Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H07909g88286342350.0
Scas_712.1888288124950.0
YGL233W (SEC15)91088624780.0
Sklu_2433.1188486621330.0
AFR251C86883220690.0
KLLA0A01023g86185719290.0
Kwal_47.1921487681218960.0
CAGL0I06314g62358685.2
Kwal_23.332425490667.8
Scas_504.1307688678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H07909g
         (869 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...  1635   0.0  
Scas_712.18                                                           965   0.0  
YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...   959   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        826   0.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...   801   0.0  
KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...   747   0.0  
Kwal_47.19214                                                         734   0.0  
CAGL0I06314g 605636..607507 similar to sp|P07252 Saccharomyces c...    31   5.2  
Kwal_23.3324                                                           30   7.8  
Scas_504.1                                                             30   8.0  

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score = 1635 bits (4235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/863 (94%), Positives = 815/863 (94%)

Query: 1   MDQETKKVISKDFQXXXXXXXXXXXXXXFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60
           MDQETKKVISKDFQ              FDQENKIVGGENAKGVDIIDSTLDIDQRAIDK
Sbjct: 1   MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60

Query: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120
           WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV
Sbjct: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120

Query: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180
           ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ
Sbjct: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180

Query: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXXXXXXX 240
           ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDEC        
Sbjct: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECINLIKNSL 240

Query: 241 XXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300
                       QTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL
Sbjct: 241 NSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300

Query: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360
           EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH
Sbjct: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360

Query: 361 DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRLKPYF 420
           DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRLKPYF
Sbjct: 361 DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRLKPYF 420

Query: 421 KYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDKD 480
           KYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDKD
Sbjct: 421 KYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDKD 480

Query: 481 FQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPLYPMTCT 540
           FQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPLYPMTCT
Sbjct: 481 FQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPLYPMTCT 540

Query: 541 MTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQLL 600
           MTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQLL
Sbjct: 541 MTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQLL 600

Query: 601 INLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESXXXXXXXXXXXXX 660
           INLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAES             
Sbjct: 601 INLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESKLIDLIDTKIKDI 660

Query: 661 XETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHFL 720
            ETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHFL
Sbjct: 661 LETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHFL 720

Query: 721 DVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPTIDDESR 780
           DVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPTIDDESR
Sbjct: 721 DVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPTIDDESR 780

Query: 781 SQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILIGK 840
           SQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILIGK
Sbjct: 781 SQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILIGK 840

Query: 841 IRPITAPAPTNEAENSSVFNLDW 863
           IRPITAPAPTNEAENSSVFNLDW
Sbjct: 841 IRPITAPAPTNEAENSSVFNLDW 863

>Scas_712.18
          Length = 882

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/881 (55%), Positives = 647/881 (73%), Gaps = 21/881 (2%)

Query: 1   MDQETKKVISKDFQXXXXXXXXXXXXXXFDQENKIVGGENA---KGVDIIDSTLDIDQRA 57
           MDQE   ++S+DFQ                 + +    ENA   K + + +   ++D ++
Sbjct: 1   MDQEV--LLSQDFQKILLSYEPKKAETTTSHDKE----ENASEYKDLGMEEDAFELDPQS 54

Query: 58  IDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQ 117
            DKW+P+LR   E +QL T+I EL+ SIDDNFQGLELQLLQDSQ+NDKLETS++EI+ IQ
Sbjct: 55  FDKWVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQ 114

Query: 118 SMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSN 177
           +M++ SLS  I   Q+ LT +TNELI +KQ ++N+KKTSLKISE  IL+ KV+R+LELS+
Sbjct: 115 NMIDTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSS 174

Query: 178 KCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXXXX 237
           KCQELITEGNFFKALQNLDSLEK+YLQEFR+YNFK LKEIY SIPYLKSVTKDEC     
Sbjct: 175 KCQELITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIR 234

Query: 238 XXXXXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRK 297
                           +F+  Y++ELL KWL  ++ MKL++ KFNSP+EISMRD+ +L+K
Sbjct: 235 NSLNSNLGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKK 294

Query: 298 LELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNT---VS 354
           L LE+FF+++ F+DS+MIF+TLN+ DYL  EF+KEYEF+K+K I PL WK + N+   + 
Sbjct: 295 LNLEKFFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIP 354

Query: 355 VNSTAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMM 414
               + D F + +++ FLKEY   ILGFLLYDINLN+ TD++ V+NNYNATNEFW+ LM 
Sbjct: 355 PGDISSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMN 414

Query: 415 RLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTL 474
           RL+PY ++F+ T L  +   +EFKDF+ IYV I+ENYKL+IDPLY +++ LF++YC  ++
Sbjct: 415 RLQPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISI 474

Query: 475 ELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPL 534
             FD +F+V+L+DDDFMPLTI++K  ++KV +ICWMKE+  +    D   FS+TLPFSPL
Sbjct: 475 RYFDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPL 534

Query: 535 YPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSRE 594
           YPMTCT+ +K Y+KLTSFI+ FYRH L +LN +LVN ID I   +VNK+IRAKL++TSRE
Sbjct: 535 YPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSRE 594

Query: 595 EIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESXXXXXXX 654
           EIAQ+LINLDYF++A+K FS +MT+ NI++NPD+EI+L STK+  +SRKYAE        
Sbjct: 595 EIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLID 654

Query: 655 XXXXXXXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDS 714
                  ETV  DW   +   DPDISIVD+AQFLEMMFATTL+NLPYS+QILLIFREFDS
Sbjct: 655 SKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDS 714

Query: 715 LTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQ--TPKT 772
           LTR FLD+LL+DTP +I+ ESV NFEV++ YLEGIIP+IFP  DE E      +  TP +
Sbjct: 715 LTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLS 774

Query: 773 PTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPD 832
           P  +  +   S   I+NN+KSLE TF+EL+Q I+LL++   NEY+DP +R RKYSR+KP+
Sbjct: 775 PVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKT--GNEYMDPDLRMRKYSRVKPE 832

Query: 833 DANILIGKIR--PITAPAPTNEAEN---SSVFNLDWNGSDS 868
            ANIL+ K+R  PI +P+ T + ++   SS+F  D+NGSDS
Sbjct: 833 HANILMRKVRVTPIMSPSDTPQQQDDDSSSIFTRDFNGSDS 873

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/886 (55%), Positives = 631/886 (71%), Gaps = 29/886 (3%)

Query: 1   MDQETKKVISKDFQXXXXXXXXXXXXXXFDQENKIVGGENAKGVD-----IIDSTLDIDQ 55
           MDQE + ++SKDFQ                 E  ++  E+   V        +   D+D 
Sbjct: 1   MDQEGQPLLSKDFQQVLLATASGNNSSW--TERAVLNNESTDAVKHEPALGQNDVFDLDP 58

Query: 56  RAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAE 115
            + DKW+P+LR   + +QL+ VI ELENSI+DNFQGLELQLLQDSQ+NDKLETS+DEIA 
Sbjct: 59  LSFDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIAN 118

Query: 116 IQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLEL 175
           IQ MV+ +LS +I +FQ  L+ S NELI +KQ Y+N+KK SLKISEA ILI KV+R+LEL
Sbjct: 119 IQGMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILEL 178

Query: 176 SNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXX 235
           S+KCQELITE  FFK LQNLDSLEKLYLQEF++YNF+ L EIY SIP+L+ VTKDEC   
Sbjct: 179 SSKCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINL 238

Query: 236 XXXXXXXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENL 295
                            Q F  IY++ELL +WL TR  MKL   KFNSPIEISMRDE  L
Sbjct: 239 IRNSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFL 298

Query: 296 RKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTS------ 349
            KL L +FF LD FHDS+MIF+ LNE   L  EFNKEYE +K+K + PL WK +      
Sbjct: 299 AKLNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQ 358

Query: 350 ------GNTVSVNSTAHD-----EFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFV 398
                 G   +  STAHD      F +SLS+ FL++Y L ILGFLLYDINLN+ T++I V
Sbjct: 359 MDSLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILV 418

Query: 399 NNNYNATNEFWEMLMMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPL 458
           +NNYN+TNEFW+ LM RL PY  YF+D  LKTE+D+I+ KDFL IYV I+EN+KLNI+PL
Sbjct: 419 DNNYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPL 478

Query: 459 YSVMLALFEKYCKTTLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQII- 517
           Y +++++FEK+C  +L  FD +FQ++L+DDDFMPL+I++K  YEKV+KICWMKE   +  
Sbjct: 479 YKILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSL 538

Query: 518 -DDMDDENFSVTLPFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGIL 576
            D  + E F+VTLPFSPLYPMTCT+ +K Y+K+T+F+S FYRH LH+LNNILV T+D I 
Sbjct: 539 PDPTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIF 598

Query: 577 DGVVNKQIRAKLETTSREEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTK 636
           + +VNK+IR+KLE+TSREEIAQ+L+NLDYF+IA+KEFSN MT++NIL+NPD+EIRL+S K
Sbjct: 599 NDIVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIK 658

Query: 637 NFAESRKYAESXXXXXXXXXXXXXXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTL 696
             AESRK AE+              ET+  DW  T+ R DPDISI+DLAQFLEMMFA+TL
Sbjct: 659 YLAESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTL 718

Query: 697 VNLPYSVQILLIFREFDSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPR 756
            NLPYSVQ LLIFREFDSLTR F+ +LLHDTP  I+ ES+ NFEVD+ YLE IIP+IFP 
Sbjct: 719 QNLPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPS 778

Query: 757 TDE--NENGRLGSQTPKTPTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPN 814
           T    + NG     TP TPT  + +   + +  +NNIKSLE+TFMELKQCI+LL+++   
Sbjct: 779 TPGTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQG-K 837

Query: 815 EYLDPQMRSRKYSRIKPDDANILIGKIRPITAPAPTNEAENSSVFN 860
           +Y +P++R RKYSRI+ +DA +L+ KI+   +       +++SV +
Sbjct: 838 DYNEPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMD 883

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/866 (48%), Positives = 604/866 (69%), Gaps = 14/866 (1%)

Query: 1   MDQETKKVISKDFQXXXXXXXXXXXXXXFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60
           MDQE + ++S++ Q                 +N      N     + D  +++D+++ D+
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNN-NKQSNTSASLLQDDIIELDEQSFDR 59

Query: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120
           W+P LR   E+  L  ++ EL NS+DDNFQ LE ++LQDSQ+ND L TS++EI  IQ ++
Sbjct: 60  WVPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQKLI 119

Query: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180
             SL +++ + Q+ L+ STN++I +KQ  +N++KTS+KISE++ILINK+L++LELSN+CQ
Sbjct: 120 NGSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSNRCQ 179

Query: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXXXXXXX 240
           +LI EG+FFKALQ+LD+LEK+YLQ+F++YNF  LKEIY SIP+LKS+ KDE         
Sbjct: 180 DLIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIKKSF 239

Query: 241 XXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300
                         ++ +Y++ LL  WL  +  MKL   KFNS +E+++RD++ L  L+ 
Sbjct: 240 TSNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLELLKA 299

Query: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVN---- 356
           E F++LD FHDS++IF+ L E DYL EEF KEY+F+K+K + PL  K +  + S+N    
Sbjct: 300 ENFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTTSSSLNGQNQ 359

Query: 357 STAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLMMRL 416
           S   D F E+L++ FLKEYLL ILGFL+YD +LN+ TDY+   N+YN TNEFW++LM +L
Sbjct: 360 SHLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFNSYNTTNEFWDILMKKL 419

Query: 417 KPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLEL 476
            P+ + F+   L TE+++++FKDFLGI++ I+EN KLNI+ LY + + +FEKYC   +  
Sbjct: 420 APHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYRIHITVFEKYCNLLVHK 479

Query: 477 FDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQII----DDMDDENFSVTLPFS 532
           F ++F  +L+DDDFMPLT +++  YEKV+KICW+KE          D  + +F  TLPFS
Sbjct: 480 FSEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKEQQDPANGDFLATLPFS 539

Query: 533 PLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTS 592
           PLYPM CT+ +K Y K+ +F+++FY+H L+ LN ILV T+D I   VVN +IR+KL+TTS
Sbjct: 540 PLYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSIFQKVVNNKIRSKLDTTS 599

Query: 593 REEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESXXXXX 652
           REEIAQ+LINLDYFVIA++EFS+++T++NI++NPDVEIRLAS +   ESRKYAE+     
Sbjct: 600 REEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASAEQLTESRKYAETKLIEL 659

Query: 653 XXXXXXXXXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREF 712
                    E V  DW+ T  + +PDISI D+AQFLEMMF +TLVNLPYSV+ LLIFREF
Sbjct: 660 IDSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTSTLVNLPYSVKTLLIFREF 719

Query: 713 DSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKT 772
           DSLTR FL++LL+ TP  I+ +SV NFE+DM +LEGI+ KIFP ++  E     S +P +
Sbjct: 720 DSLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFP-SETKELPFESSPSPDS 778

Query: 773 PTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPD 832
           P   D++R  +++ I+NN++SL+STF +LKQ IQL+++ +  EY DP +R RKY RI+P+
Sbjct: 779 PLQSDQAR--ASNLIENNVRSLQSTFTDLKQHIQLMKASNLEEYKDPSIRMRKYPRIRPE 836

Query: 833 DANILIGKIRPITAPAPT-NEAENSS 857
            A +L+ K+  I +P+P+  + +N+S
Sbjct: 837 VAQLLVSKV-AIPSPSPSAGDGDNTS 861

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/832 (47%), Positives = 573/832 (68%), Gaps = 14/832 (1%)

Query: 38  GENAKGVDIIDSTLDIDQRAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLL 97
           GE   G+      + +  +  +KW+PYLR+  E+D+L+ V+ E+ +S+++NFQ  E Q+L
Sbjct: 37  GETGDGL------MCLSDQTFEKWVPYLRQAVESDRLDGVVEEVYSSVEENFQNFETQIL 90

Query: 98  QDSQLNDKLETSMDEIAEIQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSL 157
           QDSQ++D L  S+DE   IQ++ E  L   + + Q +L++STNE++ +K+   ++++TS+
Sbjct: 91  QDSQVSDNLSFSIDENDRIQNLAESYLQGQVADLQAHLSASTNEVVSKKRALTSNRRTSI 150

Query: 158 KISEAIILINKVLRLLELSNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEI 217
           KISE+IILI K+ ++LEL+NKCQELI +GNF+KALQNLD LE++Y+ +F++Y F+ L  I
Sbjct: 151 KISESIILIEKIFQMLELTNKCQELIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVI 210

Query: 218 YVSIPYLKSVTKDECXXXXXXXXXXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLK 277
           Y SIP LK++ KDE                     QT++ +Y D+LL  WL  ++ MKL 
Sbjct: 211 YNSIPKLKNIIKDESINLIKKSLSSNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLS 270

Query: 278 RVKFNSPIEISMRDEENLRKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKK 337
             KFNSP+E+S+RD+  L  L+LE ++NLD F+DS+MIFE+L ET+YL +EF KEY+F+K
Sbjct: 271 NYKFNSPVEVSLRDDSFLAGLKLEDYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRK 330

Query: 338 SKTIQPLPWKTSGNTVSVNSTAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIF 397
            K + PL WK++       +   D F + LS+PFLKEYLL ILGFLLYD  L++ TDYIF
Sbjct: 331 VKLVYPLDWKSTTTMTHSANEQVDSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIF 390

Query: 398 VNNNYNATNEFWEMLMMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDP 457
             N Y  T EFWE  M ++ P+   F+   L TE  +IEFK+FLGI + I+EN KLN + 
Sbjct: 391 AYNTYTTTEEFWEQFMTKVSPHLSRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSES 450

Query: 458 LYSVMLALFEKYCKTTLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQII 517
           +Y + + +FEKYC   + +FDK+F  +L+DDDFMPL I ++ FYEKV+K+CWMK +   I
Sbjct: 451 MYKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPDSVPI 510

Query: 518 DDMDDEN-FSVTLPFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGIL 576
              DD N FSVTLPFSPLYPMTC + +K YA +  F+++F++H L  LN +LV T+D I 
Sbjct: 511 VTQDDANGFSVTLPFSPLYPMTCALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTVDDIF 570

Query: 577 DGVVNKQIRAKLETTSREEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTK 636
             VVN +IR+KL+TTSREEIAQ+LINLDYF++A+KEFS++MTK+NI +NPD+EI+L+STK
Sbjct: 571 IKVVNNKIRSKLDTTSREEIAQILINLDYFIVAAKEFSDIMTKENITQNPDIEIKLSSTK 630

Query: 637 NFAESRKYAESXXXXXXXXXXXXXXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTL 696
             A+++KYAE+              E V  DW   + R +P +SI D+AQFLEMMF +TL
Sbjct: 631 QLADTKKYAETKLIELIDSKVTDLMEFVELDWTTEEVRDEPGLSIRDIAQFLEMMFTSTL 690

Query: 697 VNLPYSVQILLIFREFDSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPR 756
            NLPYS++ LLIFREFD LTR FL++L+H++P YI+ +SV NFE DM +LE +I  IFP 
Sbjct: 691 ANLPYSIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVANFETDMKFLENVISNIFPN 750

Query: 757 TDENENGRLGSQTPKTPTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEY 816
               +N  +   TP TP + D    +S + I++N++SL STF +L Q I L++S + +EY
Sbjct: 751 ESTEQNVEISPSTPTTP-VADSFNVKSPNMIESNVRSLFSTFTDLNQHILLMKSNNFDEY 809

Query: 817 LDPQMRSRKYSRIKPDDANILIGKI-RPITAPAPTNEAENSSV--FNLDWNG 865
            D  +R RKY RIKP+ A++L+ K+ RP TA   T + +N++V  +++  NG
Sbjct: 810 KDSSIRMRKYPRIKPEVAHLLMNKLSRPTTA---TTDGDNTTVSDYSVTSNG 858

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/857 (46%), Positives = 560/857 (65%), Gaps = 22/857 (2%)

Query: 1   MDQETKKVISKDFQXXXXXXXXXXXXXXFDQENKIVGGENAKGVDIIDSTLDIDQRAIDK 60
           MDQ+ +  +S+D Q               +Q+     GE        D   ++D +  D+
Sbjct: 1   MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQ----GE--------DELFELDPQIFDR 48

Query: 61  WIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAEIQSMV 120
           W+P LR+  +  QLNTVI +L  SIDD+F+ LE Q+LQDSQ+N+ L TS++EI ++Q ++
Sbjct: 49  WVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQII 108

Query: 121 ELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLELSNKCQ 180
           + SL  DI   Q  +  ST  L+ +KQ  +++ KTS KI+E+ ILI KVL++LEL N+C+
Sbjct: 109 DGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILELFNRCR 168

Query: 181 ELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXXXXXXX 240
           ELI E +FFKALQ +++ E +YLQ+F+ YNF+ L +IY SIP LKS  KDE         
Sbjct: 169 ELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSL 228

Query: 241 XXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENLRKLEL 300
                       + +Y +Y+ ++L  WL T++ MKL   KFNSP+EIS+RD   L  L+L
Sbjct: 229 NYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQL 288

Query: 301 EQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSVNSTAH 360
           + F  L  FHDS++IF++LNE D+ ++EF KEYEF+KSK I PL  K   +TVS ++   
Sbjct: 289 QNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLK-DFSTVSHSNGKI 347

Query: 361 DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNY-NATNEFWEMLMMRLKPY 419
           D F E L + F KEY+L ILGFL+YD  L++ TDY+  NNN  N+T+ FW  +M +L PY
Sbjct: 348 DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLYPY 407

Query: 420 FKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTTLELFDK 479
               +   L TE+ + EFKDFLG+ + I+EN KLN++ LY V +  F +YC+  + LF K
Sbjct: 408 LITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLFQK 467

Query: 480 DFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFSPLYPMTC 539
           +F  +L DDDFMPL I +K  YEK++KICW+ +      +  ++NFS T PFSPLYPMTC
Sbjct: 468 EFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPMTC 527

Query: 540 TMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTSREEIAQL 599
           T+ +K Y+ L SFIS FY+H +  LN I++  ID I D VVN  I++KL+TTSREEIAQ+
Sbjct: 528 TLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIAQI 587

Query: 600 LINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESXXXXXXXXXXXX 659
           L+NLDYFVIA+KEFS ++T++N+  NPDVEIRL+S K   E+RK AE+            
Sbjct: 588 LVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKVID 647

Query: 660 XXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHF 719
             E + FDW  T+ R +PD++IVD+AQFLEMMF +TL  +PY++++LLIFREFD +TR F
Sbjct: 648 LMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITRRF 707

Query: 720 LDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPT-IDDE 778
           L+ LL++TP  IS +SV NFE DM+YLE  I KIFP  ++  +       P TPT +   
Sbjct: 708 LEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFP--NDVSSVPTSPSIPATPTDVPST 765

Query: 779 SRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILI 838
           + ++S++Q++NNIKSL STF +LKQ I L++    +EY D  +R +KYSR+KP+ A  L+
Sbjct: 766 AGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVAQSLL 825

Query: 839 GKIRPITAPAPTNEAEN 855
            K++P     P++E  N
Sbjct: 826 SKLQP-----PSSEQSN 837

>Kwal_47.19214
          Length = 876

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/812 (46%), Positives = 534/812 (65%), Gaps = 16/812 (1%)

Query: 56  RAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAE 115
              +KW P LR   E++ L  V+ EL NSI+DNF+ LE Q+LQDSQL+D L  S+ +IA 
Sbjct: 51  HTFNKWTPLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIAS 110

Query: 116 IQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLEL 175
           I+ ++E SL ++I++    L  +TN++I +KQ Y+N+KK S KISE IILI KVL++LEL
Sbjct: 111 IKEVIEGSLLQEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILITKVLQILEL 170

Query: 176 SNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECXXX 235
           S KCQ+LI E ++FKALQ+L  LEK+Y+Q+F++YNF  LK+IY SIP LKS  KDE    
Sbjct: 171 SKKCQDLIKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINL 230

Query: 236 XXXXXXXXXXXXXXXXXQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENL 295
                            QTF+  Y D LLS WLN+R  +KL   KFNSP+EIS+RD   L
Sbjct: 231 VKSSFNSNLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQL 290

Query: 296 RKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNTVSV 355
             L +   + LD F+DS++IF+ L E DYL  EF KEY+F+ SK + PL  K S +    
Sbjct: 291 ESLNVATLYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPA 350

Query: 356 NSTAH--DEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEMLM 413
                  + F +  +   LK YLL ILGF++YD +LN+ T+Y+   N +N +  FWE+ +
Sbjct: 351 EQKLQVTNLFADDFTQDQLKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFI 410

Query: 414 MRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKTT 473
            R  P+ ++F+++ + TE+++I+ KDFLG+Y+ I+EN  +NI+ +Y + + LF+KY +  
Sbjct: 411 NRFSPFLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFL 470

Query: 474 LELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENH----QIIDDMDDENFSVTL 529
           +++FD +F  +L DDDFMPLTI++ G YEKV+KICW++E+       I+    E+F  TL
Sbjct: 471 VQMFDSEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIEQTPGESFFATL 530

Query: 530 PFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLE 589
           PFSPLYPMTCT+ +K Y KL  F++ F+++ L  LN+++V  ID I   +VN +I AK +
Sbjct: 531 PFSPLYPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSD 590

Query: 590 TTSREEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESXX 649
           TTSREEIAQ+LINLDYF++A KEFSN+++++NI+ NP VE+ L +TK  ++SR   E+  
Sbjct: 591 TTSREEIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKL 650

Query: 650 XXXXXXXXXXXXETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIF 709
                       E V F+W   +   +PD SI D+AQFLEMMF +TLVNLP SV+ LLIF
Sbjct: 651 IALIDSKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIF 710

Query: 710 REFDSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQT 769
           REFD+LTR FLDVLL+ TP  I+ +S+ NFE +M +LE II K+FP +D         QT
Sbjct: 711 REFDALTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFPSSDST------PQT 764

Query: 770 PKTPTIDD---ESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKY 826
           P +P I        ++S++ I+N ++SL STF +LKQ IQ L+S D  EY D  +R RKY
Sbjct: 765 PTSPEIPSGQFSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKY 824

Query: 827 SRIKPDDANILIGKIRPITAPAPTNEAENSSV 858
            RIKP+ A +L  KI P  + A T   E+SSV
Sbjct: 825 PRIKPEVAQMLYNKIVPPRS-AGTESEESSSV 855

>CAGL0I06314g 605636..607507 similar to sp|P07252 Saccharomyces
           cerevisiae YJL209w CBP1 apo-cytochrome b pre-mRNA
           processing protein, hypothetical start
          Length = 623

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 157 LKISEAIILINKVLRLLE--LSNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFK 212
           LK    + LI+KVL L +  L     E   E NFF++L N   LE LY      YN K
Sbjct: 203 LKTGTVVRLIDKVLNLKDNILGKAFAEKFIESNFFRSLSNDGKLEVLYCMIENGYNNK 260

>Kwal_23.3324
          Length = 254

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 288 SMRDEENLRKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWK 347
           ++++ ++L++LE ++   ++A    LM F  +     L+    K      ++  +   +K
Sbjct: 156 ALKNPDDLQELEAKREQTINAIDQMLMKFNDMKARAMLLPRSGKPRRPVSARKYRVDVYK 215

Query: 348 TSGNTVSVNSTAHDEFKESLSVPFLKEYLL 377
            + N   +N ++ DE +E LS+P LK+Y L
Sbjct: 216 RAENAFRLNVSSDDE-EEGLSLPELKKYRL 244

>Scas_504.1
          Length = 3076

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 15/88 (17%)

Query: 410  EMLMMRLKPY-FKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEK 468
            E+L   + PY FK F DTV+ T              + + + Y   ++ L+ V  + F  
Sbjct: 2884 EILKKSILPYEFKNFKDTVINT--------------LLLFDRYYFQVNTLFEVSPSYFIS 2929

Query: 469  YCKTTLELFDKDFQVMLSDDDFMPLTID 496
             CKT + +F+ ++  + +   F  + +D
Sbjct: 2930 ACKTMVTIFEIEYARLENSKHFKTIGVD 2957

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 28,399,894
Number of extensions: 1328692
Number of successful extensions: 5958
Number of sequences better than 10.0: 113
Number of HSP's gapped: 6210
Number of HSP's successfully gapped: 122
Length of query: 869
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 759
Effective length of database: 12,788,129
Effective search space: 9706189911
Effective search space used: 9706189911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)