Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H07953g1831809361e-131
YGL231C1901795182e-67
Scas_712.201861814671e-59
AFR249W1811754531e-57
Kwal_47.192101811684494e-57
KLLA0A01067g2021763185e-37
Sklu_2433.1379691354e-11
Scas_653.2947073641.7
Kwal_23.569964159641.7
CAGL0M11154g99058642.2
YMR306W (FKS3)178526633.1
YCL004W (PGS1)52134589.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H07953g
         (180 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   365   e-131
YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   204   2e-67
Scas_712.20                                                           184   1e-59
AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   179   1e-57
Kwal_47.19210                                                         177   4e-57
KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   127   5e-37
Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement      57   4e-11
Scas_653.29                                                            29   1.7  
Kwal_23.5699                                                           29   1.7  
CAGL0M11154g 1096682..1099654 similar to sp|Q12176 Saccharomyces...    29   2.2  
YMR306W (FKS3) [4260] chr13 (881158..886515) Protein with high s...    29   3.1  
YCL004W (PGS1) [533] chr3 (109104..110669) Phosphatidylglyceroph...    27   9.8  

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  365 bits (936), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 180/180 (100%), Positives = 180/180 (100%)

Query: 1   MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVNKPDIAN 60
           MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVNKPDIAN
Sbjct: 1   MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVNKPDIAN 60

Query: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120
           LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV
Sbjct: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120

Query: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIRV 180
           LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIRV
Sbjct: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIRV 180

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  204 bits (518), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 102/179 (56%), Positives = 130/179 (72%), Gaps = 7/179 (3%)

Query: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLS--GSVRDKKNTSNKQVN----KPDIAN 60
           EW ++LL+ + ++++     NT PSP G++G S  G+V  K+  +  Q      K  I  
Sbjct: 8   EWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITV 67

Query: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120
           LQVQKAW+IALQPAKSIPMN FMSYMSGTSLQIIPIMTALMLLSGP+K+IF+ R  FKPV
Sbjct: 68  LQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPV 127

Query: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIR 179
           LGN  +Q+Q+   M +Y+ FQGVLM+IG +KLN MGLIPN   DW+ WE+I  YN G++
Sbjct: 128 LGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQ 186

>Scas_712.20
          Length = 186

 Score =  184 bits (467), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 118/181 (65%), Gaps = 12/181 (6%)

Query: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKP-------DIA 59
           EW   L N +  +    S + T PSP GY    G V   KN    Q NK        ++ 
Sbjct: 7   EWAVKLCNLKEEEATDSSAIKTLPSPPGY----GVVEVGKNQHESQGNKATEAIRMKELN 62

Query: 60  NLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKP 119
           NL  QKA  IA+QPAKSIPMN  MSYMSGTSLQIIPIM ALMLLSGP+K+IF+IR  FKP
Sbjct: 63  NLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAFKP 122

Query: 120 VLGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIR 179
           VLGN + Q+Q+   M LY+ FQG LM+IG++KLN MGLIPN  SDW+ WE   DYN G +
Sbjct: 123 VLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIGRK 182

Query: 180 V 180
           V
Sbjct: 183 V 183

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  179 bits (453), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 115/175 (65%), Gaps = 1/175 (0%)

Query: 2   VSANTEEWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKPDIAN 60
           +S+    W   L+ P+ +K     + NT P P G+     S     +    + N+  I  
Sbjct: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTRSVSKEEGEANRERINA 60

Query: 61  LQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPV 120
           LQV+KAW++A QP+K+IPMNFFMSYMSGTSLQIIPIMTALMLL+GPVKS+  +R TFK +
Sbjct: 61  LQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTFKGL 120

Query: 121 LGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYN 175
           L N  +  Q+   M LYV FQ VLM IGL+KLN MGL+PNK SDW+AWE    Y+
Sbjct: 121 LNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYS 175

>Kwal_47.19210
          Length = 181

 Score =  177 bits (449), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 89/168 (52%), Positives = 115/168 (68%), Gaps = 1/168 (0%)

Query: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKPDIANLQVQKA 66
           EW +NL +P  V++    T N+ PSP G++ LS S       ++      ++A+L VQKA
Sbjct: 7   EWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEAENLASLMVQKA 66

Query: 67  WEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPVLGNPKS 126
           W+I+ QPAKSIPMN  +SYMSGTSLQII IMTALM +S P+KS+  IR TFKPV+GNP+ 
Sbjct: 67  WQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPVMGNPEV 126

Query: 127 QNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDY 174
           Q Q+   MI++V FQ +LM IG+ KLN MGLIPN  SDW+  EK   Y
Sbjct: 127 QPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIY 174

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 1   MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLS-GSVRDKKNTSNKQVNKPDIA 59
           ++S +  +W ++L   ++++    +    P P G + L     +  K   +   N+  IA
Sbjct: 22  IMSEDIPQWAKDLKVDKVMRRNSVNGGKLPDPFGIKKLEIEGQKPPKVIDHDAQNR--IA 79

Query: 60  NLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKP 119
            L  ++AW+I+ +P KS+PMN  MSYMSG SLQIIPIMTA+ML+S P+KSI  ++  F+ 
Sbjct: 80  KLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQH 139

Query: 120 VLGNPKSQN-QIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDY 174
           ++         +   MI+YV +Q +LM IGL KLN MGL P  +SDW+AW++ T+Y
Sbjct: 140 LINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEY 195

>Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement
          Length = 79

 Score = 56.6 bits (135), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 8  EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLS-GSVRDKKNTSNKQVNKPDIANLQVQK 65
          +W  +L NP+  K    ++ NT PSP G++ +S GS ++K + +NK   K DI  LQVQK
Sbjct: 7  QWATDLCNPKHAKSLTVASSNTLPSPPGFKLVSEGSSKNKNDNANKSKEK-DINGLQVQK 65

Query: 66 AWEIALQPA 74
          AWE+ALQPA
Sbjct: 66 AWELALQPA 74

>Scas_653.29
          Length = 470

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 14  LNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVNKPDIANLQVQKAWEIAL-- 71
           LN +  K W   +    SP+ ++GL     D KN      N PD  NLQ ++  + A+  
Sbjct: 124 LNKENTKYWSDYSKLIYSPKSFRGLKNWYHDIKNP-----NLPDFHNLQQRQFTDFAMGF 178

Query: 72  QPAKSIPMNFFMS 84
              KS  M+ F+ 
Sbjct: 179 DEFKSFCMDDFID 191

>Kwal_23.5699
          Length = 641

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 11/59 (18%)

Query: 65  KAWEIALQPAK-SIPMNFFMSYMSGTSLQIIPIMTALMLLS---------GPV-KSIFT 112
           K  E ALQP+K S P NFFM +  G  ++  P+     L+S         GP+  +IFT
Sbjct: 205 KNGEKALQPSKRSGPTNFFMKWYKGAEVRYEPLGVVGALVSWNYPFHNLLGPIMAAIFT 263

>CAGL0M11154g 1096682..1099654 similar to sp|Q12176 Saccharomyces
           cerevisiae YDR060w MAK21, hypothetical start
          Length = 990

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 4/58 (6%)

Query: 17  QIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVN----KPDIANLQVQKAWEIA 70
           QIV   Q    NTP  Q YQ         +    +Q +     P  AN  V   WEIA
Sbjct: 647 QIVPHIQNLLTNTPVDQEYQADEADEDSSEKAHVRQYDSRKRDPKFANADVSSLWEIA 704

>YMR306W (FKS3) [4260] chr13 (881158..886515) Protein with high
            similarity to 1,3)-beta-D-glucan synthase catalytic
            subunit (C. albicans Fks1p), which is required for cell
            wall biosynthesis, member of the 1,3-beta-glucan synthase
            component family, which are involved in fungal cell wall
            formation [5358 bp, 1785 aa]
          Length = 1785

 Score = 28.9 bits (63), Expect = 3.1,   Method: Composition-based stats.
 Identities = 14/26 (53%), Positives = 17/26 (65%)

Query: 104  SGPVKSIFTIRETFKPVLGNPKSQNQ 129
            SG  K IF IR +  P+LG+ KS NQ
Sbjct: 976  SGLRKPIFKIRLSGNPILGDGKSDNQ 1001

>YCL004W (PGS1) [533] chr3 (109104..110669)
           Phosphatidylglycerophosphate synthase, the first enzyme
           of the cardiolipin biosynthetic pathway [1566 bp, 521
           aa]
          Length = 521

 Score = 26.9 bits (58), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 19  VKEWQQSTVNTPSPQGYQ--GLSGSVRDKKNTSN 50
           ++EWQ+  VN P+   Y   G+  S RDK + +N
Sbjct: 407 LREWQRGVVNKPNGWSYHAKGIWLSARDKNDANN 440

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,897,972
Number of extensions: 226812
Number of successful extensions: 656
Number of sequences better than 10.0: 19
Number of HSP's gapped: 654
Number of HSP's successfully gapped: 19
Length of query: 180
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 85
Effective length of database: 13,307,399
Effective search space: 1131128915
Effective search space used: 1131128915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)