Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H04917g31829214270.0
YDR088C (SLU7)3823186421e-81
Kwal_56.234073413376052e-76
Scas_636.113533465897e-74
KLLA0F14531g3412833781e-42
AGR159C2662771576e-12
Sklu_2273.227166710.47
Scas_638.1178873672.4
CAGL0L07062g48680645.0
Sklu_2384.332862635.1
YOR132W (VPS17)551108635.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H04917g
         (313 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces c...   554   0.0  
YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...   251   1e-81
Kwal_56.23407                                                         237   2e-76
Scas_636.11                                                           231   7e-74
KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775 Saccha...   150   1e-42
AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH] (1044766..1...    65   6e-12
Sklu_2273.2 YHR167W, Contig c2273 1577-2392                            32   0.47 
Scas_638.11                                                            30   2.4  
CAGL0L07062g 787292..788752 similar to sp|Q05166 Saccharomyces c...    29   5.0  
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            29   5.1  
YOR132W (VPS17) [4934] chr15 (573175..574830) Peripheral membran...    29   5.5  

>CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces
           cerevisiae YDR088c SLU7, hypothetical start
          Length = 318

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/292 (94%), Positives = 276/292 (94%)

Query: 22  HIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEF 81
           HIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEF
Sbjct: 22  HIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEF 81

Query: 82  EVIVENKKTTIDGIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEES 141
           EVIVENKKTTIDGIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEES
Sbjct: 82  EVIVENKKTTIDGIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEES 141

Query: 142 AYDTDEEIEMMKLGLTPKDLEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDD 201
           AYDTDEEIEMMKLGLTPKDLEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDD
Sbjct: 142 AYDTDEEIEMMKLGLTPKDLEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDD 201

Query: 202 LGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLE 261
           LGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLE
Sbjct: 202 LGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLE 261

Query: 262 VLRKQKELDSLKLTEEQNRQEQXXXXXXXXXXXXXXXXPKGTPQSDSTKAQL 313
           VLRKQKELDSLKLTEEQNRQEQ                PKGTPQSDSTKAQL
Sbjct: 262 VLRKQKELDSLKLTEEQNRQEQRKLKRKAKLLKKKAKKPKGTPQSDSTKAQL 313

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score =  251 bits (642), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 187/318 (58%), Gaps = 66/318 (20%)

Query: 22  HIPNYIKNLPWYYQDI------------DKNSKNNSKEQDYLRHHRQRRDDKTIDIDNND 69
           HIP YI+N PWYY+D             D ++    ++ DYL HHRQ+     +DIDNN 
Sbjct: 32  HIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGGALDIDNNS 91

Query: 70  QAKIGTGIKDEFEVIVENKKTTID------------------------------------ 93
           + KIG GIKDEF++I   K +  D                                    
Sbjct: 92  EPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPDLNS 151

Query: 94  ----GIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDL-----NNTTEESAYD 144
               G +  R  + DWD+RKDRWYGYSGKEY E++ KWE+ + +       + T+E+ +D
Sbjct: 152 QKNNGTVLVRATDDDWDSRKDRWYGYSGKEYNELISKWERDKRNKIKGKDKSQTDETLWD 211

Query: 145 TDEEIEMMKL-------GLTPKDLEQN--IKGSSVRLREDKAAYLKDIYSSTTNYDPKSR 195
           TDEEIE+MKL       G   KD   N  +  +S RLREDKAAYL DI S+ +NYDPKSR
Sbjct: 212 TDEEIELMKLELYKDSVGSLKKDDADNSQLYRTSTRLREDKAAYLNDINSTESNYDPKSR 271

Query: 196 LYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVA 255
           LYK++ LG++DE S MF RHLTGEG +LN+LN+FAR +AKE GIRDE+ D +KV HVLVA
Sbjct: 272 LYKTETLGAVDEKSKMFRRHLTGEGLKLNELNQFARSHAKEMGIRDEIEDKEKVQHVLVA 331

Query: 256 NPTKLEVLRKQKELDSLK 273
           NPTK E L+K++E +  K
Sbjct: 332 NPTKYEYLKKKREQEETK 349

>Kwal_56.23407
          Length = 341

 Score =  237 bits (605), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 150/337 (44%), Positives = 186/337 (55%), Gaps = 61/337 (18%)

Query: 22  HIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQ-RRDDKTIDIDNNDQAKIGTGIKDE 80
           HIP YIK+ PW+Y+D+      + +  DYL HHR+  R D  +DIDNN + KIG GIKDE
Sbjct: 16  HIPKYIKDQPWFYKDL---KSGDDQSNDYLSHHRRLNRPDSDLDIDNNAEPKIGRGIKDE 72

Query: 81  FEVIVE--------------------------------NKKTTIDGIIKRRKD-EKDWDA 107
           +E   E                                  K+ +   I RRKD   +WDA
Sbjct: 73  YEGYSEVVTSRVRPKCNNCGGMDHIRRDCLEAPRKRPATTKSVLKSSILRRKDMSGNWDA 132

Query: 108 RKDRWYGYSGKEYEEVLKKWE--KSREDLNNTTEESAYDTDEEIEMMKLGL--------- 156
           ++DRW+GY GKEYE+ L+ WE  K +E   N   E   DTDEEIE+  LGL         
Sbjct: 133 QRDRWFGYEGKEYEDTLRTWETAKDKESQGNDEIEDLIDTDEEIELAALGLYKDEVTGAV 192

Query: 157 TPKDLEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHL 216
            P D   +   +SVRLRED+AAYL DI S T NYDPKSRLYKS+DLG ID  S MF RHL
Sbjct: 193 APDDENGSRLRASVRLREDRAAYLNDINSETLNYDPKSRLYKSEDLGEIDTESKMFHRHL 252

Query: 217 TGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQKELDSLKLTE 276
           TGE  EL  L++FARE    +GIRDE+ D  K NHVLVANPTK E+L KQ + ++  LT 
Sbjct: 253 TGESLELAKLSRFAREKTLAAGIRDEVEDDAKTNHVLVANPTKYELLMKQDK-NTAPLTL 311

Query: 277 EQNRQEQXXXXXXXXXXXXXXXXPKGTPQSDSTKAQL 313
           E+  + Q                  GT QSD  ++QL
Sbjct: 312 EERYRNQTAKKIT------------GTKQSDEQRSQL 336

>Scas_636.11
          Length = 353

 Score =  231 bits (589), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 197/346 (56%), Gaps = 69/346 (19%)

Query: 22  HIPNYIKNLPWYYQDIDKNSKNNSKE-QDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDE 80
           HIP YIK  PWYY+D   N+K   K+ +DYL+HHR +  D T+D  +ND+  IG GI D+
Sbjct: 18  HIPRYIKTQPWYYKD--GNAKPEGKDDEDYLKHHRNK--DHTLD--HNDEPSIGAGISDK 71

Query: 81  F---------EVIVEN---KKTTIDGI-------------------------IKRRKDEK 103
           F           + +N   +K T  G                          IK R DE+
Sbjct: 72  FITTETKTLKTTMSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYSGDQIKIRNDEE 131

Query: 104 -DWDARKDRWYGYSGKEYEEVLKKWE-KSREDL----NNTTEESAYDTDEEIEMMKLGL- 156
            DWDA+KDRW+GY GKEY E+L+ WE K + +L    N   E + +D+DEEIE+MKLGL 
Sbjct: 132 LDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSDEEIELMKLGLY 191

Query: 157 ------TPKDLEQNI---KGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDE 207
                   KD   N      +SVRLRED+AAYL D+ S T NYDPKSR+YKS++LGSIDE
Sbjct: 192 KDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRIYKSEELGSIDE 251

Query: 208 HSNMFLRHLTGEGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQK 267
            S MF RHLTGEG ELN+LN F R +A+++GIRDE+ D+ KV HVLVANPTK E L ++K
Sbjct: 252 KSKMFRRHLTGEGIELNELNSFTRAHARQTGIRDEVEDSHKVEHVLVANPTKYEQLMREK 311

Query: 268 ELDSLKLTEEQNRQEQXXXXXXXXXXXXXXXXPKGTPQSDSTKAQL 313
                    +QN   +                P GT Q++ TK +L
Sbjct: 312 ---------KQNLPTERQNEDSTTPQSPMTQKPVGTAQTEETKDEL 348

>KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775
           Saccharomyces cerevisiae YDR088c SLU7 pre-mRNA splicing
           factor affecting 3 splice site choice singleton,
           hypothetical start
          Length = 341

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 153/283 (54%), Gaps = 57/283 (20%)

Query: 22  HIPNYIKNLPWYYQDIDKNSKNNS-------------------KEQDYLRHHRQRR---- 58
           HIPN+IKN PWY  +  + S + S                   +E+DYL HHR ++    
Sbjct: 24  HIPNFIKNKPWYLAEESEVSASTSAINSNSTISGTGTGTGTELEEKDYLSHHRLKKSSVP 83

Query: 59  DDKTIDIDNNDQAKIGTGI----KDEFEVIVENKKTTIDGIIKRRKD---EKDWDARKDR 111
           D  T +ID+       +G     KD +++        +D  ++RR +   E ++DA++DR
Sbjct: 84  DSGTAEIDDAFTYVRPSGRNRKKKDSYDL-------DLDAPVRRRDEKVIESNYDAKRDR 136

Query: 112 WYGYSG--KEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKDL----EQNI 165
           WYGY+   KE E   K  + S  +++    +         EM +LGL P+D+     Q +
Sbjct: 137 WYGYTPDIKEIERNHKGPDTSHREMDEVQIQ---------EMERLGLKPEDVGFDATQPL 187

Query: 166 KG-----SSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEG 220
            G     + VRLREDKAAYL+D+ S    YDPKSR+YKS + G+ID  S MF RHLTG+ 
Sbjct: 188 SGPKEKYNPVRLREDKAAYLQDMSSEEMLYDPKSRIYKSKEEGTIDPKSKMFHRHLTGDA 247

Query: 221 KELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVL 263
            ++  +N+  R+ A  SGI+D  V+ +K+NHV  ANPTK E++
Sbjct: 248 LQVGVINERVRQEAVRSGIKDFEVNKEKLNHVFAANPTKYELM 290

>AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH]
           (1044766..1045566) [801 bp, 266 aa]
          Length = 266

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 103/277 (37%), Gaps = 77/277 (27%)

Query: 22  HIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEF 81
           HIP YI++ PWY +  D ++       DYL HHR+   +   D     Q  +   I D F
Sbjct: 6   HIPKYIRDKPWYVESGDDDA-------DYLGHHRREPGEGAQDFSVAQQGSV---ISDRF 55

Query: 82  EVIVENKKTTIDG--------------IIKRRKDEK----------------DWDARKDR 111
                 +     G              +++ RK  +                 ++A++DR
Sbjct: 56  VAGSAPRAGRGRGRCTNCGANHDRRDCLLRPRKQARGDGGERAFQVRDENALSFEAKRDR 115

Query: 112 WYGYSGKEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKDLEQNIKGSSVR 171
           WYG+ G     V                 +A D    +E  KLGL  +     +   ++R
Sbjct: 116 WYGFEGPVAPAVAAA--------AAEPPAAAEDAAAAVERYKLGLDARAARAGVGAPAIR 167

Query: 172 LREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKFAR 231
            R D+A YL D+    T YDPKSR+Y                R     G+     ++  R
Sbjct: 168 PRHDRARYLDDVRGEETRYDPKSRVY----------------RGDGAAGEAPAAPDRAGR 211

Query: 232 ENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQKE 268
                        D   V+HV+ ANPT+LE+ R+  E
Sbjct: 212 -------------DGSTVDHVISANPTRLELGRQTPE 235

>Sklu_2273.2 YHR167W, Contig c2273 1577-2392
          Length = 271

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 85  VENKKTTIDGIIKRRKD----EKDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEE 140
           +ENK    D   K  KD     + WD+ ++  +G SG   ++V++K E  ++DL+N+ E 
Sbjct: 204 LENKYLLKDLFEKLTKDVANWRQQWDSLENMLFGESGNSMKKVVQKIESLKKDLDNSPEP 263

Query: 141 SAYDTD 146
           +  D D
Sbjct: 264 ADGDVD 269

>Scas_638.11
          Length = 788

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 13/73 (17%)

Query: 94  GIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEESAYD------TDE 147
           G+IK   DEK ++  K R     GKE+E+ LK W        NT E + +D       ++
Sbjct: 244 GMIK--PDEKTFEYVKGRPLAPKGKEFEKALKYWRTL-----NTDEGAQFDHIVTIKAED 296

Query: 148 EIEMMKLGLTPKD 160
            I  +  G +P+D
Sbjct: 297 VIPTITWGTSPQD 309

>CAGL0L07062g 787292..788752 similar to sp|Q05166 Saccharomyces
           cerevisiae YDL088c ASM4 or sp|Q03790 Saccharomyces
           cerevisiae YMR153w NUP53, hypothetical start
          Length = 486

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 134 LNNTTEESAYDTDEEIEMMKLGLTPKDLEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPK 193
           L +T  E+  +T   I +   G    D  +  K SS  L++       DIY+STT+Y P 
Sbjct: 98  LRSTGNENKSETSSGIHLKNNGFNLADFSK--KDSSDLLQKKDNLGATDIYNSTTDYPPT 155

Query: 194 SRLY---KSDDLGSIDEHSN 210
           + L+   + D+ G +   SN
Sbjct: 156 TSLHDWQREDEFGIVQTASN 175

>Sklu_2384.3 YKL018W, Contig c2384 6547-7533
          Length = 328

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 183 IYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKFARENAKESGIRDE 242
           IYSST          KS D+  ++  +N +LR+ TG G  ++D+     E+   S   DE
Sbjct: 84  IYSSTM---------KSFDIRHLNLETNQYLRYFTGHGALVSDIEMSPLEDVFLSASYDE 134

Query: 243 LV 244
            V
Sbjct: 135 SV 136

>YOR132W (VPS17) [4934] chr15 (573175..574830) Peripheral membrane
           protein required for vacuolar protein sorting, mutant
           displays fragmented vacuoles [1656 bp, 551 aa]
          Length = 551

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 7/108 (6%)

Query: 27  IKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEFEVIVE 86
           + N  +  +++ +  +N+  +Q+  R  R RRD   + ID   + ++    K+E  + ++
Sbjct: 353 LTNRHFIMRNLVQAQQNSKAKQEQARRFRSRRDINPMKIDEALR-QLKAAAKNEQVLTLK 411

Query: 87  NKKTTIDGIIKRRKDEKDWDARKDRWYGYSGKEYEEVLKKWEKSREDL 134
            ++ T + II+R    K W +  + W   S KE+   L+K E  R+ L
Sbjct: 412 LQRITSNMIIER----KQWISWYEEWIRSSIKEF--TLRKIEYERKKL 453

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.129    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,726,696
Number of extensions: 537466
Number of successful extensions: 2372
Number of sequences better than 10.0: 150
Number of HSP's gapped: 2342
Number of HSP's successfully gapped: 161
Length of query: 313
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 212
Effective length of database: 13,099,691
Effective search space: 2777134492
Effective search space used: 2777134492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 61 (28.1 bits)