Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H06875g70269132410.0
Scas_626.68395688136e-97
Sklu_2397.88484868112e-96
AAL175W8834917754e-91
Kwal_27.96888415677724e-91
YML099C (ARG81)8805197683e-90
KLLA0D10197g8562054924e-52
Scas_674.12*909421178e-06
Scas_597.4475671132e-05
Kwal_55.20722827431123e-05
KLLA0F10373g348441103e-05
Kwal_14.1631443511095e-05
YDR207C (UME6)836381097e-05
Scas_717.33904491071e-04
AGL099C747401061e-04
Scas_596.4701361062e-04
YDR213W (UPC2)913411062e-04
AGL206C735331052e-04
KLLA0A04169g775331052e-04
YBR240C (THI2)450531042e-04
CAGL0F05357g601411042e-04
Scas_550.5*832421042e-04
Kwal_23.3178611401033e-04
KLLA0A10329g639451024e-04
YDR034C (LYS14)790431025e-04
KLLA0F00572g597331015e-04
KLLA0F20680g787421016e-04
Kwal_23.3122788331016e-04
YDR421W (ARO80)950391017e-04
KLLA0C16489g728341007e-04
Sklu_1373.2608401007e-04
Kwal_56.2456675585990.001
Scas_521.289033990.001
Scas_721.9486933980.001
Scas_679.2677533980.001
Kwal_26.709583828980.001
KLLA0F22880g116452980.002
CAGL0F07865g84433970.002
AFR096W85233970.002
YKL222C70543960.002
KLLA0A01804g94551960.002
Scas_573.4147838960.002
KLLA0F14322g71742950.003
ADR199C94439950.003
YLR228C (ECM22)81433950.003
CAGL0F03025g92838950.003
AGL091W86633950.003
Kwal_14.2619116753950.003
YCR106W (RDS1)83242940.004
YLR256W (HAP1)150238940.004
Kwal_56.2305877541940.004
Kwal_23.652959847920.005
CAGL0B03421g135539930.006
YLR014C (PPR1)90433920.006
ACR028C60144920.006
Sklu_2434.1098339920.006
CAGL0H01507g79432920.007
CAGL0M12298g99465920.007
Scas_588.1183548920.007
ABL099W80041920.007
ADR403C97039920.008
CAGL0K05841g137238920.008
Kwal_26.673267633910.008
YLL054C76943910.008
CAGL0C01199g92233910.009
KLLA0F04213g76841910.009
Sklu_1622.277830910.009
Sklu_2064.292239910.010
Kwal_26.680594428900.011
KLLA0D00484g100442900.013
KLLA0D01452g144535900.014
Sklu_2296.691937890.015
Scas_699.793549890.015
KLLA0A03421g88039890.015
Kwal_34.1575162828880.017
AFR117C115238880.019
Scas_590.2117230880.020
KLLA0F25630g100757880.021
AFL033W38243870.021
KLLA0F22990g125338880.022
AFL160C64849870.023
YDR303C (RSC3)88537870.024
Scas_663.1294428870.025
AFR171W61238870.025
CAGL0D02904g88730870.027
Scas_661.2374142870.027
Kwal_23.290588133870.027
ADR405C80728870.028
Sklu_2411.1168753860.031
KLLA0C10923g77541860.032
Kwal_55.2067425246840.034
YJL089W (SIP4)82935860.035
Scas_720.5889063860.036
Scas_556.6102228860.039
KLLA0D05038g67336850.042
KLLA0F18084g86029850.045
CAGL0K11902g83132850.045
CAGL0J07150g102228850.051
CAGL0D03850g83438840.056
Scas_688.1776938840.062
CAGL0G09757g142328840.063
CAGL0L04400g98735840.064
Scas_625.5114187840.064
AGR061C61229830.067
KLLA0D12650g65142830.072
Kwal_26.810997049830.079
YPR196W47030820.086
Scas_526.3110929830.090
KLLA0F02387g72737820.091
YPL248C (GAL4)88149820.092
Scas_709.5175940820.096
KLLA0E19701g68136820.10
ADR404C87541820.11
CAGL0L01903g128754820.11
Sklu_2321.390633820.12
CAGL0F07909g104936820.12
YOR172W (YRM1)78641810.12
YLR278C134129820.12
Scas_711.3193234810.12
Sklu_2376.692243810.12
YDL170W (UGA3)52829810.13
KLLA0F10835g75662810.15
AAL057C80937810.15
KLLA0F19602g60336800.15
YLR266C (PDR8)70140800.15
Sklu_1973.177732800.16
ACL058W81730800.16
KLLA0F09559g65840800.17
YHR056C (RSC30)88332800.17
Kwal_27.10232120937800.18
CAGL0A00451g110740800.19
KLLA0A03443g97528800.19
KLLA0C04620g126929790.21
CAGL0I07755g105345790.22
YMR280C (CAT8)143329790.22
Kwal_26.666457950790.23
AGL361C69641790.24
YOR363C (PIP2)99628790.24
Scas_696.44116435790.24
ABL121C128533790.25
Kwal_23.642573539780.30
CAGL0E05434g81646780.33
KLLA0C17050g95529780.34
CAGL0L03377g120956770.43
KLLA0A06039g65728770.43
AGL233C87226760.46
YKL038W (RGT1)117049770.47
AGL083W85649760.57
Scas_715.3111563760.58
KLLA0C03201g65033750.61
Kwal_47.1750692439750.69
Scas_657.385633750.70
CAGL0L04576g86525750.72
KLLA0D11286g67833740.78
YMR019W (STB4)94934750.80
KLLA0D10153g65539740.81
Scas_659.1075733740.82
Scas_637.799832740.94
AGR280C110628740.98
Sklu_2191.271826740.98
YAL051W (OAF1)106228741.00
YBL005W (PDR3)97640741.0
YNR063W60738731.1
Sklu_2301.151726731.2
KLLA0D09977g63440731.3
Scas_630.1470122731.3
CAGL0M03025g125440721.4
Kwal_26.744871436721.5
Kwal_47.1808974527721.5
ADR365W70137721.5
Kwal_47.1723394836712.1
AGR369W105136712.1
Kwal_55.2188488243712.3
Kwal_56.2467064330702.5
KLLA0F02750g114832702.5
Kwal_33.1393479723702.6
KLLA0E17831g638112702.6
YGR288W (MAL13)47337692.9
YHR178W (STB5)74339703.0
YOR162C (YRR1)81033693.1
Kwal_47.1686274335693.4
Sklu_2268.287523693.8
Kwal_14.81956829684.6
KLLA0D12672g86531676.2
Kwal_27.10239914118676.6
ABL172C36058667.5
YMR168C (CEP3)60832667.6
Scas_680.2573833668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H06875g
         (691 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H06875g complement(682518..684626) some similarities with s...  1253   0.0  
Scas_626.6                                                            317   6e-97
Sklu_2397.8 YML099C, Contig c2397 9784-12330                          317   2e-96
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...   303   4e-91
Kwal_27.9688                                                          301   4e-91
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...   300   3e-90
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...   194   4e-52
Scas_674.12*                                                           50   8e-06
Scas_597.4                                                             48   2e-05
Kwal_55.20722                                                          48   3e-05
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    47   3e-05
Kwal_14.1631                                                           47   5e-05
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    47   7e-05
Scas_717.33                                                            46   1e-04
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    45   1e-04
Scas_596.4                                                             45   2e-04
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    45   2e-04
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    45   2e-04
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    45   2e-04
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    45   2e-04
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    45   2e-04
Scas_550.5*                                                            45   2e-04
Kwal_23.3178                                                           44   3e-04
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    44   4e-04
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    44   5e-04
KLLA0F00572g complement(42710..44503) some similarities with ca|...    44   5e-04
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    44   6e-04
Kwal_23.3122                                                           44   6e-04
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    44   7e-04
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    43   7e-04
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            43   7e-04
Kwal_56.24566                                                          43   0.001
Scas_521.2                                                             43   0.001
Scas_721.94                                                            42   0.001
Scas_679.26                                                            42   0.001
Kwal_26.7095                                                           42   0.001
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    42   0.002
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    42   0.002
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    42   0.002
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    42   0.002
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    42   0.002
Scas_573.4                                                             42   0.002
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    41   0.003
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    41   0.003
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    41   0.003
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    41   0.003
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    41   0.003
Kwal_14.2619                                                           41   0.003
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    41   0.004
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    41   0.004
Kwal_56.23058                                                          41   0.004
Kwal_23.6529                                                           40   0.005
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    40   0.006
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    40   0.006
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    40   0.006
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         40   0.006
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    40   0.007
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    40   0.007
Scas_588.11                                                            40   0.007
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    40   0.007
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    40   0.008
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    40   0.008
Kwal_26.6732                                                           40   0.008
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    40   0.008
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    40   0.009
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    40   0.009
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            40   0.009
Sklu_2064.2 , Contig c2064 873-3641                                    40   0.010
Kwal_26.6805                                                           39   0.011
KLLA0D00484g 44879..47893 no similarity, hypothetical start            39   0.013
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    39   0.014
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       39   0.015
Scas_699.7                                                             39   0.015
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    39   0.015
Kwal_34.15751                                                          39   0.017
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    39   0.019
Scas_590.2                                                             39   0.020
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    39   0.021
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    38   0.021
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    39   0.022
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    38   0.023
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    38   0.024
Scas_663.12                                                            38   0.025
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    38   0.025
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    38   0.027
Scas_661.23                                                            38   0.027
Kwal_23.2905                                                           38   0.027
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    38   0.028
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      38   0.031
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    38   0.032
Kwal_55.20674                                                          37   0.034
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    38   0.035
Scas_720.58                                                            38   0.036
Scas_556.6                                                             38   0.039
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    37   0.042
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    37   0.045
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    37   0.045
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    37   0.051
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    37   0.056
Scas_688.17                                                            37   0.062
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    37   0.063
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    37   0.064
Scas_625.5                                                             37   0.064
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    37   0.067
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    37   0.072
Kwal_26.8109                                                           37   0.079
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    36   0.086
Scas_526.3                                                             37   0.090
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    36   0.091
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    36   0.092
Scas_709.51                                                            36   0.096
KLLA0E19701g complement(1739869..1741914) some similarities with...    36   0.10 
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    36   0.11 
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    36   0.11 
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           36   0.12 
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    36   0.12 
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    36   0.12 
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    36   0.12 
Scas_711.31                                                            36   0.12 
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              36   0.12 
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    36   0.13 
KLLA0F10835g 997512..999782 no similarity, hypothetical start          36   0.15 
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    36   0.15 
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    35   0.15 
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    35   0.15 
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          35   0.16 
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    35   0.16 
KLLA0F09559g complement(876719..878695) some similarities with s...    35   0.17 
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    35   0.17 
Kwal_27.10232                                                          35   0.18 
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    35   0.19 
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    35   0.19 
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    35   0.21 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    35   0.22 
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    35   0.22 
Kwal_26.6664                                                           35   0.23 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    35   0.24 
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    35   0.24 
Scas_696.44                                                            35   0.24 
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    35   0.25 
Kwal_23.6425                                                           35   0.30 
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    35   0.33 
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    35   0.34 
CAGL0L03377g complement(382932..386561) some similarities with s...    34   0.43 
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    34   0.43 
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    34   0.46 
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    34   0.47 
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    34   0.57 
Scas_715.3                                                             34   0.58 
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    33   0.61 
Kwal_47.17506                                                          33   0.69 
Scas_657.3                                                             33   0.70 
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    33   0.72 
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    33   0.78 
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    33   0.80 
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    33   0.81 
Scas_659.10                                                            33   0.82 
Scas_637.7                                                             33   0.94 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    33   0.98 
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         33   0.98 
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    33   1.00 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    33   1.0  
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    33   1.1  
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                33   1.2  
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    33   1.3  
Scas_630.14                                                            33   1.3  
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    32   1.4  
Kwal_26.7448                                                           32   1.5  
Kwal_47.18089                                                          32   1.5  
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    32   1.5  
Kwal_47.17233                                                          32   2.1  
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    32   2.1  
Kwal_55.21884                                                          32   2.3  
Kwal_56.24670                                                          32   2.5  
KLLA0F02750g complement(250368..253814) some similarities with s...    32   2.5  
Kwal_33.13934                                                          32   2.6  
KLLA0E17831g complement(1572985..1574901) some similarities with...    32   2.6  
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    31   2.9  
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    32   3.0  
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    31   3.1  
Kwal_47.16862                                                          31   3.4  
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         31   3.8  
Kwal_14.819                                                            31   4.6  
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    30   6.2  
Kwal_27.10239                                                          30   6.6  
ABL172C [420] [Homologous to ScYDL230W (PTP1) - SH] (79451..8053...    30   7.5  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    30   7.6  
Scas_680.25                                                            30   8.5  

>CAGL0H06875g complement(682518..684626) some similarities with
           sp|05085 Saccharomyces cerevisiae YML099c ARG81,
           hypothetical start
          Length = 702

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/691 (88%), Positives = 612/691 (88%)

Query: 1   MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLY 60
           MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLY
Sbjct: 1   MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLY 60

Query: 61  GVPMPSNESITTTEGDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIAN 120
           GVPMPSNESITTTEGDDVETSTNLRRN                   LSELHAPPEDKIAN
Sbjct: 61  GVPMPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHEDMDEELSELHAPPEDKIAN 120

Query: 121 NKTWIIKKFGVFXXXXXXXXXXXKRGKTDKRPVQKKIAXXXXXXXXXXXXXXXPLMKKPR 180
           NKTWIIKKFGVF           KRGKTDKRPVQKKIA               PLMKKPR
Sbjct: 121 NKTWIIKKFGVFRAIEREAIIAAKRGKTDKRPVQKKIANELNSNNSNNHINNEPLMKKPR 180

Query: 181 LAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHSHLVS 240
           LAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHSHLVS
Sbjct: 181 LAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHSHLVS 240

Query: 241 LSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFP 300
           LSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFP
Sbjct: 241 LSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFP 300

Query: 301 NSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLAXXXXXX 360
           NSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLA      
Sbjct: 301 NSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLALEQEEE 360

Query: 361 XXXXXXXXXXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLIXXXXX 420
                        AEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLI     
Sbjct: 361 YEEYRDILEDDDIAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLISKNKK 420

Query: 421 XXXXXXXXXXLYTIYAFLKLMQNSTAMETITSEPSLDFHNPDIIPYKYLRETYENDIKTI 480
                     LYTIYAFLKLMQNSTAMETITSEPSLDFHNPDIIPYKYLRETYENDIKTI
Sbjct: 421 RVVVSKKIKSLYTIYAFLKLMQNSTAMETITSEPSLDFHNPDIIPYKYLRETYENDIKTI 480

Query: 481 FTDHYGSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTR 540
           FTDHYGSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTR
Sbjct: 481 FTDHYGSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTR 540

Query: 541 EFEDKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNV 600
           EFEDKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNV
Sbjct: 541 EFEDKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNV 600

Query: 601 EVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLT 660
           EVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLT
Sbjct: 601 EVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLT 660

Query: 661 GAGSYRGAIQIMFEVWRRRDNNELGDDWLSV 691
           GAGSYRGAIQIMFEVWRRRDNNELGDDWLSV
Sbjct: 661 GAGSYRGAIQIMFEVWRRRDNNELGDDWLSV 691

>Scas_626.6
          Length = 839

 Score =  317 bits (813), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 199/568 (35%), Positives = 294/568 (51%), Gaps = 92/568 (16%)

Query: 177 KKPRLAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHS 236
           K+   +PS +   + T +  +P S   +P T+          ++P P+EL     I +  
Sbjct: 300 KQTPTSPSTSKGMVKTLLD-APQSDSHMPRTIM-------EIINPSPLELE----IFEAL 347

Query: 237 HLVSLS---TESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAAL 293
           + ++LS     S   VH   +FLL +YLE V DLMT+ P+   ++NPW K+YFPRA+ AL
Sbjct: 348 NKLNLSWNIPASGVNVHGIGKFLLNYYLENVADLMTVVPL---SRNPWKKLYFPRALQAL 404

Query: 294 GELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNL 353
           G+L+    + N +R SLLN  L+VSCFNLK   + +    +++LNL +ELR +AS+FLN+
Sbjct: 405 GDLVGLGYTTN-SRNSLLNALLAVSCFNLKSKFEKNSKEYNYFLNLGIELRKQASNFLNI 463

Query: 354 AXXXXXXXXXXXXXXXXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQ 413
                                    + + D+L AIL+MNSID+VWGTM DC  +L ICE 
Sbjct: 464 CLNSTVTV-----------------EKYKDVLTAILSMNSIDVVWGTMEDCQRHLTICED 506

Query: 414 LIXXXXXXX-XXXXXXXXLYTIYAFLKLMQNSTAMETITSEPSLDFHNPDI--------- 463
            +                L+ I++FLKL+Q+STA++ +  +  + +   D          
Sbjct: 507 FVEKRMNSRPHISGKARTLHRIFSFLKLIQDSTALDKVRDKEIVIYGKKDKPDKNKVADP 566

Query: 464 ----------------------IPYKYLRETYEND------------IKTIFTDHY---- 485
                                 I  +Y+R    ND               I ++ Y    
Sbjct: 567 FVKDTSNNGGQFRESLNKLNGKIQIEYIRNDDSNDNNEQSASSSPPMFANIASESYYKPG 626

Query: 486 --GSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFE 543
               +  + L  DAL  LPNSL+LLF DCV + R+  Y+  K   + +P EF      FE
Sbjct: 627 QKSESDYDILSTDALYGLPNSLILLFSDCVRIVRHNEYYNIKY--LAVPREFTEICLNFE 684

Query: 544 DKLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVW 603
            +L  WK EW F+      F+  TIEG+YHHTMSFYYGL +YY++  K+ + + L   V 
Sbjct: 685 KRLLKWKPEWAFYKENTDEFIDDTIEGVYHHTMSFYYGLVIYYFSMAKHLNNQFLQSYVE 744

Query: 604 KVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAG 663
           KV+ HL ++  L D  +    +K++PL+WQGFIAGC  +  ++Q EF+ W   ++ +G G
Sbjct: 745 KVLLHLNKLTDLIDHKS----VKIVPLMWQGFIAGCSSNMQDLQQEFRKWAAKLAESGMG 800

Query: 664 SYRGAIQIMFEVWRRRDNNELGDDWLSV 691
           SY GA Q+MFEVWRRR N+E  D+W SV
Sbjct: 801 SYWGARQVMFEVWRRRMNDEPNDNWYSV 828

 Score =  135 bits (340), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 81/129 (62%), Gaps = 3/129 (2%)

Query: 4   KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVP 63
           K  R  KT++GCWTCR+RKVKCDL RP C+RC +S ++CGGY IKLRWS L+ FD YGV 
Sbjct: 10  KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLECGGYDIKLRWSKLVKFDPYGVQ 69

Query: 64  MPSNESITTTEGDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANNKT 123
           +P + +  +   ++ +     RRN                   LS LHAPP +KIA+ KT
Sbjct: 70  LPPSPNGNSASNEEPQYQ---RRNIDFVKYKEEYIFHEDMDDELSILHAPPTEKIADGKT 126

Query: 124 WIIKKFGVF 132
           WIIKKFGVF
Sbjct: 127 WIIKKFGVF 135

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score =  317 bits (811), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 192/486 (39%), Positives = 258/486 (53%), Gaps = 70/486 (14%)

Query: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308
           VH   RFLL +YL+ V DLMT+  +P    NPW  IYFPRA+ ALG+L     + N +R 
Sbjct: 379 VHGLARFLLNYYLQNVADLMTVVALPT---NPWKTIYFPRALKALGDLAGIGYTSN-SRN 434

Query: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLAXXXXXXXXXXXXXX 368
           SLLN  L+VSCFNL+     +     FYL L +E R++AS+FL                 
Sbjct: 435 SLLNALLAVSCFNLQSKFPKNTPQMRFYLYLGIEFRSQASNFLKKCLN------------ 482

Query: 369 XXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLIXXXXXXX-XXXXX 427
                +  + + + D+L AIL+MNSID+VWGTM DC  +L ICE  +             
Sbjct: 483 -----SSAHQERYKDILTAILSMNSIDVVWGTMADCQYHLTICEDFVEERMKTRPKISEK 537

Query: 428 XXXLYTIYAFLKLMQNSTAM-------------ETITSE---PSLDFHNPDIIPYKYLRE 471
              L+ I++FLKL+Q+STA+             E +T E    S    + +I   ++   
Sbjct: 538 AKALHRIFSFLKLIQDSTALDKVREGEIVIKDDEDVTGEQLQESQTGQDLNIADGEFKES 597

Query: 472 TYENDIKT-----------------IFTDHYGST----KMNT-----LGADALNALPNSL 505
             + D K                  IFT+    T    KM+T     L  DAL  LPNSL
Sbjct: 598 LNQKDGKIRIEFVKQPQSSSSGSTPIFTNITSETYYYPKMSTTTQDILSTDALYGLPNSL 657

Query: 506 VLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFFDSTGRNFLS 565
           +L F DCV L R+  Y+K     +  P ++     EFE +L NWKSEWDF+    R F++
Sbjct: 658 ILCFSDCVRLVRHREYYKMNK--LPAPRKYAKLCTEFEKRLLNWKSEWDFYKPHTREFVN 715

Query: 566 PTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSAGKEGI 625
            TIEG+YHHTMSFYY L +YY+   ++ + + L   V KV+ HL Q+  L D     + +
Sbjct: 716 DTIEGVYHHTMSFYYSLIIYYFTMARDLNNQLLQSYVEKVLSHLNQLSDLID----HKNV 771

Query: 626 KLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRRDNNELG 685
           K++PLIWQGFIAGC   D  +Q  FK W   ++ +G GSY GA QIMFEVWRRR N E  
Sbjct: 772 KVVPLIWQGFIAGCSSVDSNLQLSFKKWAAKLASSGMGSYWGARQIMFEVWRRRMNGEEN 831

Query: 686 DDWLSV 691
           D+W SV
Sbjct: 832 DNWCSV 837

 Score =  130 bits (327), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 78/131 (59%), Gaps = 3/131 (2%)

Query: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYG 61
           D +  R  KT++GCWTCR+RKVKCDL RPSC RC RS  +CGGY IKLRWS  + FD YG
Sbjct: 7   DIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKPIKFDRYG 66

Query: 62  VPMPSNESITTTEGDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANN 121
           V +P + +   +  D+ +     RRN                   LS LH+PP + IA +
Sbjct: 67  VQLPPSPNSPDSGSDEPQFQ---RRNIAFVRYQDEYEFYEDMDDELSALHSPPLENIAGD 123

Query: 122 KTWIIKKFGVF 132
           KTWII KFGVF
Sbjct: 124 KTWIINKFGVF 134

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
           complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score =  303 bits (775), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 177/491 (36%), Positives = 266/491 (54%), Gaps = 76/491 (15%)

Query: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308
           +H   RFLL++Y + V DLM++  +P   KNPW  IYFPRA+ ALGEL A   + +++R 
Sbjct: 410 IHGLTRFLLSYYQQNVADLMSVVALP---KNPWKTIYFPRAVKALGELGALGYT-SHSRN 465

Query: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLAXXXXXXXXXXXXXX 368
           +LLN  L+VSCF+L+     +     ++++L ++ R +AS FLN                
Sbjct: 466 ALLNALLAVSCFHLQSKFPKNSKEMKYFVSLGMDFRNQASGFLNACLS------------ 513

Query: 369 XXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLIXXXXXXXXXXXXX 428
                +    +H+ D+L AIL+MNSID+VWGTM DC  +L ICE+ I             
Sbjct: 514 -----STSRQEHYKDVLTAILSMNSIDVVWGTMSDCQYHLTICEEFIESRMKSRPLLSEK 568

Query: 429 XX-LYTIYAFLKLMQNSTAMETI-------------------TSEPSLDFHNPDIIPYKY 468
              L+ I++FLKL+Q+STA++ +                   +S P L   +      +Y
Sbjct: 569 ARCLHRIFSFLKLIQDSTALDKVQEKEIIMKDAGDKEFQKNGSSTPPLSTDSSSFTG-RY 627

Query: 469 LRETYENDIK-----------------------TIFTDHY----GSTKMNTLGADALNAL 501
           + +  +++ +                       TI T  Y      T+++TL  D L  L
Sbjct: 628 VEQLNKDNGRVCIEFIEKDGQYFDTRGSVPLFNTIVTKSYPHEINETRIDTLSMDVLYGL 687

Query: 502 PNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFF-DSTG 560
           PNSL+LLF DCVSL R+ FY K+ +     PT F +   + E +L +WK EW F+ D + 
Sbjct: 688 PNSLILLFSDCVSLVRHRFYFKRHNTA--QPTSFGLFCVKIEQRLLSWKPEWIFWKDDSK 745

Query: 561 RNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSA 620
             F++ T+EG+YHHTMSFYYGL +YY+   ++ +  +L   V KV+ HL+++  + +   
Sbjct: 746 AEFINDTVEGVYHHTMSFYYGLLIYYFTMARSLEDHTLQNYVQKVLSHLRELGNIIE--- 802

Query: 621 GKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRRD 680
             + +K++PL+WQGF+AGC C+D  +Q EFK W   +   G GSY GA QIM EVWRRR 
Sbjct: 803 -HKDVKIVPLMWQGFMAGCSCTDSSMQLEFKKWTAQLVNFGIGSYWGARQIMLEVWRRRM 861

Query: 681 NNELGDDWLSV 691
            +   D+W SV
Sbjct: 862 TDGKCDNWYSV 872

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 78/146 (53%), Gaps = 5/146 (3%)

Query: 9   VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVPMPSNE 68
            KT++GCWTCR RKVKCDL +PSC RC +S + CGGY IKLRWS  + FD +G  M   +
Sbjct: 38  AKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDCGGYDIKLRWSNPIRFDKFGNQMAGED 97

Query: 69  SITTTEGDDVETSTNL-RRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANNKTWIIK 127
                +GD  + +    RRN                   LS LH+PP + IA++KTWIIK
Sbjct: 98  R----DGDGEQPAQPFQRRNIMFVRYDEEYEYYEDMDDELSALHSPPLEMIADHKTWIIK 153

Query: 128 KFGVFXXXXXXXXXXXKRGKTDKRPV 153
           +FGVF            R +    PV
Sbjct: 154 RFGVFKGTDRVKRKYVPRKRRKVNPV 179

>Kwal_27.9688
          Length = 841

 Score =  301 bits (772), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 191/567 (33%), Positives = 282/567 (49%), Gaps = 87/567 (15%)

Query: 177 KKPRLAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAFMSPLPMELLQPDFIHDHS 236
           K  + AP V       P ++ P   +++     +   G    M    +E++  D + DH+
Sbjct: 299 KVTQQAPVVPIDDQHVPRTIVPLDNVIL-----INSSGTEGRMPKQVLEVVNSD-VPDHT 352

Query: 237 H---------LVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFP 287
                     L+ L T     VH   RFL+ +YL+ V DLMT+  +P    NPW  IYFP
Sbjct: 353 IFNLPTNDNILLRLPTTGLK-VHGLTRFLMNYYLQNVVDLMTVVALPT---NPWRTIYFP 408

Query: 288 RAIAALGELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRA 347
           RA  ALG++     + N +R SLLN  L+VSCFNL+     +     FYL L +E R +A
Sbjct: 409 RAAQALGDIAGVGYTSN-SRNSLLNAILAVSCFNLQSKFPRNSPEMRFYLQLGIEFRGQA 467

Query: 348 SHFLNLAXXXXXXXXXXXXXXXXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNY 407
           S FL                           + + D+L AIL+MNSID+VWGTM DC  +
Sbjct: 468 SDFLKACLASSAK-----------------QERYKDILTAILSMNSIDVVWGTMADCQYH 510

Query: 408 LRICEQLIXXXXXXX-XXXXXXXXLYTIYAFLKLMQNSTAMETI-TSEPSLDFHNPDI-- 463
           L +CE L+                L+ I++FLKL+Q+STA++ +   E  +D   P+   
Sbjct: 511 LTLCEGLVEERMKTRPKLSGKARALHRIFSFLKLIQDSTALDKVHEREIVIDHRIPESVV 570

Query: 464 ---------------------IPYKYLRETYENDIKTIF------TDHYGSTKMNT---- 492
                                I  +Y+++  ++    IF      T +Y   +M +    
Sbjct: 571 ENDVSDNGGEFKESLNKVDGKIRIEYVKQNRKSGSTPIFDSVASQTYYYPGNRMGSGDYT 630

Query: 493 --------LGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFED 544
                   L  DAL  LPNS++LLF DCV L R+  Y++K  +  + P  + +   EFE 
Sbjct: 631 KSLEGNDVLSTDALYGLPNSIILLFSDCVRLARHREYYRKHDQ--DPPESYEILCAEFEK 688

Query: 545 KLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWK 604
           KLS W SEWDF       F++ TIEG+Y+HTMSFY  L +YY    + + ++ +   V  
Sbjct: 689 KLSGWTSEWDFHKPNSTEFVNDTIEGVYYHTMSFYQSLIIYYNTMARGRRHQDIQENVRN 748

Query: 605 VIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGS 664
            + +L ++  L +     +G+K++PLIWQGFIAGC   D ++Q ++K W   ++ +G GS
Sbjct: 749 ALTYLNKLTELIN-----KGVKIVPLIWQGFIAGCSAIDTDLQLQYKEWAARLANSGMGS 803

Query: 665 YRGAIQIMFEVWRRRDNNELGDDWLSV 691
           Y GA QIMFEVWRRR N E  D+W +V
Sbjct: 804 YWGARQIMFEVWRRRVNGENCDNWFNV 830

 Score =  130 bits (326), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 81/129 (62%), Gaps = 5/129 (3%)

Query: 4   KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVP 63
           K  R VKT++GCWTCR+RKVKCDL +P+C RC +S ++CGGY IKLRWSP + F+ +G  
Sbjct: 12  KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLECGGYDIKLRWSPSIKFNKFG-Q 70

Query: 64  MPSNESITTTEGDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANNKT 123
           + SN S      +  E   + RRN                   LS LH+P +DKI++NKT
Sbjct: 71  VDSNGS----PANGTEEPQSQRRNVGFVTYKDEYEFYEDMDEELSALHSPSQDKISDNKT 126

Query: 124 WIIKKFGVF 132
           WIIKKFGVF
Sbjct: 127 WIIKKFGVF 135

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component of
           the ARGR regulatory complex, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score =  300 bits (768), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 185/519 (35%), Positives = 267/519 (51%), Gaps = 90/519 (17%)

Query: 237 HLVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGEL 296
            LV +  ++   VH   RFLL HY   V D MT+  +    KNPW  +YFPRA+ ALG+L
Sbjct: 377 ELVDIIPKTDLTVHGLARFLLNHYFNNVADKMTVVVL---EKNPWKTLYFPRALMALGDL 433

Query: 297 IAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLAXX 356
                S N +R +LLN  L+VSCF+L+     +     ++L L +ELR +AS+FL L   
Sbjct: 434 AGLGQSSN-SRNALLNALLAVSCFHLQSKYPRNYKLQKYFLGLGIELRNQASNFLRLCLN 492

Query: 357 XXXXXXXXXXXXXXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLIX 416
                                 + + D+L AIL+MNSID+VWGTM DC ++L +CE  + 
Sbjct: 493 TKSSIP----------------EKYKDVLTAILSMNSIDVVWGTMADCQDHLALCEDFVE 536

Query: 417 XXXXXX-XXXXXXXXLYTIYAFLKLMQNSTAMETITSE-----PS--------LDFHNP- 461
                          L+ I++FLKL+Q+STA++ + ++     PS        LD  N  
Sbjct: 537 SRMKLRPNISEKTKTLHRIFSFLKLIQDSTALDKVRAKEIVILPSEEDDNYKPLDTSNAT 596

Query: 462 --------DIIPYKYLRETY-ENDIK----------------------------TIFTDH 484
                   D++     RE   END K                             I T+ 
Sbjct: 597 TSSSEPRVDVVQEGLFREALNENDGKIHIEFVKEPITNVSADSTPSSTTPPIFTNIATES 656

Query: 485 Y----------GSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTE 534
           Y            T  N +G D+L  LPNSL+LLF DCV + R+  Y+      + +P +
Sbjct: 657 YYNKSDISKLVSKTDENIIGTDSLYGLPNSLILLFSDCVRIVRHNEYYNLTY--LPVPRK 714

Query: 535 FFMKTREFEDKLSNWKSEWDFF--DSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKN 592
           F   +  FE +L  WKSEW+F   +S G++F++ T E +YHHTMSFY+ L +YY+   ++
Sbjct: 715 FNELSLNFEKRLLKWKSEWNFHQENSEGKSFINSTAEALYHHTMSFYFSLIIYYFTMARS 774

Query: 593 QDYESLNVEVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKT 652
            + + L   V KV+ HL  +E L D    ++ +K++PLIWQGF+AGC C+D   Q EF+ 
Sbjct: 775 LNCQFLQNYVAKVLDHLNAMEELVD----QKKVKIVPLIWQGFMAGCACTDENRQQEFRR 830

Query: 653 WFDTVSLTGAGSYRGAIQIMFEVWRRRDNNELGDDWLSV 691
           W   ++ +G GSY GA Q+M EVWRRR  +E GD+W SV
Sbjct: 831 WAAKLAESGVGSYWGARQVMLEVWRRRKEDEPGDNWYSV 869

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 86/154 (55%), Gaps = 2/154 (1%)

Query: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
           KK  R+ KT++GCWTCR RKVKCDL  P C RC +S + CGGY IKLRWS  + FD YGV
Sbjct: 10  KKMGRA-KTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKPMQFDPYGV 68

Query: 63  PMPSNESITTTE-GDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANN 121
           P+P N   TTT     V+     RRN                   L+ LH PP +KI++N
Sbjct: 69  PIPQNSPATTTNLSGSVDEPQYQRRNIDFVRYDEEYVYHEDMDDELTMLHTPPIEKISDN 128

Query: 122 KTWIIKKFGVFXXXXXXXXXXXKRGKTDKRPVQK 155
           KTWIIKKFGVF            R K +++ V K
Sbjct: 129 KTWIIKKFGVFKGTDKIDKQYAPRKKRNRKRVAK 162

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
           Saccharomyces cerevisiae YML099c ARG81 transcription
           factor involved in arginine metabolism singleton, start
           by similarity
          Length = 856

 Score =  194 bits (492), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 130/205 (63%), Gaps = 7/205 (3%)

Query: 488 TKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLS 547
           T  N L  DAL  LPNSL+LLF DCV L R+  Y+++ +  I  P  F     EFE ++ 
Sbjct: 647 TDNNILSTDALYGLPNSLILLFSDCVRLARHLEYYRQHN--IVTPKAFKKLCTEFEQRIL 704

Query: 548 NWKSEWDF-FDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVI 606
           +WKSEWDF    +  +F++ TIEG+YHHTMSFY GL +YY+  +K   Y+ +   V  V+
Sbjct: 705 SWKSEWDFKVPGSPDHFVNDTIEGVYHHTMSFYNGLIIYYFTVVKGLTYKYVKHHVQNVL 764

Query: 607 YHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYR 666
             L Q+  L ++    +G+K++PLIWQGF+AGC C D  +Q EFK W   +  +G GSY 
Sbjct: 765 NSLIQLTELIEN----KGVKIVPLIWQGFMAGCACIDSNLQLEFKEWAAKLCKSGMGSYW 820

Query: 667 GAIQIMFEVWRRRDNNELGDDWLSV 691
           GA QIMFEVWRRR N E  DDW SV
Sbjct: 821 GARQIMFEVWRRRLNGEQNDDWFSV 845

 Score =  140 bits (354), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 111/206 (53%), Gaps = 22/206 (10%)

Query: 249 VHNNVRFLLTHYLEKVPDLMTIAPIPNKNKNPWAKIYFPRAIAALGELIAFPNSQNYARI 308
           VH   RFLL +YL+ V DLMT+  +P    N W  IYFPRA+ ALG+L     + N +R 
Sbjct: 377 VHGLARFLLNYYLQNVADLMTVVVLPT---NSWKTIYFPRALKALGDLTGIGYTSN-SRN 432

Query: 309 SLLNGCLSVSCFNLKDLLKYDPVSTDFYLNLAVELRTRASHFLNLAXXXXXXXXXXXXXX 368
           SLLN  L+VSCFNL+     +     F+L L +E RT+AS FL                 
Sbjct: 433 SLLNALLAVSCFNLQSKFPKNSPEMKFFLTLGIEFRTQASSFLKRCLSNTVN-------- 484

Query: 369 XXXXXAEDYNKHFCDMLIAILTMNSIDIVWGTMVDCDNYLRICEQLIXXXXXXX-XXXXX 427
                     + + D+L AIL+MNSID+VWGTM DC  +L ICE  +             
Sbjct: 485 ---------QERYKDILTAILSMNSIDVVWGTMADCQVHLAICEDFVENRMKTRPKISAK 535

Query: 428 XXXLYTIYAFLKLMQNSTAMETITSE 453
              L+ I++FLKL+Q+ST+++ + ++
Sbjct: 536 AKALHRIFSFLKLIQDSTSLDKVRTK 561

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/158 (40%), Positives = 79/158 (50%), Gaps = 13/158 (8%)

Query: 9   VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVPMPSNE 68
           VKT++GCWTCR+RKVKCDL RP C RC +  + CGGY +KLRW+  + FD  G     N 
Sbjct: 8   VKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRPIQFDTMG-----NV 62

Query: 69  SITTTEGDDVETSTNLRRNXXXXXXXXXXXXXXXXXXXLSELHAPPEDKIANNKTWIIKK 128
           + T T   D +     RRN                   LS L +PP + I+ +KTWIIKK
Sbjct: 63  TATPTGIKDPDEPQYQRRNVDFVRYKEEYVYYEDMDDELSALSSPPLELISEDKTWIIKK 122

Query: 129 FGVFXXXXXXXXXXXKRGKTDKRPV--------QKKIA 158
           FGVF            R K  K  V        QKK+A
Sbjct: 123 FGVFKGTDKVKKRYVPRKKRKKNQVFINAIEKAQKKLA 160

>Scas_674.12*
          Length = 909

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          M+ K+ R  +    C  CR++KVKCD  RPSC RCR++   C
Sbjct: 1  MNDKNYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>Scas_597.4
          Length = 475

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 9  VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVPMPSNE 68
           +T++GCW CR +K +CD ++P+C  C R    C  Y I+L W  +  F +        E
Sbjct: 18 ARTFTGCWACRLKKRRCDELKPTCSLCVRHGDTC-SYDIRLMWLDVNMFKVDTSMSGGAE 76

Query: 69 SITTTEG 75
           +T  E 
Sbjct: 77 YVTFNES 83

>Kwal_55.20722
          Length = 827

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCG 43
          MD+KS R  +    C  CR RK+KCD  RP C RC+++ + C 
Sbjct: 1  MDRKSPRVNRPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCS 43

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSP 53
          + ++GCW CR +K KCD  +P C  C +  V+C  Y ++L W P
Sbjct: 5  RNFTGCWACRFKKRKCDERKPICSLCLKHGVEC-CYDVRLSWLP 47

>Kwal_14.1631
          Length = 443

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRW 51
          M   S    ++++GCW CR +K +CD  +P C  C +   QC  Y I+L W
Sbjct: 1  MSTASKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQC-SYDIRLVW 50

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 5   STRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +++  ++ +GCW CR RK KC   RP C  C R K+ C
Sbjct: 761 TSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDC 798

>Scas_717.33
          Length = 904

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 9/49 (18%)

Query: 3  KKSTRSVK---TYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42
          K+S+R +K   ++  C +CR RKVKCDL       +P C+RCRR    C
Sbjct: 19 KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTC 67

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           KK+    ++ +GCW CR RK KC   RP C  C R  ++C
Sbjct: 668 KKAGAGTRSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC 707

>Scas_596.4
          Length = 701

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 7   RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           ++ ++ SGCW CR RK KC   +P+C  C+R  + C
Sbjct: 560 KARRSRSGCWICRLRKKKCTEEKPACFNCQRLNLDC 595

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLR 50
          K+ +GC  C+ R+VKCD  +P+C +C   K++C    I LR
Sbjct: 46 KSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQYTPIHLR 86

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ +GC TCRAR+ KCD  RP C+ C+R+ + C
Sbjct: 45 RSRNGCLTCRARRKKCDETRPKCIGCQRNLLLC 77

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD  RP CL C++  + C
Sbjct: 52 KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
          +T++GCW CR +K +CD  RP C  C +    C  Y I+L W   L  ++Y V
Sbjct: 25 RTFTGCWACRFKKRRCDENRPICSLCAKHGDNC-SYDIRLMW---LEENIYKV 73

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           ++K   + ++ +GCW CR RK KC   +P+C  C+R  + C
Sbjct: 517 ERKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDC 557

>Scas_550.5*
          Length = 832

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          M KKS R  +    C  CR +K++C+  RPSC RC+R    C
Sbjct: 1  MQKKSIRGQRPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>Kwal_23.3178
          Length = 611

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +K+    ++ +GCW CR RK KC   +PSC  C R  +QC
Sbjct: 533 RKNNSGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQC 572

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRW 51
          +  ++Y GC  C++ K KCD V+P C  C++   QC  Y   L+W
Sbjct: 9  KVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC-DYSRTLKW 52

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 2   DKKSTRSVKTYS--GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           DKK     + YS  GC  C+ R++KCD  +P+C +C R   QC
Sbjct: 144 DKKGNTVKRKYSRNGCSECKRRRMKCDETKPTCWQCARLNRQC 186

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ +GC  CR RK KCD V+P+C  C+R+ ++C
Sbjct: 6  RSSTGCLICRRRKKKCDEVKPTCTACKRNFLEC 38

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 1   MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           + K++    ++ +GCW CR RK KC   +P C  C R  ++C
Sbjct: 705 IKKRNATGARSRTGCWICRLRKKKCTEEKPQCQNCVRLHLEC 746

>Kwal_23.3122
          Length = 788

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD  +PSC +C   K++C
Sbjct: 45 KSKNGCDNCKRRRVKCDEDKPSCQKCLNMKLEC 77

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42
          +TY  C +CR+RKVKCDL        P C RC+R   +C
Sbjct: 20 RTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKC 58

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%)

Query: 9  VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           ++ SGC+TCR +++KCD   P C RC+R+ + C
Sbjct: 37 TRSKSGCFTCRLKRMKCDEQHPICGRCKRNLLTC 70

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 3   KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +K+T   ++ +GCW CR RK KC   +P C  C R  ++C
Sbjct: 529 RKNTTGSRSRTGCWICRLRKKKCTEEKPHCNNCTRLNLEC 568

>Kwal_56.24566
          Length = 755

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 7/85 (8%)

Query: 10  KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC-------GGYKIKLRWSPLLHFDLYGV 62
           ++ +GC+TCR R+ KCD  RP C  C +  ++C       G    ++R       DLY  
Sbjct: 27  RSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIWPRKGQGRLTKEMREKMKREVDLYDE 86

Query: 63  PMPSNESITTTEGDDVETSTNLRRN 87
                    + E D  +T   LRR+
Sbjct: 87  SCNFALDGGSQEPDTPQTPYRLRRS 111

>Scas_521.2
          Length = 890

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ S C  CR++K+KCD   PSC RC   KV C
Sbjct: 36 KSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPC 68

>Scas_721.94
          Length = 869

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+  GC  C+ R+VKCD ++P+C RC    V C
Sbjct: 50 KSKQGCTHCKRRRVKCDELKPACRRCLNWNVPC 82

>Scas_679.26
          Length = 775

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD ++P+C +C    ++C
Sbjct: 53 KSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>Kwal_26.7095
          Length = 838

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  C+ RK+KCD  RPSC RC + +++C
Sbjct: 30 CRNCKKRKIKCDKARPSCGRCSKLELEC 57

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 9/52 (17%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRR--SKVQCGGYKIKLR 50
          MDKK+ +S      C  CR RKV+CD  +P CL C +  S ++C  Y+++ R
Sbjct: 1  MDKKNGKS------CLVCRRRKVRCDRAKPVCLVCVKHGSNMEC-NYEVQKR 45

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD  +P C +C + K++C
Sbjct: 49 KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++   C  CR +K+KCD +RPSC  C++   QC
Sbjct: 24 RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQC 56

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 3/43 (6%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          +D++S R  K    C  CR RK+KCD VRP C  C  R++ QC
Sbjct: 12 LDRQSRR--KPAKSCHFCRVRKLKCDRVRPFCGSCSSRNRKQC 52

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 13/51 (25%)

Query: 10 KTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC-------GGYKI 47
          + Y  C  C+ RKVKCDL        P C+RC+R   +C       GG+++
Sbjct: 19 RGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTETKRGGFRV 69

>Scas_573.4
          Length = 1478

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
          C  CR RKVKCD +RP C +C ++ V    + ++  W+
Sbjct: 43 CTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQSWA 80

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          M   ST+  +    C  CR +K+KCD ++PSC  C++    C
Sbjct: 49 MPTASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHC 90

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 6/39 (15%)

Query: 10 KTYSGCWTCRARKVKCDL------VRPSCLRCRRSKVQC 42
          + Y  C  CR RKV+CDL        P C+RC R + +C
Sbjct: 27 RIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKEC 65

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD  +P C +C   K+ C
Sbjct: 39 KSKTGCDNCKRRRVKCDEGKPFCKKCTNMKLDC 71

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 6/38 (15%)

Query: 11 TYSGCWTCRARKVKCDL------VRPSCLRCRRSKVQC 42
          T+  C  C+ +K+KCDL      V P C  CRRS+  C
Sbjct: 34 TFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHC 71

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 10  KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           K+ +GC  C+ R+VKCD  +P C +C + ++ C
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLSC 116

>Kwal_14.2619
          Length = 1167

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSK--VQCGGYKIKLRWSPLLHF 57
          R+    + C TCR RKVKCD  +P CL C + K   +C  Y++K R    LH 
Sbjct: 4  RAFNIGTSCLTCRRRKVKCDRSKPVCLACIKYKSISEC-SYEVK-RGVKFLHM 54

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          MD  + +  +    C  C+  K KCD +RP+C RC+++ +QC
Sbjct: 1  MDSITVKKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQC 42

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
           with heme-dependent DNA-binding activity, responsible
           for heme-dependent activation of many genes [4509 bp,
           1502 aa]
          Length = 1502

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 15  CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
           C  CR RKVKCD +RP C +C ++ V    + ++  W+
Sbjct: 64  CTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWA 101

>Kwal_56.23058
          Length = 775

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 25/41 (60%)

Query: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           D K+ +   + +GC  C+ R++KCD  +P+C +C R   +C
Sbjct: 136 DGKTVKRKYSRNGCTECKRRRMKCDEGKPTCWQCARLNREC 176

>Kwal_23.6529
          Length = 598

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 5  STRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRW 51
          ST++ ++  GC  C+  K+KCD  +P C +C +       Y + L+W
Sbjct: 4  STKNQRSRGGCINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQW 50

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
           C  CR RKVKCD  RP C +C ++ V    + ++  W+
Sbjct: 22 SCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQNWA 60

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ + C  CR +K+KCD   PSC RC + +V C
Sbjct: 29 KSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPC 61

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKI 47
          K  +S  +  GC  C+    KCD  +P+CL+C +  V+C  YK+
Sbjct: 10 KKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNVEC-TYKV 52

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSP 53
          C  CR  K KCD  +PSC RC ++ ++C  Y I+ +  P
Sbjct: 28 CKACRKSKTKCDREKPSCTRCIKNGIEC-VYDIEQQTQP 65

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRS 38
          R +K    C  CR RKV CD VRP C  C R+
Sbjct: 6  RKMKKPPACAQCRRRKVGCDRVRPVCGNCARA 37

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGVPMPSNESITTTE 74
          C  CR  K +CD  +P C RC++ K++C  Y +  + +P +         PS ++     
Sbjct: 27 CQACRRSKTRCDKEKPICTRCKKLKLEC-VYDMAKQSAPRI---------PSKDATIARL 76

Query: 75 GDDVE 79
          G DV+
Sbjct: 77 GRDVD 81

>Scas_588.11
          Length = 835

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRS-KVQCGGYKIKLRWSP 53
          R ++    C  CR RK+ CD V+P C  CR++ K  C    I  R+ P
Sbjct: 6  RKMRKPPACVQCRKRKIGCDRVKPICGNCRKTNKGDCFFPDIPGRYVP 53

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           D K T+   + +GC  C+ R++KCD  +P C +C R   +C
Sbjct: 184 DPKRTKRKYSRNGCTECKRRRMKCDEGKPICWQCSRLNREC 224

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSP 53
          C  CR  K KCD  +P C RC ++ V+C  Y I+ + +P
Sbjct: 32 CQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRAP 69

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 15  CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
           C  CR RKVKCD  RP+C +C ++ V    + ++  W+
Sbjct: 71  CTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQAWA 108

>Kwal_26.6732
          Length = 676

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ +GC TCR R+ KCD  +P C  C  + +QC
Sbjct: 7  RSVTGCLTCRKRRKKCDERKPVCTGCESNFLQC 39

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCG 43
          M   S + VK    C  C+ RK+KCD + P+C +C+ S   C 
Sbjct: 1  MSIASQKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSICS 43

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +GC  C+ R+VKCD  +P C +C    + C
Sbjct: 43 KSKTGCDNCKRRRVKCDEGKPGCKKCSNLNLVC 75

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 2   DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           D K  +   + +GC  C+ R++KCD  +P+C +C R   +C
Sbjct: 142 DGKIVKRKYSRNGCLECKKRRMKCDEGKPTCWQCARLNRKC 182

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 13  SGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +GC  C+ R++KCD  +PSC +C R   +C
Sbjct: 162 NGCTECKKRRMKCDEGKPSCWQCTRLNREC 191

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSP 53
          C  CR RK+KCD  RP C++C    + C  Y I+ + +P
Sbjct: 25 CLECRRRKIKCDKQRPCCIQCAEQGLTC-VYDIERQPAP 62

>Kwal_26.6805
          Length = 944

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C +CR  K KCD  +PSC RC +  ++C
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGIRC 56

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 20/42 (47%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +  K  +S  +  GC  C+    KCD  +P C RC +  + C
Sbjct: 57 LSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDC 98

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 8   SVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           S +    C  CRA+K++CD  RP C +C     +C
Sbjct: 176 SYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFEC 210

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +R  ++   C  CR +K+KCD ++P+C  C++    C
Sbjct: 20 SRQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHC 56

>Scas_699.7
          Length = 935

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
           C  CR +K+KC   +P C +C ++  +C  Y  K R SPL    L  V
Sbjct: 12 ACDLCRVKKLKCSKEKPKCAKCLKNNWEC-CYSPKTRRSPLTRAHLTKV 59

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+ +  K    C  CR  K KCD  +PSC RC+R    C
Sbjct: 10 KAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>Kwal_34.15751
          Length = 628

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR RK+KC+  +PSC RC +  +QC
Sbjct: 15 CDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
          C  CR RKVKCD  RP C +C ++ V    + ++  W+
Sbjct: 19 CTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQTWA 56

>Scas_590.2
          Length = 1172

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          + C  CR RK KCD   PSC  C ++ V+C
Sbjct: 39 TACLLCRRRKQKCDHQLPSCTACLKAAVKC 68

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 7/57 (12%)

Query: 4   KSTRSVKTYSGCWTCRARKVKCDLVR-------PSCLRCRRSKVQCGGYKIKLRWSP 53
           +S R  K    C  CR +K+KCD +         SC  CR+   +C   +I L+  P
Sbjct: 106 ESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGP 162

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 9  VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRW 51
          ++ ++GCW CR +K +CD   P C  C +    C  Y ++L W
Sbjct: 18 IRCFTGCWACRFKKRRCDEGVPFCALCVKHGDAC-SYDVRLVW 59

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
          C  CR RKVKCD  RP C +C ++ V    + ++  W+
Sbjct: 25 CTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQTWA 62

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
           C +CR RK+KC    P C +CR     C  Y  K+R SPL    L  V
Sbjct: 8  ACDSCRRRKMKCSKTFPKCAKCREDNRVC-LYSPKIRRSPLTRAHLTEV 55

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          R +K    C  CR RK+ CD V+P C  C + +K+ C
Sbjct: 6  RKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDC 42

>Scas_663.12
          Length = 944

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR  KVKCD  +P C RC +  ++C
Sbjct: 40 CQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 5  STRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          + RS  + +GC  C+ RKVKCD  +P+C +C     +C
Sbjct: 12 ARRSKYSKNGCSECKRRKVKCDETKPACWQCSHLGKRC 49

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          + C  CR +KVKCD   PSC  C R+ V C
Sbjct: 23 NACKLCRRKKVKCDQGYPSCKGCLRNNVPC 52

>Scas_661.23
          Length = 741

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 3   KKSTRSVKTYS--GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           KK+    + YS  GC  C+ R++KCD  +P C +C R   +C
Sbjct: 118 KKTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLSREC 159

>Kwal_23.2905
          Length = 881

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ + C  CR RKVKCD   PSC RC  +   C
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPC 76

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C +CR  K KCD V+PSC RC ++   C
Sbjct: 39 CQSCRRSKTKCDKVKPSCTRCVKNGSVC 66

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 2  DKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPL 54
          D  S + ++    C  C+ RK+KCD  +P C  C ++ VQC  YK     SP+
Sbjct: 15 DNGSKQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQC-VYKFTDTASPI 65

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 3  KKSTRSV-KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K+S+ ++ ++ + C  CR RK+KCD   PSC +C +++  C
Sbjct: 7  KESSGNIYRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPC 47

>Kwal_55.20674
          Length = 252

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 1  MDKKSTRSVKTYSG----CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ ++T+  K  SG    C +CR RK KC   +P C RC R  + C
Sbjct: 3  LNSRATKMGKDRSGAMFTCKSCRQRKRKCSREKPQCQRCARLSIPC 48

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 8  SVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          SV+    C  CR +K+KCD ++P+C  C +    C
Sbjct: 39 SVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPC 73

>Scas_720.58
          Length = 890

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 1  MDKKSTRSVKTY----SGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLH 56
          ++K +TR  K        C  CR +K+KC    P C +C ++ ++C  Y  K++ SPL  
Sbjct: 2  IEKNTTRLSKALDIIEQACDNCRLKKLKCSKETPKCSKCLKNGMKC-LYSPKVKRSPLTR 60

Query: 57 FDL 59
            L
Sbjct: 61 VHL 63

>Scas_556.6
          Length = 1022

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR  K KCD  +P+C RC +  + C
Sbjct: 46 CQECRKAKTKCDKEKPACTRCVKQNLAC 73

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIK 48
          +GC  C+ +KVKCD  +P C +C    ++C  YK K
Sbjct: 26 NGCLECKRKKVKCDETKPMCWQCTHLSLEC-VYKTK 60

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  CR  + KCD  +P+C RC + K+ C
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKIDC 32

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 11  TYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           + +GC  C+ R++KCD  +P C +C R    C
Sbjct: 200 SRNGCAECKRRRMKCDESKPKCWQCTRLNRDC 231

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR  K KCD  +P+C RC +  ++C
Sbjct: 23 CQGCRKAKTKCDKEKPACSRCLKHGIRC 50

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          T+ VK    C  CR RK+ CD  +P C  C ++ K  C
Sbjct: 7  TKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDC 44

>Scas_688.17
          Length = 769

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          TR  K    C  CR RK+ CD   P C  C +  + QC
Sbjct: 8  TRKPKKNPACIQCRKRKIGCDRGHPKCGNCIKLKRAQC 45

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR RK +CD   PSC  C ++ V+C
Sbjct: 41 CLLCRRRKQRCDHKLPSCTACLKAAVKC 68

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRR 37
          K+  +  K    C  CR RK+KCD  +P C  C R
Sbjct: 25 KRPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCAR 59

>Scas_625.5
          Length = 1141

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 6/87 (6%)

Query: 7   RSVKTYSGCWTCRARKVKCDLVRPS--CLRCRRSKVQCGGYKIKLRWSPLLHFDL---YG 61
           +  K    C  CR +K+KCD       C  C+R+  +C   ++ L+  P   +       
Sbjct: 67  KRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGYTRNHSKS 126

Query: 62  VPMPSNES-ITTTEGDDVETSTNLRRN 87
            P  ++E+ I   +  + ET  ++ RN
Sbjct: 127 TPQTTHETDINHNKSQNYETERDMNRN 153

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C TCR R+ KCDL  P C+ C++  V+C
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVEC 40

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 6/42 (14%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++K+S+R      GC TCR R  KCD  +P C  C+ + ++C
Sbjct: 24 VEKRSSR------GCLTCRDRHKKCDEKKPLCSGCKENFLRC 59

>Kwal_26.8109
          Length = 970

 Score = 36.6 bits (83), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 7  RSVKTYSGCWTCRARKVKCDLV--RPSCLRCRRSKVQCGGYKIKLRWSP 53
          R  KT   C  CR +K +CD     P C  C+R    C   ++ ++  P
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGP 79

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 36.2 bits (82), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
            C  CR R+VKCD  RP C RCR+  ++C
Sbjct: 6  QSCDCCRVRRVKCDRNRP-CDRCRQRNLRC 34

>Scas_526.3
          Length = 1109

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  CR RK +CD   PSC  C ++ V+C
Sbjct: 40 SCLLCRRRKQRCDHKMPSCTACLKAAVKC 68

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 36.2 bits (82), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLR 50
           C  CR R+ KCDL  P C RC+   + C   K+ LR
Sbjct: 40 ACANCRRRRKKCDLEYP-CGRCQELGLGCNINKVDLR 75

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
           C  CR +K+KC   +P C +C ++  +C  Y  K + SPL    L  V
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWEC-RYSPKTKRSPLTRAHLTEV 57

>Scas_709.51
          Length = 759

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++  + ++    C  C+ RKVKCD  +P CL C + ++ C
Sbjct: 22 ERKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDC 60

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          R   +  GC TC+ RK +C   RP C  C R  + C
Sbjct: 12 RRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDC 47

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCG 43
          K +T   K    C  CR  K KCD ++P+C RC    + CG
Sbjct: 12 KPNTHKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYCG 52

>CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces
          cerevisiae YKL038w RGT1, hypothetical start
          Length = 1287

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 2  DKKSTRSVKTYSGCWTCRARKVKCD--LVRPSCLRCRRSKVQCGGYKIKLRWSP 53
          DKK T   +    C  CR +K+KCD    R  C  C+R+  +C   ++ L+  P
Sbjct: 6  DKKRTNVSR---ACDQCRRKKIKCDRNQERNICTSCQRNGERCKFERVPLKRGP 56

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++ + C  CR +KVKCD   PSC +C  +   C
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPC 70

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 10 KTYSGCWTCRARKVKCDLVRP---SCLRCRRSKVQC 42
          ++   C  CR RK++CD V P    C  C + KV+C
Sbjct: 36 RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCR-RSKVQC 42
          KK+ +  K    C  CR RK++CD  +P C  C+ R +  C
Sbjct: 19 KKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRSGC 59

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  CR RK +CD   PSC  C ++ ++C
Sbjct: 40 SCLLCRRRKQRCDHKLPSCTACLKAGIKC 68

>Scas_711.31
          Length = 932

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 18/34 (52%)

Query: 9  VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +K    C  CR +K+KCD   P C  C ++ + C
Sbjct: 39 IKRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWS 52
          +T   C  C+ RK+KCD  RP+C  C  + V      ++  W+
Sbjct: 23 RTTVVCTNCKKRKIKCDRKRPACSNCSVANVAEYCQYVQPNWA 65

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          GC TC+ RK +C   +P C  CRR    C
Sbjct: 16 GCITCKIRKKRCSEDKPVCRDCRRLSFPC 44

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLRWSPLLHFDLYGV 62
          K+ TR  +   GC  C+   +KCD  +P C +C +  + C  Y++ L +  +    L  +
Sbjct: 14 KRKTRYSR--KGCLQCKRSHLKCDEGQPKCGKCVKRNISC-TYQLSLVFQDVSQSKLKSM 70

Query: 63 PM 64
          P+
Sbjct: 71 PV 72

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          R +K    C  CR RK+ CD  +P C  C R  K  C
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDC 44

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          R  K +  C  CR ++ KCD+ RP C  C +  ++C
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKV-QC 42
          K  +  K    C  CR RK+KC   RP C +C   K+ QC
Sbjct: 20 KKGKRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKLPQC 59

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRS 38
          R +K    C  CR RK+ CD  +P C  C R+
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPICGNCLRN 39

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCG 43
           C  C  RKVKC+  RP C  C +++  C 
Sbjct: 37 NCMPCHKRKVKCNRARPVCDHCEKNRYACA 66

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 4   KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCR-RSKVQC 42
           K  +  K    C  CR RK+KCD  RP C  C+ R   +C
Sbjct: 79  KVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSEC 118

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRCRR 37
           R V+    C  CR RK+ CD  +P C  C +
Sbjct: 6  VRKVRKPPACTQCRKRKIGCDRAKPICGNCVK 37

>Kwal_27.10232
          Length = 1209

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 19/37 (51%)

Query: 6   TRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           T + +    C  CR++K +CD  RP C +C     +C
Sbjct: 65  TSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K STR  K    C +CR RK+KC+ ++P C  C     +C
Sbjct: 19 KPSTRRTKVGKACDSCRRRKIKCNGLKP-CPSCTIYGCEC 57

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 975

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR  K KCD  +P C RC +  ++C
Sbjct: 35 CQACRKNKTKCDREKPRCGRCVKYHLKC 62

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  C+ RK KCD   PSC  C ++ V+C
Sbjct: 40 ACLLCQRRKQKCDHKIPSCTACLKAGVKC 68

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 1   MDKKSTRSVKTYSGCWTCRARKVKCDLVRP---SCLRCRRSKVQC 42
           + K+  R+ K    C  CR RK KCD V P    C  C ++ V C
Sbjct: 167 LHKEKRRAAK---ACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
          Transcription factor required for derepression of
          gluconeogenic enzymes, contains an N-terminal
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
          bp, 1433 aa]
          Length = 1433

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  CR++K +CD  RP C +C     +C
Sbjct: 69 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 97

>Kwal_26.6664
          Length = 579

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLR 50
          M+KK     +    C  C   K KC+  +P C RC R  +QC  Y  +LR
Sbjct: 1  MNKKQITRNRPVKACIKCYNGKRKCNKAKPVCGRCARLHLQC-LYSAELR 49

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%)

Query: 4  KSTRSVKTYS--GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          KS +    YS  GC  C+   +KCD V+P C  C +  + C
Sbjct: 48 KSKKPKVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNILC 88

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR  K KCD  +P C RC +  + C
Sbjct: 25 CQACRKAKTKCDQEKPRCGRCTKQNLFC 52

>Scas_696.44
          Length = 1164

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 8   SVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +++    C  CR++K +CD  RP C +C     +C
Sbjct: 74  NLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFEC 108

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 17/33 (51%)

Query: 10  KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +    C  CR++K +CD  RP C +C     +C
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 105

>Kwal_23.6425
          Length = 735

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 5  STRSVKTYSGCWTCRARKVKCDLVRPSCLRC-RRSKVQC 42
          S +  K+   C  CR RK+KCD  RP C  C  R   +C
Sbjct: 26 SRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTEC 64

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 5   STRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLR 50
           ++R  K    C  CR R+ KCDL  P C  C +  ++C   +  LR
Sbjct: 66  TSRPTKKRLACSNCRRRRKKCDLQYP-CFTCDKLGLECNINEEDLR 110

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  C  RK+KCD  +P C  C ++  +C
Sbjct: 45 SCVACHKRKIKCDRAKPVCESCGKNGWEC 73

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 6  TRSVKTYS-GCWTCRARKVKCDLVRPSCLRCRRSKVQC-GGYKIKLRWSPLLHFDL 59
          TR+ K +S  C  CR++K+KCD ++P C  C +    C    K+  R  P  + DL
Sbjct: 19 TRTKKRHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGYTDL 73

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  CR RK KCD  +PSC  C +    C
Sbjct: 21 CLNCRRRKTKCDRGKPSCSNCLKLGETC 48

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRC 35
          K    C  CR R+VKC+  RP C  C
Sbjct: 14 KVSKSCVFCRKRRVKCNKARPKCSTC 39

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 7  RSVKTYSGCWTCRARKVKCDLV--RPSCLRCRRSKVQCGGYKIKLRWSP 53
          +  K    C  CR +K+KCD    +  C  C+R+  +C   ++ L+  P
Sbjct: 39 KRTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGP 87

>AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W
          (EDS1) - NSH] complement(550291..552861) [2571 bp, 856
          aa]
          Length = 856

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVR--PSCLRCRRSKVQCGGYKIKLRWSP 53
          R  K    C  CR +K+KC+      SC  CR++  +C   ++ L+  P
Sbjct: 38 RRTKVSRACDQCRRKKIKCEYQEDAQSCSGCRKNSERCAFERVPLKRGP 86

>Scas_715.3
          Length = 1115

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 13/63 (20%)

Query: 1   MDKKSTRSV-------KTYSGCWTCRARKVKCDLVR---PSCLRCRRSKVQCGGYKIKLR 50
           MD+  T S        +  + C  CR +K+KCD  +     C RC++  +QC   +I  R
Sbjct: 85  MDRMRTESFSHNSLNHRPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMALQC---QIDPR 141

Query: 51  WSP 53
           + P
Sbjct: 142 FKP 144

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K    C +C+ RKV+CD   P C  C  ++V+C
Sbjct: 31 KVKHACSSCKERKVRCDGQSP-CASCINARVKC 62

>Kwal_47.17506
          Length = 924

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K  RS K    C  CR RK+KC   +P CL C+  + +C
Sbjct: 9  KKKRS-KVSRACNNCRRRKIKCTGAQP-CLNCQTYRCEC 45

>Scas_657.3
          Length = 856

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQCGGY 45
          + C  CR RK+KCD  RP C  C   K+    Y
Sbjct: 43 TSCAFCRQRKLKCDQKRPICSTCIGRKLTTCVY 75

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 14/25 (56%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSK 39
          C  CR RK+KCD  RP C  C   K
Sbjct: 40 CAFCRRRKLKCDNARPMCSTCVSRK 64

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +T   C  C + K KCD  +PSC RC +  + C
Sbjct: 21 RTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPC 53

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 9   VKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           ++    C  C+ RKVKCD   P CL C + + +C
Sbjct: 81  LRVQKACELCKKRKVKCDGNNP-CLNCSKHQKEC 113

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 6/39 (15%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          K TRS      C  C+ RK KCD   PSC  C +   +C
Sbjct: 7  KPTRS------CLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>Scas_659.10
          Length = 757

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 17/33 (51%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSK 39
          R  K    C  CR RK+KCD  +P C +C   K
Sbjct: 13 RRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRK 45

>Scas_637.7
          Length = 998

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%)

Query: 14  GCWTCRARKVKCDLVRPS---CLRCRRSKVQC 42
            C  CR RK+KCD V PS   C  C +    C
Sbjct: 105 ACDHCRKRKIKCDKVDPSTGKCSNCLKYNANC 136

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  C+ RK +CD   PSC  C ++ V+C
Sbjct: 41 CLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (53%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRC 35
          K    C  CR RK+KCD  +P C  C
Sbjct: 14 KVIKSCLFCRKRKLKCDHKKPKCSTC 39

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 33.1 bits (74), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          C  C   K KCD  +P C RC +  ++C
Sbjct: 66 CQACWKSKTKCDREKPECGRCVKHGLKC 93

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          KKSTRS K  + C  CR RK+KC    P C  C      C
Sbjct: 4  KKSTRS-KVSTACVNCRKRKIKCTGKYP-CTNCISYDCTC 41

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 1  MDK-KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRR 37
          MD+ K  R       C  CR RK+KCD  +P C RC R
Sbjct: 1  MDRSKDARKRSISLACTVCRKRKLKCDGNKP-CGRCIR 37

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRC 35
          ++   C  CR +K KCD   PSC RC
Sbjct: 35 RSIVACERCRTKKTKCDQNFPSCARC 60

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 18/40 (45%)

Query: 1  MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKV 40
          M K      K    C  C+ARKVKCD   P+C  C    V
Sbjct: 1  MSKPKISLTKGKHPCTFCQARKVKCDRSLPACQNCIERNV 40

>Scas_630.14
          Length = 701

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 13/22 (59%)

Query: 14 GCWTCRARKVKCDLVRPSCLRC 35
           C  CR RK KCD ++P C  C
Sbjct: 25 SCTVCRLRKSKCDRIKPYCSSC 46

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          + ST + +    C  CR +K KCD   P C +C     +C
Sbjct: 48 RGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87

>Kwal_26.7448
          Length = 714

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 14  GCWTCRARKVKCDLVRPSCLRCR----RSKVQCGGY 45
           GC  C+ R++KCD   P C  C+    +   QC  Y
Sbjct: 94  GCDECKRRRIKCDETLPECNNCKNRHNKGPSQCCSY 129

>Kwal_47.18089
          Length = 745

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKV 40
           C  CR RK+KCD  RP C  C   K+
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKL 54

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQCGGYKIKLR 50
           C  CR R+ KCDL  P C  C R K++C      LR
Sbjct: 46 ACTNCRRRRKKCDLNYP-CSSCLRLKLECNVNDEDLR 81

>Kwal_47.17233
          Length = 948

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 17/36 (47%)

Query: 7  RSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          R  +    C  C  RK+KC    PSC +C +   +C
Sbjct: 27 RRQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWEC 62

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 10  KTYSGCWTCRARKVKCDLVR---PSCLRCRRSKVQC 42
           +  + C  CR  K+KC+       SC RC R  +QC
Sbjct: 87  RPVTSCTHCRQHKIKCNASENFPSSCSRCERMGLQC 122

>Kwal_55.21884
          Length = 882

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 3/43 (6%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPS---CLRCRRSKVQC 42
          K S R  +    C  CR +K KCD    +   C RC +  V C
Sbjct: 19 KSSRRGRRKKLACVECRQQKSKCDAHEKAPEPCTRCAKKNVAC 61

>Kwal_56.24670
          Length = 643

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 13 SGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +GC  C+ RK +C   +P+C  C R    C
Sbjct: 25 TGCIPCKIRKKRCSEHKPTCTDCERLGFTC 54

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 14 GCWTCRARKVKCDLVRP---SCLRCRRSKVQC 42
           C  CR RK+KCD + P    C  C + KV C
Sbjct: 33 ACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Kwal_33.13934
          Length = 797

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRR 37
          C  C+ RK KCD ++P C  C R
Sbjct: 23 CTNCKRRKSKCDRLKPICGNCSR 45

>KLLA0E17831g complement(1572985..1574901) some similarities with
           sp|P38069 Saccharomyces cerevisiae YBR015c TTP1 type II
           membrane protein, hypothetical start
          Length = 638

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 17/112 (15%)

Query: 486 GSTKMNTLGADALNALPNSLVLLFYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFED- 544
            ST+   L  + L   P  L+ L+Y+    + YY    ++S G E   E F+    F D 
Sbjct: 401 ASTESGQLMINKLKHFPTVLLSLYYNVYGPSWYYSIFSQRSSG-EGDKETFIAAAHFYDL 459

Query: 545 KLSNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYE 596
                +SE             P ++G + H    + G+C+  ++F   QDY+
Sbjct: 460 PFYQVRSE-------------PRVDGYHRHNNEGFRGVCMLQHDFA--QDYK 496

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          T+       C  CR R+VKCD  RP C  C ++ + C
Sbjct: 4  TKQTCAKQACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 4  KSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          +S R+ + YS C  CR  K KC    P+C  C ++   C
Sbjct: 12 RSQRTTELYS-CARCRKLKKKCGKQIPTCANCDKNGAHC 49

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
          Transcription factor involved in drug-induced
          transcriptional regulation, including activation of
          multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 3  KKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRC 35
          KK  + +K+   C  CR RK++CD  +P C  C
Sbjct: 45 KKRNKLIKS---CGFCRRRKLRCDQQKPMCSTC 74

>Kwal_47.16862
          Length = 743

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 6/35 (17%)

Query: 14 GCWTCRARKVKC------DLVRPSCLRCRRSKVQC 42
           C  C A+K KC      D+ R  C+RCR+    C
Sbjct: 59 ACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLC 93

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 15 CWTCRARKVKCDLVRPSCLRCRR 37
          C  C+ RK KCD  +P+C  C R
Sbjct: 13 CSNCKRRKSKCDKQKPACSNCVR 35

>Kwal_14.819
          Length = 568

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 14/29 (48%)

Query: 14 GCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           C  CR RKV+C    P C  C +   +C
Sbjct: 15 SCRQCRDRKVRCSRQIPKCKSCTKRNCEC 43

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 12  YSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
           +  C  CR +K KC    P+C  C +  + C
Sbjct: 92  HQACDACRKKKWKCSKTVPTCTNCLKYNLDC 122

>Kwal_27.10239
          Length = 914

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 55/118 (46%), Gaps = 23/118 (19%)

Query: 541 EFEDKL--SNWKSEWDFFDSTGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESL 598
           EF+D++  ++   ++DFFD++G  ++  +IE +     S Y+G      +FI        
Sbjct: 191 EFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAIVHFI-------- 242

Query: 599 NVEVWKVIYHLQQIEFLKDSSAGKEGIKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDT 656
                 +   ++ +E+LK  +    G+  +  +   F +G        +SEF+T+ ++
Sbjct: 243 -----SIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSG--------KSEFQTFSNS 287

>ABL172C [420] [Homologous to ScYDL230W (PTP1) - SH] (79451..80533)
           [1083 bp, 360 aa]
          Length = 360

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 558 STGRNFLSPTIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFL 615
             GR     T++ + H T  F  G+C  Y + +  Q    L ++  K++  LQQ EF+
Sbjct: 291 GVGRTGTYITLDHLIHDTRDFTEGVCEDYSHDLIEQIVMQLRMQRLKMVQLLQQYEFI 348

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 6  TRSVKTYSGCWTCRARKVKCDLVRPSCLRCRR 37
          T  +K+   C  C  RKVKCD + P C  CR+
Sbjct: 5  TTQLKSKHPCSVCTRRKVKCDRMIP-CGNCRK 35

>Scas_680.25
          Length = 738

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 10 KTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQC 42
          ++YS C  CR  K KC    PSC  C ++   C
Sbjct: 12 ESYS-CSRCRRLKKKCPRQTPSCANCEKAHATC 43

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,603,322
Number of extensions: 903606
Number of successful extensions: 2653
Number of sequences better than 10.0: 195
Number of HSP's gapped: 2604
Number of HSP's successfully gapped: 208
Length of query: 691
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 582
Effective length of database: 12,822,747
Effective search space: 7462838754
Effective search space used: 7462838754
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)