVTKINVFGEYLIASTDNNVVYIYK 144

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 20/133 (15%)

Query: 188 IRDSQLTPEGDGFVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPN 247
           IR   ++P+G+ F     DG V +   D    +  F  H+         Y   +++F+PN
Sbjct: 181 IRHLDISPDGETFASCSNDGTVKINDMDGNILK-TFTGHES------FVY---SVKFLPN 230

Query: 248 TSEFYTGGSDGCVSAWHLHKKTKIKQLPKYNENSVVQLAC--NENILCVATSDDSFKTNA 305
             +  + G D  V  W   K   +KQ+ +    S+  L    N +IL V +SD+  +   
Sbjct: 231 -GDLVSCGEDRSVRVW--SKTGAVKQVLRLPAVSIWDLDILPNGDIL-VGSSDNMVRIFT 286

Query: 306 V----IDSNLELE 314
           V    I SN +LE
Sbjct: 287 VEESRIASNSKLE 299

>Scas_605.18
          Length = 424

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 9/72 (12%)

Query: 200 FVCTGIDGRVSVEYFDDTSKRFAFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGC 259
           F   G DG     Y  DT  R +    K+   DT     +NAI+F  + +   TGG DG 
Sbjct: 243 FASCGSDGYT---YIWDT--RTSAAVQKFFASDT----DVNAIQFFKDGNSIVTGGDDGV 293

Query: 260 VSAWHLHKKTKI 271
           ++ + L     I
Sbjct: 294 INMFDLRSDCAI 305

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,027,179
Number of extensions: 423063
Number of successful extensions: 1429
Number of sequences better than 10.0: 71
Number of HSP's gapped: 1387
Number of HSP's successfully gapped: 74
Length of query: 320
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 218
Effective length of database: 13,065,073
Effective search space: 2848185914
Effective search space used: 2848185914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)