Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H02805g1219120059280.0
YJL074C (SMC3)1230121334350.0
Scas_711.391227121433110.0
AAL182W1231123028110.0
Kwal_14.24351247121127820.0
KLLA0A00286g1280122226770.0
KLLA0D16005g11708043755e-36
CAGL0D05258g11707153122e-28
Scas_565.611703132987e-27
AGR236W11702742816e-25
Scas_707.2312237352405e-20
YFR031C (SMC2)11703712333e-19
Kwal_55.2042111702212031e-15
Kwal_56.2382513967582022e-15
YFL008W (SMC1)12253572012e-15
Sklu_2249.210835661984e-15
CAGL0F02079g12232611879e-14
Scas_681.414091091879e-14
CAGL0L12188g13981991852e-13
YLR086W (SMC4)14182481833e-13
AGR089C13701031781e-12
Kwal_23.504312253551752e-12
KLLA0F19085g13721031743e-12
KLLA0D07502g1243731611e-10
Scas_643.1110952761403e-08
AEL337C10972611252e-06
AGL023W12221731206e-06
KLLA0F07997g11192271143e-05
AER044W11031891143e-05
Kwal_26.720411172001117e-05
YOL034W (SMC5)1093224980.003
CAGL0F01155g110548960.005
Scas_719.6109679960.005
KLLA0E05247g1098173880.038
Kwal_26.93801102110870.046
ACR068W1805188820.22
YLR383W (RHC18)111483810.24
AGL335W69156800.32
CAGL0H05071g1110358800.33
CAGL0F04719g704135780.50
Scas_636.1460853780.60
Kwal_33.13526129881770.77
YDR091C60853760.82
KLLA0C02915g1296111770.88
CAGL0G08756g135456770.89
Kwal_26.948071947751.2
KLLA0E11572g1848254751.4
YFR015C (GSY1)708151741.6
Kwal_56.2342953953732.0
CAGL0G08041g60753732.2
AGR125W60753732.3
KLLA0C01991g70687722.8
CAGL0K10626g69675723.1
KLLA0E21362g392104713.4
KLLA0F19888g4915166723.7
Sklu_2429.670675713.9
YNL121C (TOM70)617103704.2
KLLA0E21406g38058704.3
Kwal_23.335630187694.6
Scas_706.21130445705.4
CAGL0L01221g99449696.7
YJL109C (UTP10)176956688.1
Scas_587.871550688.1
CAGL0J07788g130545688.2
KLLA0D16236g87199689.3
Kwal_14.205773387689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H02805g
         (1200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  2288   0.0  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  1327   0.0  
Scas_711.39                                                          1280   0.0  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  1087   0.0  
Kwal_14.2435                                                         1076   0.0  
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  1035   0.0  
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...   149   5e-36
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...   124   2e-28
Scas_565.6                                                            119   7e-27
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...   112   6e-25
Scas_707.23                                                            97   5e-20
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    94   3e-19
Kwal_55.20421                                                          83   1e-15
Kwal_56.23825                                                          82   2e-15
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...    82   2e-15
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          81   4e-15
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    77   9e-14
Scas_681.4                                                             77   9e-14
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    76   2e-13
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    75   3e-13
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    73   1e-12
Kwal_23.5043                                                           72   2e-12
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    72   3e-12
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...    67   1e-10
Scas_643.11                                                            59   3e-08
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    53   2e-06
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...    51   6e-06
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    49   3e-05
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    49   3e-05
Kwal_26.7204                                                           47   7e-05
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    42   0.003
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    42   0.005
Scas_719.6                                                             42   0.005
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    39   0.038
Kwal_26.9380                                                           38   0.046
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...    36   0.22 
YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved i...    36   0.24 
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    35   0.32 
CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces c...    35   0.33 
CAGL0F04719g 475180..477294 highly similar to sp|P27472 Saccharo...    35   0.50 
Scas_636.14                                                            35   0.60 
Kwal_33.13526                                                          34   0.77 
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    34   0.82 
KLLA0C02915g 261280..265170 similar to sp|P12753 Saccharomyces c...    34   0.88 
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...    34   0.89 
Kwal_26.9480                                                           33   1.2  
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...    33   1.4  
YFR015C (GSY1) [1696] chr6 complement(174257..176383) UDP-glucos...    33   1.6  
Kwal_56.23429                                                          33   2.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    33   2.2  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    33   2.3  
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    32   2.8  
CAGL0K10626g complement(1031704..1033794) highly similar to sp|P...    32   3.1  
KLLA0E21362g complement(1900927..1902105) some similarities with...    32   3.4  
KLLA0F19888g complement(1839682..1854429) similar to sp|Q12019 S...    32   3.7  
Sklu_2429.6 YLR258W, Contig c2429 11089-13209 reverse complement       32   3.9  
YNL121C (TOM70) [4474] chr14 complement(398684..400537) Mitochon...    32   4.2  
KLLA0E21406g 1904841..1905983 highly similar to sp|P38716 Saccha...    32   4.3  
Kwal_23.3356                                                           31   4.6  
Scas_706.21                                                            32   5.4  
CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces c...    31   6.7  
YJL109C (UTP10) [2806] chr10 complement(211917..217226) Componen...    31   8.1  
Scas_587.8                                                             31   8.1  
CAGL0J07788g complement(757051..760968) similar to sp|P12753 Sac...    31   8.2  
KLLA0D16236g complement(1366718..1369333) weakly similar to sp|P...    31   9.3  
Kwal_14.2057                                                           31   9.6  

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 2288 bits (5928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1142/1200 (95%), Positives = 1142/1200 (95%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
            DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
            QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXF 360
            KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITE               F
Sbjct: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEIIDSKKSKRRKISPRF 360

Query: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420
            DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA
Sbjct: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420

Query: 421  STTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDAR 480
            STTELKEQKSSIDVK                GPGIKAEIEDIEKELINLRRKYTANIDAR
Sbjct: 421  STTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTANIDAR 480

Query: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540
            KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT
Sbjct: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540

Query: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600
            VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG
Sbjct: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600

Query: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660
            NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT
Sbjct: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660

Query: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720
            LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID
Sbjct: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720

Query: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780
            STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE
Sbjct: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780

Query: 781  KLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTITAEL 840
            KLTQLKID                           QNKLNLTSETLSHLSVEIDTITAEL
Sbjct: 781  KLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITAEL 840

Query: 841  ESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIES 900
            ESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIES
Sbjct: 841  ESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIES 900

Query: 901  TKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGII 960
            TKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGII
Sbjct: 901  TKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGII 960

Query: 961  SEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDD 1020
            SEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDD
Sbjct: 961  SEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDD 1020

Query: 1021 SKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNS 1080
            SKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNS
Sbjct: 1021 SKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNS 1080

Query: 1081 ELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFY 1140
            ELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFY
Sbjct: 1081 ELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFY 1140

Query: 1141 LFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSVIE 1200
            LFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSVIE
Sbjct: 1141 LFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSVIE 1200

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 1327 bits (3435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1213 (55%), Positives = 907/1213 (74%), Gaps = 15/1213 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            MYIKRVIIKGFKTYRNETII +FSPH NV+IG+NGSGKSNFFAA+RFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            RQGLIHQG+G SVMSASVEIVFHDP+HS+I P+G+ S G  DEV IRRTVGLKKDDYQ+N
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGD-DEVTIRRTVGLKKDDYQLN 119

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
            DRNVTKGD+VRMLE+AGF M+NPYNIVPQG+IV+LTNAKDKERLQLLE+VVGAKSFEVKL
Sbjct: 120  DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            KAS+K+M+ETEQK+ QI+ EM EL SKL+EME+ERKELEKYN LER+RK+ ++TL+DREL
Sbjct: 180  KASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDREL 239

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
             ++I+Q+E LDGDYN+T+ SS++YI EL+KRE+MI +V++++ +++ SLK+K   DL+QA
Sbjct: 240  NEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQA 299

Query: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXF 360
            K    E  ++   + +++KD++++I+ N+EQ + D   LK I                 +
Sbjct: 300  KLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRY 359

Query: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420
             +L  EE + K  L    +KQ + +LKKG YARFKSK+ERD WI+S+I+EL  SI  +  
Sbjct: 360  QELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNE 419

Query: 421  STTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDAR 480
              ++L+  ++S+  +                GP  K ++ED + ELI+L++K + ++D R
Sbjct: 420  LESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTR 479

Query: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540
            KE WR+EQKLQ + ++L+++V +N+R++NETMSRSLANG  NVKEI E+L +  ESVFGT
Sbjct: 480  KELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGT 539

Query: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600
            +GELI+VN+KYK CAEVIGGNSLFH+VVDT+ETA+++MNEL+RMKGGRVTF+PLN+L + 
Sbjct: 540  LGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL-SL 598

Query: 601  NQNIDYPSDPN--IPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSC 658
            + ++ +PS+    I  TPLIKKIKY+ +F+  VK VFG+ +VVKDL  GL ++K++KL+ 
Sbjct: 599  DSDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNA 658

Query: 659  ITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDND 718
            ITLDGDR D +GVLTGGYL+Q K++RLE L+ +  S+ Q  +I  +L  ++NEL ++D  
Sbjct: 659  ITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTK 718

Query: 719  IDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVS 778
            ID  NG+IR V N +E++ +N+  ++  L+ ++NE L L++    I  K++ ++ N   +
Sbjct: 719  IDQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFA 778

Query: 779  GEKLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTITA 838
             EKL   + D                            NKLN+TS+ L  ++  ID++ A
Sbjct: 779  QEKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNA 838

Query: 839  ELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEI 898
            ELESKLIPQ+ND++ K+ +  D+ I  L  + +EL+      + Q       L ++++EI
Sbjct: 839  ELESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREI 898

Query: 899  ESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVG 958
            ES  AE TN +++LEKANNQQRLLLKKLD +QK V+KTMIKKTTL TR++E++Q+IRE+G
Sbjct: 899  ESLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIG 958

Query: 959  IISEDTL-DKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATE 1017
            ++ ED L + F  ++S+ LL +LN+ N EISG++N+NKRAFEN+KKFNE++ +L ERA+E
Sbjct: 959  LLPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASE 1018

Query: 1018 LDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTD 1077
            LD+SK SIQDLI+KLK+QK+NAVD TF KVS+NF  +FE++VPRGTA L IHR N    D
Sbjct: 1019 LDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNAND 1078

Query: 1078 DNS----ELFTQSNEHTTP------YEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127
             +     ++  +SNE          Y GVSISVSFNSKQ+EQL VEQLSGGQKTVCAIAL
Sbjct: 1079 HDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIAL 1138

Query: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFY 1187
            ILAIQMV+PA FYLFDEIDAALDKQYR AVA  + +LS NAQFICTTFR+DM+  A+KF+
Sbjct: 1139 ILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFF 1198

Query: 1188 RVKYENKQSSVIE 1200
            RVKYENK S+VIE
Sbjct: 1199 RVKYENKISTVIE 1211

>Scas_711.39
          Length = 1227

 Score = 1280 bits (3311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1214 (54%), Positives = 876/1214 (72%), Gaps = 20/1214 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            MYIKRV+IKGFKTYRN+T+I DFSPHHN+VIG+NGSGKSNFF+A+RFVLSDDYSNLKREE
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            RQGLIHQG+G SVMSASVEIVFHDPEH +I P+G+    ++DE+ IRRTVGLKKDDYQ+N
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
            DRNVTKGD+VRMLES GF MSNPYNIVPQG+I+SLTNAKDKERLQLLE+VVGAKSFEVKL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            KAS+K+M+ETEQKRA+I+ EM+EL SKL EME+ERKELEKYN+LE++RKV ++TL+DREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
             DII+Q+E LD DYN T  SS++YI EL+KRE +I  +++ +  +  +LK+K T DL QA
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXF 360
            K+   E   +   +++Q+KD+K +IK  + Q ++D+K L +I +               F
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420
             +L  EE   K    +  ++Q + LLKKG YARF S EER+EWI ++I+E  +++  +  
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 421  STTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDAR 480
               ++  ++  I+ K                GP +  E+E I+ EL  L+ +Y A+ID R
Sbjct: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480

Query: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540
            KE WR EQK++ +  +L+  VK  ER++NETM RSLANG K+VKEI  +L L  +SVFGT
Sbjct: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540

Query: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600
            +GELI VNEKYK+CAEV+GGNSLFH+VVDT+ETA+I+M EL++MKGGRVTF+PLN++   
Sbjct: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIY-L 599

Query: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660
            + NI YP +     TPLI KIKYD +FD  V+ +FG+ +VVKDLT GL ISK++KL+ IT
Sbjct: 600  DANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSIT 659

Query: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720
            LDGDR D +GVLTGGY +Q K+SRL+ L T+  S  +  E+S +LT IK  + E+D++ID
Sbjct: 660  LDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNID 719

Query: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780
            + N SIR     +E++ SN+   K KL +++N+ + L++    +  K +  ++N+ V+ +
Sbjct: 720  TLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTAD 779

Query: 781  KLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTITAEL 840
            K      D                           + KL LT+E L  ++ E++++ AEL
Sbjct: 780  KKETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEMNSLNAEL 839

Query: 841  ESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIES 900
             SKL PQ+ DI  ++     S +  L  D + +  +     NQ     + + +I+KEIE 
Sbjct: 840  NSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIED 899

Query: 901  TKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGII 960
             K+E  N ++ILEKAN+QQRLLLKKL+ +QKDV+KTMIKKT L TR+ E++QKIRE+G++
Sbjct: 900  LKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLL 959

Query: 961  SEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDD 1020
            +ED L+ F  LSSE+LL +LN  +++ISG++N+NKRA+EN++KF+EKQ EL ERATELD+
Sbjct: 960  AEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDE 1019

Query: 1021 SKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNS 1080
            SK SIQDLI +L++QK+ AVD TF KV++NF  +FEK+VP G A L IHR+     D+N+
Sbjct: 1020 SKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRV-----DNNA 1074

Query: 1081 ELFTQSNE--------------HTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIA 1126
             + T SN+              + + Y GVSISVSFNSK++EQL VEQLSGGQKTVCAIA
Sbjct: 1075 RMETNSNDDDVDMDQEDEVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIA 1134

Query: 1127 LILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKF 1186
            LILAIQMV+PAPFYLFDEIDAALDKQYR AVA  I QLS NAQFICTTFR+DM+  A++F
Sbjct: 1135 LILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRF 1194

Query: 1187 YRVKYENKQSSVIE 1200
            +RVKYENK S+VIE
Sbjct: 1195 FRVKYENKISTVIE 1208

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1230 (47%), Positives = 828/1230 (67%), Gaps = 49/1230 (3%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            MYIK+VII+GFKTY+N+T I +FSPHHNVV+G NGSGKSNFFAA+RFVLSDDY+NLKREE
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            R+ LI+QG  +SVMS  VEIVFH  E+  +   G    G    + IRRTVGLKKD+Y +N
Sbjct: 61   RRSLIYQGT-SSVMSGYVEIVFHGAENRTL--LGAQDGGV---IHIRRTVGLKKDEYMIN 114

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
            ++N ++ D+ R+LESAGF  SNPYNIVPQGRIVSLTNA+++ERLQLLEEV+GAKSFE KL
Sbjct: 115  NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKL 174

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            K S+++M+ TE+ R +I  E+EE+E+KLNE+++ERKELEKYNSL+R RK+ ++ L+DREL
Sbjct: 175  KESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDREL 234

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
             ++ S +E LDG+Y +TL  S++YI ELEKRE++I+ + + +  L   LK+K + DL+QA
Sbjct: 235  NEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQA 294

Query: 301  KAILEESLERSEAIK-LQLKDIKEKIKQN---KEQHDNDRKNLKLITEXXXXXXXXXXXX 356
            K   +  LE ++ +  L +K  +E I QN   KEQ  ++ ++L  I              
Sbjct: 295  K---DSELELAKHLADLNVK-YEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARL 350

Query: 357  XXXFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESIN 416
               F+QL  EE  +K   K   ++Q + L K+G Y++F++K ERD WI+ ++  L E + 
Sbjct: 351  SPRFEQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQ 410

Query: 417  TMKASTTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTAN 476
                + T + E++ S+ +K                GPGI AE+ED+++EL  L++ +   
Sbjct: 411  CSSIALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFK 470

Query: 477  IDARKEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTES 536
            ID RK+ WR EQK+Q + +SLV++VK  E +L+ETM RSLA G KNV EI +RLNL   S
Sbjct: 471  IDERKQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGS 530

Query: 537  VFGTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNK 596
            VFG +GELI+++EKYK CAEV+GG SLFHVVVDT+ TA++LM EL+  KGGRVTF+PLN+
Sbjct: 531  VFGPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNR 590

Query: 597  LKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKL 656
            + + + NI YPS+    CTPLIKKIKYD +F+  +K VFG+ +VVKDL  G  ++KQ++L
Sbjct: 591  V-HVDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRL 649

Query: 657  SCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMD 716
            + ITLDGD+ D +GVLTGG+ +  K+ RL+ ++ +   K++     ++L E+K +L  +D
Sbjct: 650  NAITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSID 709

Query: 717  NDIDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLG 776
             +ID  N  I+  M+R+E + + +     KL   + E   L++    +  K +   +N  
Sbjct: 710  QEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQK 769

Query: 777  VSGEKLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTI 836
            +  +KL     D                           +N LN T++ LS + V+ID++
Sbjct: 770  LLQDKLDMYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSL 829

Query: 837  TAELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRA-----L 891
             AEL+SKL PQ  +++    D  + I+    + + +    A E + +  +++++     +
Sbjct: 830  KAELDSKLKPQAKELE----DQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEV 885

Query: 892  QSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIE 951
            Q I + I++ K+    +E+ LEKAN+QQR LLKKLD YQK+ +K+M++K TL+TR+ E++
Sbjct: 886  QKISEIIDTLKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQ 945

Query: 952  QKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSEL 1011
            QKIR++G++ +D+ DK+  +SS +LL +L+  N +IS M N+NKRA EN+KKF++KQ ++
Sbjct: 946  QKIRDIGLLPDDSADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDV 1005

Query: 1012 RERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI 1071
             +RA ELD+SK+SI+ LI KLK+QK+ AV+ TF KVS+NF  +FEK+VPRGT  L IHR 
Sbjct: 1006 MKRAKELDESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRR 1065

Query: 1072 ---------------------NLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQL 1110
                                 ++   DD  E  +Q     + Y GVSI VSFNSK+DEQ+
Sbjct: 1066 ENEPSKPSKRQQKKRKRQETEDVHFNDDQDENSSQD----SIYSGVSIEVSFNSKKDEQV 1121

Query: 1111 KVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQF 1170
             VEQLSGGQKTVCAIALILAIQMV+PAPFYLFDEIDAALDKQYR AVA T+ QLS+ AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1171 ICTTFRSDMVDAANKFYRVKYENKQSSVIE 1200
            ICTTFR DM+  A++FYRV +ENK S+V+E
Sbjct: 1182 ICTTFRGDMIAVADRFYRVNFENKISTVVE 1211

>Kwal_14.2435
          Length = 1247

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1211 (46%), Positives = 810/1211 (66%), Gaps = 22/1211 (1%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            MYI+ V+I+GFKTYRN T + DFSPH NVVIG NGSGKSNFFAAVRFVLSDDYS+LKREE
Sbjct: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            RQGLIHQG G S+MSA VEIVFHDP   ++  +GI        VR+RRT+GLKKD+Y VN
Sbjct: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGIPVT-EEHIVRVRRTIGLKKDEYSVN 142

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
             +   K D+ RM ES GF  SNPYNIVPQGRIV++TNAKDKERL LLE+VVGA+SFE+KL
Sbjct: 143  GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKL 202

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            + S K+M+ T + RA+I++E+ EL+++L E+++ER+ELEKY  LERDR++ ++ L+DREL
Sbjct: 203  RESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQFVLYDREL 262

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
             ++ SQIESL+ +YN+ L SS++YI EL KRE +I  + + I N++  LKLK + D +Q 
Sbjct: 263  NEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQD 322

Query: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXF 360
            K+ L+E ++R   ++++ ++ K +  Q   Q    RKNL  + E               +
Sbjct: 323  KSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRY 382

Query: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420
            +QL+ E +  +  L +   KQ   + K+G YA+F+++ ERD WI  ++  L    + +K 
Sbjct: 383  EQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKELSSLKAQTDDLKK 442

Query: 421  STTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDAR 480
            +   ++ +K  +  +                GPGI +E++DI+  L +L+R Y   ID R
Sbjct: 443  NVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEKIDER 502

Query: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540
            KE WR EQ+LQ +S++L++ VK +ER+L+ETM R+LANG K V+EI +RL L   +V G 
Sbjct: 503  KELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGAVHGP 562

Query: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600
            +GELI+VNEKYK CAE +GGNSL HVVVDT+ETASILM+EL+  K GRVTF+PLN++ + 
Sbjct: 563  LGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNRISDR 622

Query: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660
            N  + +P +    CTPL+ KIKYD  F+  V+ VFGR +VV+DL NG  +++ Y L  +T
Sbjct: 623  NA-VTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLDAVT 681

Query: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720
            LDGDR D +GV+TGGY +  K++RL+ L+ ++ +K QL + +  L  ++ ++  +D++ID
Sbjct: 682  LDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDSEID 741

Query: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780
            + NG ++    RK+ + +N+   + K+S    +  F  +    +  K++ +  +L V+ E
Sbjct: 742  NVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTVNEE 801

Query: 781  KLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTITAEL 840
            K+ + + D                              +  T+E LS LS+ ID +  EL
Sbjct: 802  KIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLKTEL 861

Query: 841  ESKLIPQQNDIKQKLLD--SSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQ----SI 894
              KL PQ+ D++ +L +  S D      L  + ELE  A E   +L ++++ LQ    S+
Sbjct: 862  NVKLNPQKRDLENRLEEEYSRDD-----LTTNRELEHMADEL-KKLAVKEQDLQTSLASL 915

Query: 895  EKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKI 954
             + I +   E  N +++LEKA++QQR L+KKLD +QK+ +K++IKKT+L TR+ E++ +I
Sbjct: 916  TEAIGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQLRI 975

Query: 955  REVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRER 1014
             E+G++SE++L++ + L +E +L KLN  N +IS M NIN+RA EN+KKFN+K+ +L  R
Sbjct: 976  SEIGLLSEESLERHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESR 1035

Query: 1015 ATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI--- 1071
            A EL+ SK+SI+ L+  LK+QK+ AV+ TF KV+ NF  IFEK+VP G   L IHR    
Sbjct: 1036 AEELEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEK 1095

Query: 1072 NLQGTDDNSELFTQSNEHT----TPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127
            + +GT   S  ++  N +     + Y GVSISVSFNSK +EQL VEQLSGGQKTVCAIAL
Sbjct: 1096 SNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIAL 1155

Query: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFY 1187
            ILAIQMV+PAPFYLFDEIDAALDKQYR +VA TI +LS +AQFICTTFR+DM+  A+ FY
Sbjct: 1156 ILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFY 1215

Query: 1188 RVKYENKQSSV 1198
            RVK+ENK S +
Sbjct: 1216 RVKFENKISEI 1226

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1222 (46%), Positives = 813/1222 (66%), Gaps = 40/1222 (3%)

Query: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
            ++IK VII GFKTY+N T++ +FSPHHNVV+G+NGSGKSNFFAA+RFVLS++ SNLKRE+
Sbjct: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117

Query: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120
            R+G I+QGAG  VMSA VEI+F DPE+ ++AP   N  G   EVRIRRTVGLKKD+Y +N
Sbjct: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAPLR-NDTG---EVRIRRTVGLKKDEYMIN 172

Query: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180
            D+N T+ D+ R+LE+ GF  SNPYNIVPQGRI+SLTNAKD ERL LLE+VVGAKSFE KL
Sbjct: 173  DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKL 232

Query: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240
            K S+K+M+  E+ R +I+ E+ EL+ +L+E+  E++ELEKYN+L RDRKVL++ L+DREL
Sbjct: 233  KESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDREL 292

Query: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300
             DI +QIE L+G+YN  + +S +Y+ ELEKRE +  E+N+ + +L+  +K+K + DL Q 
Sbjct: 293  NDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQL 352

Query: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXF 360
            KA   E       +  +L DI+ ++  ++   +++ K +  + +               F
Sbjct: 353  KASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKF 412

Query: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420
             +L +E +++K  +++  ++Q   L KKG Y  F++  ER++WI  +I  L++S+N    
Sbjct: 413  QKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNI 472

Query: 421  STTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDAR 480
               +L  Q S++                   G G  A+ ED++ ++   +++Y   ID R
Sbjct: 473  LKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEYLTKIDQR 532

Query: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540
            K+ WR EQ+LQ IS SL N+VK  E  +NET+ RSLA G +NV +I  RLNL  E VFG 
Sbjct: 533  KQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH-EHVFGP 591

Query: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600
            VGELI+V++KYK+CAEV+GGNSLF+VVVD +ETAS+L+ ELF  KGGRVTF+PLNKL + 
Sbjct: 592  VGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL-HV 650

Query: 601  NQNIDYPSD-PNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCI 659
            + N  YP++     CTPLIKKIKYD++F+ V+KQVFGR LVVK L +G S++K+YKL+ I
Sbjct: 651  DTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYKLNAI 710

Query: 660  TLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDI 719
            TLDGDR D KGVL+GGYL+Q K +RL+ L+    SKR+  +I  +L EIK  L  ++ +I
Sbjct: 711  TLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQSIEQEI 770

Query: 720  DSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSG 779
            D  N  ++     ++  ++ +   + +L  + ++ + +      +  +++ +D  L    
Sbjct: 771  DGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDTELEQCR 830

Query: 780  EKLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLNLTSETLSHLSVEIDTITAE 839
            E+      D                           +  LN    TL+ LS ++D + AE
Sbjct: 831  ERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAE 890

Query: 840  LESKLIPQQNDIKQKLLDSSDSIIEQL-------LLDSEELEGRASEADNQLTIQKRALQ 892
            L SKL+P+ +++++K   S    I Q+       L++ + +     + +++L++      
Sbjct: 891  LNSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSV------ 944

Query: 893  SIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQ 952
             ++  I+S + E    ++ L+KAN+QQR L+K++  +QK+ +K ++KK+TL +RK+E++Q
Sbjct: 945  -LDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQ 1003

Query: 953  KIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELR 1012
             IREVG+++E++L K+K L+S+++L KLN     +S M N+NKRA ENY +F +K+ EL 
Sbjct: 1004 LIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELT 1063

Query: 1013 ERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNI-HRI 1071
             RA ELD+SKQSI++LI +LKEQK+ A++KTF+KV+ NF  +F  +VPRG   L I HR 
Sbjct: 1064 SRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRK 1123

Query: 1072 NLQGTDDNSELFTQSNE-------------HTTPYEGVSISVSFNSKQDEQLKVEQLSGG 1118
            N     DNSE+ T+                + + Y GVSI VSFNSK+DEQL+VEQLSGG
Sbjct: 1124 NT----DNSEVSTKKRRRGARQEQNSAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGG 1179

Query: 1119 QKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSD 1178
            QKTVCAIALILAIQMV+PAPFYLFDEIDAALDKQYR AVA+TI  LS+ AQFICTTFR+D
Sbjct: 1180 QKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTD 1239

Query: 1179 MVDAANKFYRVKYENKQSSVIE 1200
            M++ A+ F+RVK+ENK S+V E
Sbjct: 1240 MINVADTFFRVKFENKVSTVTE 1261

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
           Saccharomyces cerevisiae YFR031c SMC2 chromosome
           segregation protein, start by similarity
          Length = 1170

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 201/804 (25%), Positives = 362/804 (45%), Gaps = 133/804 (16%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I D+ P  N + G NGSGKSN   A+ FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTV---GLKKDD 116
             Q LI++   A V  ASV IVF++ + S  +P G  S+    ++ I R +   G+ K  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFNNSDTSN-SPIGFESHA---KISITRQIILGGVSK-- 114

Query: 117 YQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSF 176
           Y +N     +  ++++ +S    ++NP  ++ QG+I  + N K +E L L+EE  G + F
Sbjct: 115 YLINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQEILSLIEEAAGTRMF 174

Query: 177 EVKLKASMKQMDETEQKRAQISAEM-EELESKLNEMEKERK----------ELE------ 219
           E + + + + M + E K  +I   + EE+E KL     E++          +LE      
Sbjct: 175 EDRREKAERTMAKKETKLQEIRTLLTEEIEPKLERFRNEKRTYLEFQETQSDLENVMRVV 234

Query: 220 ---KYNSLERDRKVLRYTLHD-----RELQDIIS----QIESLDGDYNDTLGSSKKYILE 267
              +++ L   +K +  +LH       EL+D IS    ++E+L  D  D L   +   ++
Sbjct: 235 NAFEFSQLSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLGSDL-DALKEQRHKEVQ 293

Query: 268 LEKRENMIKEVNEEIKNLQKSLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQ 327
           L  R + ++    EI N           +L + +  L  +LE S   K+++ ++K+ I++
Sbjct: 294 LGGRMSELETKESEISN-----------ELSRVQTSLNIALEDSGEEKVRISNLKKNIER 342

Query: 328 NKEQHDNDRKNLKLITEXXXXXXXXXXXXXXXFDQLQSEEKLIKHHLKE--CIEKQNNFL 385
            K Q   ++K L                    +D    E  +    L+E   I K+   L
Sbjct: 343 WK-QQHQEKKTL--------------------YDSKYKEYNIQNKKLEELKAIHKEKQEL 381

Query: 386 LKKGSYARFKSKEERDEWINSKIKELSESINTMKASTTELKEQKSSIDVKXXXXXXXXXX 445
           L   +     +    + +               + ST + K Q + I+++          
Sbjct: 382 LSTLTTGISSTGTTANGY-------------NFQLSTIKEKLQNTRIEIREKEMEVEMLK 428

Query: 446 XXXXXXGPGI---KAEIEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVK 502
                  P I   KAE E  +KE+ N++  +  N++ + E++  +         L+  +K
Sbjct: 429 EELNSNTPKISAAKAEKEKYDKEIQNMQH-HCNNLEKQLEQYGYD-------PILLKNLK 480

Query: 503 ENERSL----------NETMSRSLANGFKNVKEICERLNLGTESVFGTVGELIQVNEK-- 550
           +NERSL           E++ R ++N   N   +    N    SV G VG+L  ++E   
Sbjct: 481 DNERSLKHTHYQLSQETESLHRKVSNLDFNY--VPPSKNFDVSSVKGVVGQLFTLDEANI 538

Query: 551 -YKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG--NQNIDYP 607
                 +V  G  LF+VVVD + TAS L+ E  R++  RVT +PLNK+ +   N++I + 
Sbjct: 539 DSSAALQVCAGGRLFNVVVDNERTASQLL-EHGRLR-KRVTIIPLNKISSRRINESILHL 596

Query: 608 SDPNIP--CTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNG--LSISKQYKLSCITLDG 663
           +    P      I  I ++ +    ++ +FG + + +D      ++ + + +   ITL G
Sbjct: 597 AKELAPGKVELAINLIGFEEEVTRAMEFIFGTSFICRDAETAKQITFNPRIRSRSITLQG 656

Query: 664 DRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDIDSTN 723
           D  D +G L+GG    S    L++        ++    S++L +++N+L E+ + I    
Sbjct: 657 DVYDPEGTLSGGSRNSSNSLLLDI--------QKYNHASSRLKQVENDLQEVGSQIKDQ- 707

Query: 724 GSIRLVMNRKENMQSNLNTWKHKL 747
              ++     +N+ S LN   HKL
Sbjct: 708 ---QMKAENSKNVLSELNLATHKL 728

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 20/208 (9%)

Query: 991  RNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKN 1050
            R +N       +   +K++ L+     ++  KQ IQ+ I KL E K   + KT++KVS +
Sbjct: 980  RKVNPEVMSMIESVEKKETALKTMIKTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVD 1039

Query: 1051 FVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQL 1110
            F  IF  ++P   A L                  + +E     EG+ + V       E L
Sbjct: 1040 FGNIFGDLLPNSFAKL------------------EPSEGKDVTEGLEVKVKLGKIWKESL 1081

Query: 1111 KVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQF 1170
               +LSGGQ+++ A++LILA+   +PAP Y+ DE+DAALD  + + +   I      +QF
Sbjct: 1082 V--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1171 ICTTFRSDMVDAANKFYRVKYENKQSSV 1198
            I  + +  M   AN+ +R ++++  S V
Sbjct: 1140 IVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 179/715 (25%), Positives = 312/715 (43%), Gaps = 121/715 (16%)

Query: 536  SVFGTVGELIQV---NEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFM 592
            SV G   EL  +   N KY +  ++  G  L++V+VD ++T S L+ +  R++  RVT +
Sbjct: 522  SVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQK-GRLRK-RVTII 579

Query: 593  PLNKLKNGNQNIDYPSDPN-IPCTPLIKKIKYDMQF------DCVVKQ---VFGRALVVK 642
            PL+K+      I  P + N +     +   K ++        D VVK    +FG +L+  
Sbjct: 580  PLDKV------ISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVKAMEFIFGNSLICD 633

Query: 643  DLTNG--LSISKQYKLSCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSK----- 695
            D      ++ +   +   ITL+GD  D +G L+GG    +    +++ Q   L K     
Sbjct: 634  DAETAKKITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNTLKKELLAM 693

Query: 696  --------RQLLEISAKLTEIKN---ELTEMDNDID----STNGSIRLVM-NRKENMQSN 739
                    +QL  + AK  E  N   EL+   + +D    + N    L+M NR   +++ 
Sbjct: 694  NEEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMNSEPSLMMQNRNGEIENE 753

Query: 740  LNTWKHKLSHERNELLFLQQEKTNICEKI--DSVDLNLGVSGEKLTQLKIDXXXXXXXXX 797
            + T +     +  E   L+ E     EK+  D VD +    G KL +LK +         
Sbjct: 754  VKTLEDSTKQKMLENSSLEAE----IEKLRKDMVDFSKN-KGAKLKELKAEVHELNEQIK 808

Query: 798  XXXXXXXXXXXXXXXXXXQNKLNLTSETLS----HLSVEIDTITAELESKLIPQQNDIKQ 853
                                KLN T E +      ++ EIDT T  L+S +     DI++
Sbjct: 809  DLESESE-------------KLNDTYEKIKVETEQIANEIDTDTKSLDSTV----QDIEK 851

Query: 854  KLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIESTKAEITNKERILE 913
            KL    +  I ++L  SEE         N L ++++ + +I+ E+E  +  I  KE    
Sbjct: 852  KL--EEEIKINKMLKTSEE---ELMSVQNDLNVERKRISNIDDELEELERTIKQKE---- 902

Query: 914  KANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKF--KTL 971
            ++ N   L LK+L       D +  K +T       IE+ + ++    E   D+   +++
Sbjct: 903  ESKNTYELELKQLHH-----DLSKYKNSTDG-----IEKALNDIQEEHEWVTDEMLVRSI 952

Query: 972  SSEDLLLKLNEANKEISGM--------RNINKRAFENYKKFNEKQSELRERATELDDSKQ 1023
              ++  + +NE    +  +        R +N       +   +K   L+     ++  K+
Sbjct: 953  CEQNAGVNVNEYRHRMEQLQKNFDELRRKVNPNIMNMIESVEKKGEALKTMIRTIEKDKK 1012

Query: 1024 SIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELF 1083
             I+D I KL E K   + KT+ KV+K+F  IF  ++P  +A L    +  +G D      
Sbjct: 1013 KIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLLPNSSAKL----VPCEGKD------ 1062

Query: 1084 TQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFD 1143
                      EG+ + V   +   E L   +LSGGQ+++ A++LI+A+    PAP Y+ D
Sbjct: 1063 --------ITEGLEVKVKLGNLWKESLV--ELSGGQRSLIALSLIMALLQFRPAPMYILD 1112

Query: 1144 EIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSV 1198
            E+DAALD  + + +   I      +QFI  + +  M   AN+ +R ++++  S V
Sbjct: 1113 EVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

>Scas_565.6
          Length = 1170

 Score =  119 bits (298), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 92/313 (29%), Positives = 160/313 (51%), Gaps = 22/313 (7%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           M ++ +II GFK+Y   T+I D+ P  N + G NGSGKSN   A+ FVL      + R  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 61  R-QGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGL-KKDDYQ 118
             Q LI++   A V  ASV IVF + + +  +P G N   +S ++ + R + L     Y 
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFDNSDKT-NSPIGFN---NSSKISVTRQIILGGTSKYL 116

Query: 119 VNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEV 178
           +N     +  ++++ +S    ++NP  ++ QG+I  + N K  E L L+EE  G K FE 
Sbjct: 117 INGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAAGTKMFEN 176

Query: 179 KLKASMKQMDETEQKRAQISAEM-EELESKLNEMEKERKELEKYNSLERDRKVLRYTLHD 237
           + + + + M + E K  +    + EE+E KL ++  E++   ++ + + D +     +H 
Sbjct: 177 RREKAERTMAKKETKLQESRTLLEEEIEPKLEKLRNEKRMFLEFQTTQADFEKTMKVVHA 236

Query: 238 RELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDL 297
            + +++I++  S+     D L SS+  + EL   + +I    EEI +L +        DL
Sbjct: 237 FDYKNMINRHASV----KDVLESSEARMAEL---KGLILRTAEEIGSLNE--------DL 281

Query: 298 EQAKAILEESLER 310
           EQ K   E+ L++
Sbjct: 282 EQVKIQKEKELDK 294

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 104/208 (50%), Gaps = 20/208 (9%)

Query: 991  RNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKN 1050
            R IN       +   +K+S L+     ++  K  IQ+ I KL E K + + KT++KV+++
Sbjct: 980  RKINPNIMSMIENVEKKESALKVMIRTIEKDKVKIQETISKLNEYKRDTLIKTWEKVTED 1039

Query: 1051 FVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQL 1110
            F  IF  ++P   A L    +  +G D                EG+ + V   +   + L
Sbjct: 1040 FGHIFADLLPNSFAKL----VPSEGKD--------------VTEGLEVRVKLGNLWKDSL 1081

Query: 1111 KVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQF 1170
               +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  + + +   I      +QF
Sbjct: 1082 V--ELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1171 ICTTFRSDMVDAANKFYRVKYENKQSSV 1198
            I  + +  M   AN+ +R +++N  S V
Sbjct: 1140 IVVSLKEGMFSNANRVFRTRFQNGTSVV 1167

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
           complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score =  112 bits (281), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 139/274 (50%), Gaps = 15/274 (5%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLS-DDYSNLKRE 59
           M ++ +II GFK+Y   T+I  + P  N + G NGSGKSN   ++ FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGAGASVMSASVEIVF--HDPEHSIIAPTGINSNGSSDEVRIRRTVGL-KKDD 116
             Q LI++   A V+ ASV IVF   DP  S   P G     +  ++ + R + L     
Sbjct: 61  NLQDLIYKRGQAGVIKASVTIVFDNSDPSSS---PFGFE---TYPKISVTRQIILGGTSK 114

Query: 117 YQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSF 176
           Y +N     +  ++ + +S    ++NP  ++ QG+I  + N K  E L L+EE  G + F
Sbjct: 115 YLINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMF 174

Query: 177 EVKLKASMKQMDETEQKRAQISA-EMEELESKLNEMEKERKELEKYNSLERDRKVLRYTL 235
           E + + + K M + E K  +I A  +EE+E KLN +  E++   ++   + D +     +
Sbjct: 175 EDRREKAEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLEKTSRIV 234

Query: 236 HDRELQDIISQIESLDGDYNDTLGSSKKYILELE 269
           +  + Q ++ +  S+     + L S +K I +LE
Sbjct: 235 NTYDYQTLVQKRSSM----QERLQSDQKRIKDLE 264

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 88/365 (24%), Positives = 182/365 (49%), Gaps = 43/365 (11%)

Query: 848  QNDI---KQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIESTKAE 904
            QND+   KQ+L++      EQLL   + LE R ++ +  + ++   L+S+++++   + +
Sbjct: 832  QNDVVTMKQELVEK-----EQLL---QSLEERITKLERDVLLRSNDLESVQRDLNEERNK 883

Query: 905  ITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIR--------- 955
            +   +  +E+  +  R   KK+ E + +  K   +        ++IE++I+         
Sbjct: 884  LLRIDEEIEELTSLIRDKSKKMSESELEYQKLTAEANKSKYNAEKIEEEIKALKDENSWL 943

Query: 956  -EVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRN-INKRAFENYKKFNEKQSELRE 1013
             + G+++ + L++ + ++ E+   +  +  ++  GMR  +N       +   +K++ LR 
Sbjct: 944  SDAGLVA-NILNQNEGINLEEYRERAKQLQEKFQGMRRKVNPNIMSMIENVEKKEAALRT 1002

Query: 1014 RATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINL 1073
                ++  K  I + I KL E K +A+ KT++KV+ +F  IF +++P   A L      +
Sbjct: 1003 MIKTIEKDKMKIVETIEKLNEYKRDALVKTWEKVNVDFGNIFAELLPNSFAKLAA----I 1058

Query: 1074 QGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQM 1133
            +G D  +              G+ + V   +   E L   +LSGGQ+++ A++LILA+  
Sbjct: 1059 EGKDVTA--------------GLEVKVKLGTLWKESLV--ELSGGQRSLIALSLILALLQ 1102

Query: 1134 VEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193
             +PAP Y+ DE+DAALD  + + +   I      +QFI  + +  M   AN+ ++ ++++
Sbjct: 1103 FKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFKTRFQD 1162

Query: 1194 KQSSV 1198
              S V
Sbjct: 1163 GTSVV 1167

>Scas_707.23
          Length = 1223

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 166/735 (22%), Positives = 307/735 (41%), Gaps = 130/735 (17%)

Query: 537  VFGTVGELIQVN-EKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLN 595
            V G V +L +   EKY +   V+ G +   ++V+    A   ++ L + + G  +F+PL+
Sbjct: 527  VKGLVHDLCRPKKEKYGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLD 586

Query: 596  KLKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVK--DLTNGLSISKQ 653
             + +    +  P  P+      I  I+YD+ ++  ++ V G +++    D+   L  ++ 
Sbjct: 587  TIDSEQPTLSAP--PSQEYILTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNRG 644

Query: 654  YKLSCITLDGDRVDGKGVLTGGYLEQSKKSRL--ELLQTVALSKRQLL-----------E 700
             +   ++LDG  +   G++TGG + +  K+R   E  Q++   K +LL           +
Sbjct: 645  VRSKLVSLDGSLIHKAGLMTGG-ISKDSKNRWDKEEYQSLMTLKDKLLIQIEEVSTVGRD 703

Query: 701  ISAKLTEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNLN--TWKHKLSHER--NELLF 756
             +AK  E+++ L+ ++ ++ S    +  V   K +++ N N   + +KL  E+   +L  
Sbjct: 704  AAAKARELESSLSLLNAELSSLRTQLVQV---KRSVEENANEINYHNKLLTEQYTPKLES 760

Query: 757  LQQEKTNICEKIDSVDLNLGVSGEKLT-------------QLKIDXXXXXXXXXXXXXXX 803
            LQ+E   I   I S+      + EK++                I                
Sbjct: 761  LQEEIQAIENSISSI------TAEKVSLQETIFKELTDKVGFSIQDYERYSGDLMREQSK 814

Query: 804  XXXXXXXXXXXXQNKLNLTSETLS------HLSVE-IDTITAELESKLIPQQNDIKQKL- 855
                        +NKL   SE L       H S+E +++  + L+S L  ++N+ +QK  
Sbjct: 815  ELQQLQKQILNIKNKLQFESERLKTTEGKYHASLESLESAKSNLQS-LEEEENECQQKRK 873

Query: 856  ------------LDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIESTKA 903
                        L+    + +   LD   L+   +E +N+L   K     I +++E    
Sbjct: 874  QIEQHISEDEAELNRLQRVYDARQLDFNNLDDVLAEYNNELQSLKHNRNQIREDMEKIDL 933

Query: 904  E---------ITNKERILEKANNQQRLLLKKLDE------YQKDVD----KTMIKKTTLA 944
            E         ITN E  +    N   L + K+DE       + DVD        K+++  
Sbjct: 934  ERVGVLKNCKITNMEIPILSDINLSNLPIDKIDEDTIAISNEIDVDYNDLPAKYKESSAT 993

Query: 945  TRKKEIEQKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKF 1004
            T ++E+E  IR +    EDTL+  +                        N RA E +   
Sbjct: 994  TIREELENHIRSI----EDTLNVLQP-----------------------NARAVERFDDA 1026

Query: 1005 NEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIV--PRG 1062
             E+   + +   +L   ++      +K+K+++    +  FD V+++   I+ ++   P  
Sbjct: 1027 QERFEVVEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDPIYRELTRNPNS 1086

Query: 1063 TATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTV 1122
            +A L+    +L   D++         H  P             +D    +E LSGG+KTV
Sbjct: 1087 SALLSGGNASLTLEDEDEPFNAGIKYHAMP--------PLKRFKD----MEYLSGGEKTV 1134

Query: 1123 CAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSN-NAQFICTTFRSDMV- 1180
             A+AL+ AI   +P+PF++ DE+DAALD      +A  I +  N + QFI  + ++ M  
Sbjct: 1135 AALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFE 1194

Query: 1181 --DAANKFYRVKYEN 1193
              DA    YR + EN
Sbjct: 1195 KSDALVGVYRQQQEN 1209

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 101/226 (44%), Gaps = 20/226 (8%)

Query: 8   IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+YR  T IG    +   +IG NGSGKSN   A+ FVL    S+L+    + LI++
Sbjct: 9   LSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLIYR 68

Query: 68  GAGASVMSASVEIVFHDPE-----HSIIAPTGINSNGSSDEVRIRRTVGLKKD-DYQVND 121
           G    +   S E    DPE     H   A            V + RT+ +  D  Y++++
Sbjct: 69  GV---IRDFSEE----DPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGDTTYKIDN 121

Query: 122 RNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGA-------K 174
           + V+       LE     +     +V QG +  + +    +  +L EE+ G+        
Sbjct: 122 KTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSALDLSKLFEEISGSIQYKKEYD 181

Query: 175 SFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEK 220
           S + +L+   K   E+ + R +I  E++  +  +++ E+ +  +EK
Sbjct: 182 SLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNNVEK 227

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 96/371 (25%), Positives = 176/371 (47%), Gaps = 39/371 (10%)

Query: 839  ELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEI 898
            ELE++ +  + D  + LL +    IE L L++ +LEG+    ++ L   +  L   +K +
Sbjct: 825  ELETEQLSSELDSNKTLLHNHLKSIESLKLENSDLEGKIRGVEDDLVTVQTELNEEKKRL 884

Query: 899  ESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQK----- 953
                 E+   E +++K  ++++    +L +   D++K       +    +++ QK     
Sbjct: 885  MDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLE 944

Query: 954  ----IREVGIISEDT-LDKFKTLSSEDLLLKLNEANKEISGMRNIN-KRAFENYKKFNEK 1007
                +R +   +E   LD ++  S +     LNE  +E+    N N     EN +K   K
Sbjct: 945  DFDLVRNIVKQNEGIDLDTYRERSKQ-----LNEKFQELRKKVNPNIMNMIENVEK---K 996

Query: 1008 QSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLN 1067
            ++ L+     ++  K  IQ+ I KL E K   + KT++KV+ +F  IF  ++P   A L 
Sbjct: 997  EAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKL- 1055

Query: 1068 IHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127
               +  +G D      TQ         G+ + V   +   E L   +LSGGQ+++ A++L
Sbjct: 1056 ---VPCEGKD-----VTQ---------GLEVKVKLGNIWKESLI--ELSGGQRSLIALSL 1096

Query: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFY 1187
            I+A+    PAP Y+ DE+DAALD  + + +   I      +QFI  + +  M   AN+ +
Sbjct: 1097 IMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFANANRVF 1156

Query: 1188 RVKYENKQSSV 1198
            R ++++  S V
Sbjct: 1157 RTRFQDGTSVV 1167

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 103/226 (45%), Gaps = 23/226 (10%)

Query: 531 NLGTESVFGTVGELIQV---NEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGG 587
           N     V G VG+L Q+   N +Y    +   G  LF+VVV   +TA+ L+ E  R++  
Sbjct: 517 NFEASFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLL-ERGRLR-K 574

Query: 588 RVTFMPLNKLKN---GNQNIDYPSDPNIPCTPL-IKKIKYDMQFDCVVKQVFGRALVVKD 643
           RVT +PL+K+      +Q +D           L I  I++D      ++ +FG +L+ +D
Sbjct: 575 RVTIIPLDKIYTRPISSQVLDLAKKIAPGKVELAINLIRFDESITKAMEFIFGNSLICED 634

Query: 644 LTNGLSISKQYKLSC--ITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEI 701
                 I+   K+    ITL GD  D +G L+GG    S +S L  +Q     ++Q+  I
Sbjct: 635 PETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTS-ESLLVDIQKYNQIQKQIETI 693

Query: 702 SAKLTEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNLNTWKHKL 747
            A L  +  EL            +      + + +QS+LN   HKL
Sbjct: 694 QADLNHVTEELQ-----------TQYATSQKTKTIQSDLNLSLHKL 728

>Kwal_55.20421
          Length = 1170

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 114/221 (51%), Gaps = 21/221 (9%)

Query: 979  KLNEANKEISGMRN-INKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKL 1037
            + ++ N++ S +R  +N       +   +K+S L+   + ++  K+ IQ+ + KL E K 
Sbjct: 967  RADQLNEKFSALRRKVNPNIMSMIESVEKKESALKTMISTIEKDKRKIQETVAKLNEYKR 1026

Query: 1038 NAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVS 1097
              + KT++KV+ +F  IF  ++P   A L    + ++G               +  EG+ 
Sbjct: 1027 ETLIKTWEKVTVDFGNIFGDLLPNSFAKL----VPIEGK--------------SVTEGLE 1068

Query: 1098 ISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAV 1157
            + +   S   E L   +LSGGQ+++ A++LILA+   +PAP Y+ DE+DAALD  + + +
Sbjct: 1069 VKIRLGSIWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNI 1126

Query: 1158 AQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSV 1198
               I      +QFI  + +  M   AN+ +R ++++  S V
Sbjct: 1127 GHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 105/228 (46%), Gaps = 26/228 (11%)

Query: 536 SVFGTVGELIQVNEKYKVCA---EVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFM 592
           SV G   +L  +NE+    A   ++  G  LF+VVV+ + TAS L+ E  R++  RVT +
Sbjct: 522 SVKGVAAQLFSLNEENFSSATALQICAGGRLFNVVVNNESTASQLL-ERGRLR-KRVTII 579

Query: 593 PLNK-----LKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNG 647
           PLNK     L     N      P+      +  I Y+ +    ++ +FG +L+ +D    
Sbjct: 580 PLNKISARRLHQDTVNFAKQLAPD-SVELALNLIGYEDEVAKAMEFIFGTSLICRDAETA 638

Query: 648 --LSISKQYKLSCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKL 705
             ++   + +   ITL GD  D +G L+GG    +    +++ +  A S R L E  AKL
Sbjct: 639 KKVTFHPKVRARSITLQGDIYDPEGTLSGGSRNNNSSILIDIQKYNAYS-RNLSESEAKL 697

Query: 706 TEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNLNTWKHKLS-HERN 752
            ++   + +              V+ + +N+Q+ LN   HK    ERN
Sbjct: 698 ADVTKRIKQYSE-----------VLQKTKNLQNELNLATHKFHLAERN 734

>Kwal_56.23825
          Length = 1396

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 176/758 (23%), Positives = 309/758 (40%), Gaps = 170/758 (22%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           + I R+++  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186

Query: 61  RQGLIHQGA-GASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119
              LIH+      + S  V+I F   +      T I     S  +R R+        Y +
Sbjct: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIR-RKAFRNNTSKYYL 245

Query: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172
           N +  +   + ++L   G  + +   ++ QG + S+   K K         L+ LE+++G
Sbjct: 246 NGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIG 305

Query: 173 AKSFEVKLKASMKQM-------DETEQKRAQISAEMEELESKLNE----MEKE------R 215
              ++  ++ ++ ++       +E E +   +  E   LE   NE    +EKE      R
Sbjct: 306 TAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILR 365

Query: 216 KELEKYNSLERDRKV------------------LRYTLHDRELQDIISQIESLDGDYNDT 257
            +L +Y+  + ++K+                   + T H  E+  + + ++SL     D 
Sbjct: 366 SKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGD- 424

Query: 258 LGSSKKYILELEKRENMIKEVN--EEIKNL-QKSLK-------LKATVDLEQAKAILEES 307
           LG S+K  L LEKR      V+  E++KNL QK +K       + +++   QAK  +EE 
Sbjct: 425 LGESEKK-LTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAK--MEEL 481

Query: 308 LERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLK----LITEXXXXXXXXXXXXXXXFDQL 363
               E  +  L ++   +K+ KE+ D  + +LK    LI+E                 Q+
Sbjct: 482 ANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISE-----------------QI 524

Query: 364 QSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDE----WINSKIKELSESINTMK 419
           +  EK ++    +  EK+    L++ + + FK    + E     +N  I EL   +N  +
Sbjct: 525 REIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQR 584

Query: 420 ASTTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAEIEDIEKELINLRRKYTANIDA 479
            S   L                                     EKE +++ R+ T     
Sbjct: 585 GSVFSL-------------------------------------EKEQVDIGRQLTVG--- 604

Query: 480 RKEKWREEQKLQMISDSLVNEVKE--------NERSLNETMSRSLANGFKNVKEICERL- 530
                      Q   D+ V ++KE         +RS++   +RS  + F+N  ++   L 
Sbjct: 605 -----------QSECDNAVKKIKEMKGILTAHRQRSID---ARSSLSTFENKNKVLAALL 650

Query: 531 ---NLGTESVF-GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKG 586
                G  S F G +G+L  +++KY V         L  +VV+T E     +  L + K 
Sbjct: 651 RLQRSGRISGFHGRLGDLGTIDDKYDVAIST-ACPRLDDIVVETVECGQQCIEYLRKNKL 709

Query: 587 GRVTFMPLNKLKNGN-QNIDYPSDPNIPCTPLIKKIKYDM------QFDCVVKQVFGRAL 639
           G   F+ L+KL+N N   I  P   N+P         YD+      +F      V    L
Sbjct: 710 GYARFILLDKLRNFNLSPIKTPE--NVPRL-------YDLVRPNNPKFRNAFYSVLRDTL 760

Query: 640 VVKDL--TNGLSISKQYKLSCITLDGDRVDGKGVLTGG 675
           V KDL   N ++  KQ +   +TLDG  +D  G ++GG
Sbjct: 761 VAKDLKEANKVAYGKQ-RYRVVTLDGKLIDLSGTMSGG 797

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1279 PFSEGVLFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1336

Query: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENK 1194
             +    VA  I + + NAQFI  + R++M + A +   V Y+NK
Sbjct: 1337 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGV-YKNK 1379

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 76/144 (52%), Gaps = 12/144 (8%)

Query: 175  SFEVKLKASMKQMDETEQKRAQISAEMEEL---ESKLNEMEKERKELE-KYNSLERDRKV 230
            S   ++KAS  +++   Q++AQ  +  EEL   E KL  ++ E +ELE +  S +++ KV
Sbjct: 872  SLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKV 931

Query: 231  LR---YTLHDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQK 287
            L+     +   +LQ   S ++S++      L  SKK   +L+K +N IK   ++ + L +
Sbjct: 932  LQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAE 991

Query: 288  SLKLKATVDLEQAKAILEESLERS 311
             LK        Q K+++E +L+ S
Sbjct: 992  ELK-----SCSQEKSLIENNLDSS 1010

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 161/357 (45%), Gaps = 51/357 (14%)

Query: 873  LEGRASEADNQLTIQKRALQSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKD 932
            +E +    +++L   K  L  ++K+  + ++E+ + E ILE  N+  ++L ++ D  ++D
Sbjct: 870  IEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGIKED 929

Query: 933  VDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKFKTLSSED---------------LL 977
            ++K  +++ T A +  +I      + I SE T+D     S+++               L 
Sbjct: 930  IEKFDLERVT-ALKNCKISNI--NIPISSETTIDDLPISSTDNEAITISNSIDINYKGLP 986

Query: 978  LKLNEAN---------------KEISGMRNINKRAFENYKKFNEKQSELRERATELDDSK 1022
             K  E N               +EI      N RA E Y +   +   +     +L   +
Sbjct: 987  KKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVINNETEQLKAEE 1046

Query: 1023 QSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIV--PRGTATLNIHRINLQGTDDNS 1080
            + I +  +K+K+++    +KTFD VS +   I+ ++   P     L     +L   D++ 
Sbjct: 1047 KKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDE 1106

Query: 1081 ELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFY 1140
                    H TP             +D    +E LSGG+KTV A+AL+ AI   +P+PF+
Sbjct: 1107 PFNAGIKYHATP--------PLKRFKD----MEYLSGGEKTVAALALLFAINSYQPSPFF 1154

Query: 1141 LFDEIDAALDKQYRRAVAQTISQLSN-NAQFICTTFRSDMV---DAANKFYRVKYEN 1193
            + DE+DAALD    + +A  I +  N + QFI  + ++ M    DA    YR + EN
Sbjct: 1155 VLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQEN 1211

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 152/712 (21%), Positives = 297/712 (41%), Gaps = 96/712 (13%)

Query: 8   IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+YR  T +G    +   +IG NGSGKSN   A+ FVL    ++L+    + LI++
Sbjct: 9   LSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYR 68

Query: 68  G---------------AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGL 112
           G               A ++  SA V+  +      +     I+ NG +           
Sbjct: 69  GVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDT----------- 117

Query: 113 KKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVG 172
               Y+++ + V+  D    LE+    +     +V QG +  +      E  ++ EEV G
Sbjct: 118 ---SYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSG 174

Query: 173 A-------KSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLE 225
           +       +  + K++   K   E+ + R +I  E++  +  +N+ E+ RK+L+K N L+
Sbjct: 175 SIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQ 234

Query: 226 RDRKVLR-YTLHDR--ELQDII----SQIESLDGDYNDTLGSSKKYILELEKRENMIKEV 278
           + + + + Y L  +  EL D +    S+I SL G  N+ + S ++      K   +I + 
Sbjct: 235 KFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQ 294

Query: 279 NEEIKNLQKSLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKN 338
             ++  + K  K K   DL   K   + + +R   I+ +++ +++ +++ K   +     
Sbjct: 295 KSKLDYIFKD-KEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFETQ 353

Query: 339 LKLITEXXXXXXXXXXXXXXXFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKE 398
           LK++T                +D+ +  E  +K +   C+ ++  +L + GS       E
Sbjct: 354 LKVVTRSKEAFEEEIKQSARNYDKFKLNENDLKTY--NCLHEK--YLTEGGSIL-----E 404

Query: 399 ERDEWINSKIKELSESINTMKASTTELKEQKSSIDVKXXXXXXXXXXXXXXXXGPGIKAE 458
           E+   +N+  +E+ E          EL+      D+                    +   
Sbjct: 405 EKIAVLNNDKREIQE----------ELERFNKRADISKRRITEE------------LSIT 442

Query: 459 IEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVKENERSLNETMSRS--- 515
            E ++ +L +LR           E+  E +KLQ   +S  N+  +    L ET+ +    
Sbjct: 443 GEKLDTQLNDLRVSLNEKNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDL 502

Query: 516 LANGFKNVKEICERLNLGTESVF-----GTVGELIQV-NEKYKVCAEVIGGNSLFHVVVD 569
            AN  + +KE   R N+     F     G V +L     EKY +    I G +   V+V+
Sbjct: 503 SANQRETMKERKLRENIAMLKRFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVE 562

Query: 570 TDETASILMNELFRMKGGRVTFMPLNKLKNGNQNIDYPSDPNIPCTPLIKKIKYDMQFDC 629
               A   +  L + + G  +F+PL+ ++     +  P   +   +  I  I Y+ +++ 
Sbjct: 563 NLTVAQECIAFLKKQRAGTASFIPLDTIETELPTLSLPDSQDYILS--INAIDYEPEYEK 620

Query: 630 VVKQVFGRALVVKDLTNGLSISKQYKL------SCITLDGDRVDGKGVLTGG 675
            ++ V G +++     N L+I+K  K         +T++G  +   G++TGG
Sbjct: 621 AMQYVCGDSIIC----NTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGG 668

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 141/566 (24%), Positives = 248/566 (43%), Gaps = 57/566 (10%)

Query: 531  NLGTESVFGTVGELIQV---NEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGG 587
            N   +SV G   +L  +   N       +V  G  LF+VVVD + TAS L+ E  R++  
Sbjct: 517  NFDPKSVKGVAAQLFTLEKENFDSATALQVCAGGRLFNVVVDNEVTASQLL-ERGRLRK- 574

Query: 588  RVTFMPLNKL--KNGNQNIDYPSDPNIPCTP--LIKKIKYDMQFDCVVKQVFGRALVVKD 643
            RVT +PLNK+  +  N+N    +    P      +  I Y+ +    ++ +FG +L+ KD
Sbjct: 575  RVTIIPLNKIASRTLNENALKLAKSVAPGNVELALNLIGYEDEVSRAMEFIFGTSLICKD 634

Query: 644  LTNG--LSISKQYKLSCITLDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEI 701
                  ++   Q +   ITLDGD  D +G L+GG    +K S L  +QT   + ++L E+
Sbjct: 635  AETAKRVTFHPQIRARSITLDGDIYDPEGTLSGGS-RNTKNSLLIDIQTFNAASKRLNEM 693

Query: 702  SAKLTEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEK 761
              +L +I +++ E +     T           +++Q+ LN   HKLS  +  L       
Sbjct: 694  ELELKQINSKIAEYEQTSQKT-----------KSLQNELNLATHKLSLAKKSL------A 736

Query: 762  TNICEKIDSVDLNLGVSGE-KLTQLKIDXXXXXXXXXXXXXXXXXXXXXXXXXXXQNKLN 820
             N   +I  +  N  +S E      +I+                            +KL 
Sbjct: 737  ANSATQI--IRRNNEISDEISSCTAEINRQTLLSEEFEQEIIKIQKDMEEFNQDKGSKLR 794

Query: 821  LTSETLSHLSVEIDTITAELESKLIPQQN-----DIKQKLLDSSDSIIEQLLLDSEELEG 875
               E +++LS +I+   A +E K    QN     D     + +S   IE L    +ELE 
Sbjct: 795  ELKEEITNLSKKIEEQDAFIEKKFDLYQNLQLEKDQLTSDISASKGSIEDLEQAIKELEN 854

Query: 876  RASEADNQLTIQKRALQSIEKEIESTKA-------EITNKERILEKANNQ---QRLLLKK 925
              +  ++ L++++  L  I+ ++   K        EI   E +L K N Q     L L+K
Sbjct: 855  TRNSIEDDLSLRQTELNQIQNDLNEEKTRLLDIDDEIRELESLLMKKNEQLSNSELELQK 914

Query: 926  ----LDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKFKTLSSEDLLLKLN 981
                L++++   DK   +  +L    + +  K   + II+++     + ++ E+   + N
Sbjct: 915  LTHELNKFKSSTDKIEQRIESLLEDNRWLNDKGLVLNIINQN-----EGINLEEYRQRGN 969

Query: 982  EANKEISGM-RNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAV 1040
            +  ++  GM R +N       +   +K++ L+     ++  K  IQ+ I KL E K + +
Sbjct: 970  QLQEKFQGMKRKVNPNIMSMIENVEKKETALKTMIKTIEKDKTKIQETIEKLNEYKRDTL 1029

Query: 1041 DKTFDKVSKNFVMIFEKIVPRGTATL 1066
             KT++KVS +F  IF  ++P   A L
Sbjct: 1030 LKTWEKVSVDFGNIFGDLLPNSFAKL 1055

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
            cerevisiae YFL008w SMC1 chromosome segregation protein,
            start by similarity
          Length = 1223

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 123/261 (47%), Gaps = 45/261 (17%)

Query: 939  KKTTLATRKKEIEQKIREVGIISEDTLDKFKTLSS-EDLLLKLNEANKEISGMRNINKRA 997
            K+ T A  K+++  +IR++  + E+     + +   +D   + +E +KE  G++   ++ 
Sbjct: 988  KEATSAAVKQDLNNQIRDIDDVLEELQPNARAVERFDDAKSRFDEVDKETEGLKTEERKV 1047

Query: 998  FENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEK 1057
            F+ + K  +K+ EL E A E             K+ E     +D  + ++++N       
Sbjct: 1048 FDEFLKVKQKRKELFENAFE-------------KINEH----LDAIYSELTRNVNST--S 1088

Query: 1058 IVPRGTATLNIHRINLQGTDDNSELFTQS-NEHTTPYEGVSISVSFNSKQDEQLKVEQLS 1116
            I+  G+A++ I        +D  E F      H TP             +D    +E LS
Sbjct: 1089 ILGGGSASMTI--------EDEDEPFNAGIRYHATP--------PMKRFKD----MEYLS 1128

Query: 1117 GGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSN-NAQFICTTF 1175
            GG+KTV A+AL+ AI    P+PF++ DE+DAALD    + +A  I +  N + QFI  + 
Sbjct: 1129 GGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISL 1188

Query: 1176 RSDMV---DAANKFYRVKYEN 1193
            ++ M    DA    +R + EN
Sbjct: 1189 KNTMFEKSDALVGVFRQQQEN 1209

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 100/218 (45%), Gaps = 10/218 (4%)

Query: 11  FKTYRNETIIGDFS-PHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQGA 69
           FK+Y+  T+  DF   +   +IG NGSGKSN   A+ FVL    S+L+    + LI++  
Sbjct: 12  FKSYKG-TVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLIYRDI 70

Query: 70  GASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVNDRNVTKGDL 129
            +   + +      +   +         +G   E+ +R    L    Y+++   VT  + 
Sbjct: 71  ISRENTPTGADNDENGNRTAYVKAFYEYDGKVVEL-MRLISRLGDTSYKLDGNTVTYKEY 129

Query: 130 VRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKLKASMKQMD- 188
            + LES    +     +V QG +  + +       +L+EEV G+  ++ + +    Q D 
Sbjct: 130 SQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEEVSGSMQYKKEYEELKDQYDK 189

Query: 189 ------ETEQKRAQISAEMEELESKLNEMEKERKELEK 220
                 E+ +KR +I AE++  +  ++  E+ RK ++K
Sbjct: 190 ICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQK 227

>Scas_681.4
          Length = 1409

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1288 PFSEGVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1345

Query: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198
             +    VA  I + + NAQFI  + R++M + A +   + K EN+  S 
Sbjct: 1346 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 152/329 (46%), Gaps = 26/329 (7%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           ++I ++ +  FK+Y  + ++G F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208

Query: 61  RQGLIHQG---AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDY 117
              LIH+       +  S  VE ++   EH     T I S      V  R+        Y
Sbjct: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHD--GDTKI-SETKPKLVISRKAFKNNSSKY 265

Query: 118 QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEV 170
            +N +     D+ ++L+  G  + +   ++ QG + ++   K K         L+ LE++
Sbjct: 266 YINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 325

Query: 171 VGAKSFEVKLKASMKQMD-------ETEQKRAQISAEMEELESKLNEMEKERKELEKYNS 223
           +G   ++  ++  + +++       E E +   +  E   LES  N +  E  E EK  +
Sbjct: 326 IGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESGKN-LALEFLEKEKQLT 384

Query: 224 LERDRKVLRYTL--HDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEE 281
           L +  K+L+Y L  ++ +L + + +I +L+ +YN     ++    E+ + + ++ E   +
Sbjct: 385 LSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSK 443

Query: 282 IKNLQKSLK--LKATVDLEQAKAILEESL 308
           IK L+   K  LK+   LE     L+E L
Sbjct: 444 IKVLEGEEKQQLKSKRILEGEHVSLDEKL 472

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 8/140 (5%)

Query: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598
           G +G+L  ++  Y V         L  +VV+T E     +  L + K G   F+ L+KL+
Sbjct: 685 GRLGDLGTIDNTYDVAVST-ACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLR 743

Query: 599 NGNQN-IDYPSDPNIP-CTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSIS-KQYK 655
           + N N I  P   N+P    LIK    D +F      V    LV KDL     ++  Q +
Sbjct: 744 SFNTNTIQTPK--NVPRLFDLIKP--KDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRR 799

Query: 656 LSCITLDGDRVDGKGVLTGG 675
              +TLDG  +D  G ++GG
Sbjct: 800 YRVVTLDGKLIDVSGTMSGG 819

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
            cerevisiae YLR086w Stable Maintenance of Chromosomes,
            start by similarity
          Length = 1398

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 99/199 (49%), Gaps = 24/199 (12%)

Query: 1001 YKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVP 1060
            + +FN+++++L         S+ S++D +  +K ++ +   + F  +S     +++ I  
Sbjct: 1212 FVEFNKRKNDLNSAV----QSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITL 1267

Query: 1061 RGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQK 1120
             G A L +         D+ + F+         EGV+ SV    K      +  LSGG+K
Sbjct: 1268 GGNAELELV--------DSLDPFS---------EGVTFSVMPPKKS--WRNISNLSGGEK 1308

Query: 1121 TVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMV 1180
            T+ ++AL+ A+   +P P Y+ DEIDAALD +    VA  I + + NAQFI  + R++M 
Sbjct: 1309 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1368

Query: 1181 DAANKFYRV-KYENKQSSV 1198
            +   +   + K+EN   S 
Sbjct: 1369 ELTKQLVGIYKHENMTKSA 1387

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 83/184 (45%), Gaps = 9/184 (4%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           ++I ++++  FK+Y    +IG F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187

Query: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119
              LIH+      + S SVE+ F          T I+     + V  R+        Y V
Sbjct: 188 LSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDET-KGNLVVTRKAFKNNASKYFV 246

Query: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172
           N +     ++  +L+  G  + +   ++ QG + ++   K K         L+ LE+++G
Sbjct: 247 NGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIG 306

Query: 173 AKSF 176
              +
Sbjct: 307 TSKY 310

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
            protein complex required for proper chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 122/248 (49%), Gaps = 30/248 (12%)

Query: 955  REVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRER 1014
            R +  +SED L   + L  E +  K+NE +  +    N++    E Y +   + +E + R
Sbjct: 1186 RGIPRLSEDEL---RELDVELIESKINELSYYVEET-NVDIGVLEEYAR---RLAEFKRR 1238

Query: 1015 ATELDDSKQ---SIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRI 1071
              +L+++ Q    +++ +  LK+++ +     F+ +S     +++ I   G A L +   
Sbjct: 1239 KLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELV-- 1296

Query: 1072 NLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAI 1131
                  D+ + F+         EGV+ SV    K      +  LSGG+KT+ ++AL+ A+
Sbjct: 1297 ------DSLDPFS---------EGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFAL 1339

Query: 1132 QMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-K 1190
               +P P Y+ DEIDAALD +    VA  I + + NAQFI  + R++M + A +   V K
Sbjct: 1340 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYK 1399

Query: 1191 YENKQSSV 1198
             +N+  S 
Sbjct: 1400 RDNRTKST 1407

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 16/144 (11%)

Query: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598
           G +G+L  +++ + V         L  VVVDT E A   ++ L + K G   F+ L++L+
Sbjct: 690 GRLGDLGVIDDSFDVAIST-ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLR 748

Query: 599 NGN-QNIDYPSD-PNI-----PCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSIS 651
             N Q I  P + P +     P  P      Y +  D +V Q   +A       N ++  
Sbjct: 749 QFNLQPISTPENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQA-------NNVAYG 801

Query: 652 KQYKLSCITLDGDRVDGKGVLTGG 675
           K+ +   +T+DG  +D  G ++GG
Sbjct: 802 KK-RFRVVTVDGKLIDISGTMSGG 824

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..905555)
            [4113 bp, 1370 aa]
          Length = 1370

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 4/103 (3%)

Query: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1253 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1310

Query: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193
             +    VA  I + + NAQFI  + R++M + A +   + Y+N
Sbjct: 1311 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 95/198 (47%), Gaps = 13/198 (6%)

Query: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           + I+ ++++ FK+Y    ++G F    + V+G NGSGKSN   ++ F      + +++ +
Sbjct: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165

Query: 61  RQGLIHQGAGASVMS-ASVEIVFHDPEHSIIAPTGINS--NGSSDEVRIRRTVGLKKDDY 117
              LIH+      +   SVEI F   ++ +  P G     +G  +   +R+        Y
Sbjct: 166 LSHLIHKSEKYPDLDFCSVEIQF---QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKY 222

Query: 118 QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEV 170
            +N +  T  ++ R+L   G  + +   ++ QG + S+   K K         L+ LE++
Sbjct: 223 YLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDI 282

Query: 171 VGAKSFEVKLKASMKQMD 188
           +G   ++ +++ ++ ++D
Sbjct: 283 IGTTKYKAQIEQALVEVD 300

>Kwal_23.5043
          Length = 1225

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 161/355 (45%), Gaps = 46/355 (12%)

Query: 839  ELESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEI 898
            E+E ++I    D +QK LDS      Q L     L+ +  E ++ L+  KR  +++ +++
Sbjct: 876  EMEERII----DEEQKQLDSLQDEASQNLAGLNALDEQIQEINDDLSASKRKNEALSEDL 931

Query: 899  ESTKAEITN--------KERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEI 950
            E+   E  N          ++ E +++   L L K+DE+      T+     ++     +
Sbjct: 932  ETNTLERLNVLKNCKMQNIKLPEGSSSLDELPLDKVDEF------TLNAANDVSINYAGL 985

Query: 951  EQKIREVGIISEDTLDKFK-TLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQS 1009
             +K+R+ G   E+T    K ++   + LL + + N + +G     K  +E+  K  EK  
Sbjct: 986  SKKLRQSG--EEETGAGLKKSIDELNELLTILQPNSKAAGRYEDAKLRYESIYKETEK-C 1042

Query: 1010 ELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIV--PRGTATLN 1067
            + +E+    D           ++K  +  A +K FD VS +   I+ ++   P   A L 
Sbjct: 1043 KAKEKKVNED---------FTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELA 1093

Query: 1068 IHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127
                +L   D++         H TP      +  F         +E LSGG+KT+ A+AL
Sbjct: 1094 GGNASLTLEDEDEPYLAGIRYHATP-----PAKRFKD-------MEYLSGGEKTIAALAL 1141

Query: 1128 ILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSN-NAQFICTTFRSDMVD 1181
            + AI   +P+PF++ DE+DAALD      VA  I + +  + QFI  + ++ M +
Sbjct: 1142 LFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQFIVISLKNTMFE 1196

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 105/229 (45%), Gaps = 11/229 (4%)

Query: 8   IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+Y+ +  IG    +   +IG NGSGKSN   A+ FVL     +L+      LI++
Sbjct: 9   LNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLIYR 68

Query: 68  GAGA--SVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDD-YQVNDRNV 124
           G  +     SA  E   H P  + +      SN   D V + RTV   ++  Y+++ + V
Sbjct: 69  GTLSEEEASSADFESENH-PNSAYVKAFYSPSNNEDDVVELSRTVTRSQESTYRIDGKTV 127

Query: 125 TKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEV------ 178
                 + LES    +     +V QG +  +   K +E   L E+V G+  ++       
Sbjct: 128 GYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQELTDLFEQVSGSLQYKQDYDRIR 187

Query: 179 -KLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLER 226
            +L+ +  +  +  Q R +    ++  +  +++ E+ RK LE  N+L++
Sbjct: 188 EELERARSETSDCIQSRKRAHIGLKSFKEGVDKDEEYRKHLEDRNNLQQ 236

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
            cerevisiae YLR086w SMC4 Stable Maintenance of
            Chromosomes, start by similarity
          Length = 1372

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1255 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1312

Query: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193
             +    VA  I + + NAQFI  + R++M + A     + Y+N
Sbjct: 1313 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 108/235 (45%), Gaps = 36/235 (15%)

Query: 455 IKAEIEDI----------EKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVKE- 503
           I+++IED+          E  L N + K  A I   +++  E QK         NE+++ 
Sbjct: 565 IESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQ-------TNEMRDV 617

Query: 504 --NERSLNETMSRSLANGFKNVKEICERL----NLGTESVF-GTVGELIQVNEKYKVCAE 556
              +R + E    +L NGF+N   +   L    N G  + F G +G+L  ++++Y +   
Sbjct: 618 LIQQRQIVEEAKANL-NGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIS 676

Query: 557 VIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNGNQNIDYPSDP-NIP-C 614
                 L  +VV+T E     ++ L + K G   F+ L+KL+  N  +D  + P N+P  
Sbjct: 677 T-ACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCN--LDRIATPENVPRL 733

Query: 615 TPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYKLSCITLDGDRVD 667
             LI  ++ D+ F      V    LV +DL   N ++  K+ +   +TLDG  +D
Sbjct: 734 FDLITPVR-DL-FRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLID 785

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
            Saccharomyces cerevisiae YFL008w SMC1 chromosome
            segregation protein, start by similarity
          Length = 1243

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 48/73 (65%), Gaps = 1/73 (1%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSN-NAQF 1170
            +E LSGG+KT+ A+AL+  I   +P+PF++ DE+DAALD      +A  I + +N NAQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1171 ICTTFRSDMVDAA 1183
            I  + ++ M + +
Sbjct: 1203 IVISLKNAMFEKS 1215

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 78/188 (41%), Gaps = 19/188 (10%)

Query: 8   IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+Y++   +G    +   +IG NGSGKSN   A+ FVL    + L+      LI++
Sbjct: 9   LHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLIYR 68

Query: 68  G---------AGASVMSASVEIVFHDPEHSIIAPTGINSNGSS---------DEVRIRRT 109
           G           A  M  S       PE++  +     S   S         +  +  RT
Sbjct: 69  GRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFTRT 128

Query: 110 VGLKKDD-YQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLE 168
           +    D  Y++NDR V+       LES    +     +V QG +  + +   +    LLE
Sbjct: 129 INTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPESLTLLLE 188

Query: 169 EVVGAKSF 176
           +V G+ ++
Sbjct: 189 QVSGSINY 196

>Scas_643.11
          Length = 1095

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 127/276 (46%), Gaps = 44/276 (15%)

Query: 3   IKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER- 61
           I ++ ++ F TYR      + SP  N++IG NGSGKS F  AV   L+     + R +R 
Sbjct: 38  IVKIKLQNFVTYRLTEF--NLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 62  QGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSN-------GSSDEVRIRRTV---G 111
              I  G   S     +EI   + E     PT + S+          D +++ R +   G
Sbjct: 96  DDFIKNGEDTS----RIEIFLKNYED----PTELQSSLNLKFNLAGKDLLKVTRLIQRDG 147

Query: 112 LK-KDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRI------------VSLTNA 158
            K K DY +ND+ VT+  +  +++     + N    + Q R+            V    +
Sbjct: 148 NKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRS 207

Query: 159 KDKERLQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKEL 218
            D + LQ+L+++  +++ E  L+  +    + +QKR        ELE+  N++E   + L
Sbjct: 208 IDAQLLQILDDLKSSQNDETTLENEV----DIKQKR------FNELETDRNKLEASVRSL 257

Query: 219 EKYNSLERDRKVLRYTLHDRELQDIISQIESLDGDY 254
           +++ +++ D ++ +  L   +++D    ++ L GDY
Sbjct: 258 KEFETMKEDIEIHKKLLPYVKVKDHKENLQRLKGDY 293

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 1116 SGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ---LSNNAQFIC 1172
            SGG++ V  +  ++A+Q    APF + DEI+  +D +  R V + + +     N +Q+  
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1173 TT 1174
             T
Sbjct: 1050 IT 1051

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 119/261 (45%), Gaps = 33/261 (12%)

Query: 23  FSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER-QGLIHQGAGASVMSASVEIV 81
            SP  N++IG NGSGKS F  A+   L+     + R +R +  I  G   S    ++EI 
Sbjct: 64  MSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRAKRVEDFIKNGTAES----TIEIQ 119

Query: 82  FHDPEHSIIAPTGINSNGSSDEVRIRRTVGLK---KDDYQVNDRNVTKGDLVRMLESAGF 138
             +  +     +G+    + DE    RTV +K   K  Y +N   V++  +  ++     
Sbjct: 120 LRNSRNV----SGLPMISAEDEAINVRTVLMKARRKCAYYINGEPVSENQMRALVSMLNI 175

Query: 139 YMSNPYNIVPQGRIVSLTNAK-DKERLQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQI 197
            + N    + Q R+      K DK    LLE+ V  +S +  L   ++Q+  ++Q+   +
Sbjct: 176 QLDNLCQFLSQERVEEFARLKADK----LLEQTV--RSVDASLLGLLEQLKTSQQEELSL 229

Query: 198 SAEMEELESKLNEM-------EKERKELEKYN----SLERDRKVLRYTL---HDRELQDI 243
           + E+E  + KL ++       E + + LE+Y      ++  +++L Y     H R+L+D+
Sbjct: 230 NREVELGQKKLEKLMTHKESLENQVRALEEYERKKEEIDIHKRLLPYVRVKNHKRQLKDL 289

Query: 244 ISQIESLDGDYNDTLGSSKKY 264
            S+ E +  +  + L   K +
Sbjct: 290 KSEYERVKQELKEFLKDKKPF 310

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1116 SGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ---LSNNAQFIC 1172
            SGG++ V  +  ++A+Q    APF + DEI+  +D +Y R V + + +     N +Q+  
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1173 TT 1174
             T
Sbjct: 1052 IT 1053

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
           complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 80/173 (46%), Gaps = 7/173 (4%)

Query: 8   IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQGLIHQ 67
           +K FK+Y+    +G    +   ++G NGSGKSN   A+ FVL    S+L+      LI++
Sbjct: 9   VKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLIYR 68

Query: 68  GAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIR--RTVGLKKDD-YQVNDRNV 124
           G      SA      ++P+ + +    +  + S  E R+   R +    D  Y+++ + V
Sbjct: 69  GRMEEGGSAHE----NNPKSAYVTAFYVKQDASGAERRMEFTRVIHNTGDSTYKLDGKTV 124

Query: 125 TKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFE 177
              + V +LE     +     +V QG +  + +    +  +L E+V G+  ++
Sbjct: 125 GYKEYVDVLEGERILVKARNFLVFQGDVEQIASQSGVDLTKLFEQVSGSVQYQ 177

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
           Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 97/227 (42%), Gaps = 26/227 (11%)

Query: 23  FSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER-QGLIHQGAGASVMSASVEIV 81
            SP  N++IG NGSGKS F  A+   L+     + R ++ +  I  G    V    +EI 
Sbjct: 78  LSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGV----IEIT 133

Query: 82  FHDPEHSIIAPTGINS-NGSSDEVRIRRTVGL--KKDDYQVNDRNVTKGDLVRMLESAGF 138
             +   S +  +  N  N   D V ++R + +  KK  Y +N++ VT+  +  M+     
Sbjct: 134 LKNS--SALLHSDFNMINTDDDVVHVKRVLSMEKKKSKYYINNKVVTEEVVKSMVRVLNI 191

Query: 139 YMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQIS 198
            + N    + Q R+      K      LL E +  +S E  L   + ++   + +  ++ 
Sbjct: 192 QLDNLCQFLSQERVEEFARLKPD---TLLNETI--RSIEAGLLEKLSELKSLQAEGNELQ 246

Query: 199 AEMEELESKLNEMEKERKEL-----------EKYNSLERDRKVLRYT 234
            ++   E+KL E+   R  L           EK   L+  +K+L YT
Sbjct: 247 IDLGAKENKLKELTSSRAALESQAHALELYEEKARELDIHQKLLNYT 293

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 1096 VSISVSFNSKQD-EQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYR 1154
            + I V F    + +QL     SGG++ V  +  ++A+Q    +PF + DEI+  +D+   
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1155 RAVAQTISQ---LSNNAQFICTT 1174
            R V + + +     N +Q+   T
Sbjct: 1053 RIVHRIMVENACAENTSQYFLIT 1075

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
           complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 81/189 (42%), Gaps = 36/189 (19%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKRE-E 60
           Y+KR+ +K F  + +  +  +F P  N ++G+NGSGKS    A+  V     S+  R   
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVS 118

Query: 61  RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINS---NGSSDEVRIRRTVGLKKDDY 117
            + LI +G G    +A + IV        +A  G+ +        E+ I RT  LK+D  
Sbjct: 119 LKSLIREGCG----TARIAIV--------LANQGLGAFEQGVYGSEITIERT--LKRDGQ 164

Query: 118 QV-------NDRNVT--KGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKE------ 162
                    N R V+  K DL R+++     + NP   + Q    S   A   +      
Sbjct: 165 SSHFSIKSENGREVSNKKRDLQRIVDYFSIPVLNPMCFLSQDAARSFLTASTPQDKFRHF 224

Query: 163 -RLQLLEEV 170
            R  LLEE+
Sbjct: 225 MRGTLLEEI 233

>Kwal_26.7204
          Length = 1117

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 89/200 (44%), Gaps = 20/200 (10%)

Query: 23  FSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER-QGLIHQGAGASVMSASVEIV 81
            SP  N++IG NGSGKS F  AV   L+     + R +R    I  G    ++  +++  
Sbjct: 87  LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGKRVDSFIKNGENRGLIEVTLK-- 144

Query: 82  FHDPEH--SIIAPTGINSNGSSDEVRIRRTVGL-KKDDYQVNDRNVTKGDLVRMLESAGF 138
             DP    S +A  G          ++ R + + KK +Y +ND  V++  +  ++     
Sbjct: 145 -RDPGRTGSFVAVDGT--------TKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNI 195

Query: 139 YMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQIS 198
            + N    + Q R+      K     +LL E V  +S  V L  S K +   ++++   +
Sbjct: 196 QLDNLCQFLSQERVEEFARLKSD---KLLMETV--RSVNVNLLESFKNLKTLQEEQITEA 250

Query: 199 AEMEELESKLNEMEKERKEL 218
            E+E   SKL ++ + R +L
Sbjct: 251 KELELKTSKLRDLNETRDKL 270

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 87/193 (45%), Gaps = 29/193 (15%)

Query: 989  GMRNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLIIKLKEQKL---NAVDKTFD 1045
            GM N ++   E   K  + + EL      +   + S+ DL I +++++      VD   +
Sbjct: 903  GMMNQDESVIE---KMRQTEKELETLNRSIPQIQASLNDLTIAIEKERSVLEPNVDGIVE 959

Query: 1046 KVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSF-NS 1104
             +S NF  +F+ +   G+  L           + +ELF+           ++I V F +S
Sbjct: 960  GISINFSRLFQNVGSGGSVVL-----------EKNELFSNWK--------INIMVRFRDS 1000

Query: 1105 KQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ- 1163
               ++L  +  SGG++ V  +  ++A+Q    APF + DEI+  +D +  R V + + + 
Sbjct: 1001 ALMKKLDSQIQSGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVEN 1060

Query: 1164 --LSNNAQFICTT 1174
                  +Q+I  T
Sbjct: 1061 ACAEKTSQYILVT 1073

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 101/224 (45%), Gaps = 23/224 (10%)

Query: 3   IKRVIIKGFKTYRNETIIGDF--SPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60
           I ++ ++ F TY     + +F  SP  N++IG NGSGKS F  AV   L+     + R +
Sbjct: 42  IIKIRLQDFVTY----TLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 61  R-QGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDE-VRIRRTV--GLKKDD 116
           + +  I  G   S     +EI   +  +     T I    + DE ++I R +    ++ D
Sbjct: 98  KVEDFIKNGQDVS----KIEITLKNSPNV----TDIEYIDARDETIKITRIITRSKRRSD 149

Query: 117 YQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSF 176
           Y +ND  V++  +  ++      + N    + Q R+      K    ++LL E +  +S 
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS---VKLLVETI--RSI 204

Query: 177 EVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEK 220
           +  L   + ++ E +     +  +++  ++K+  + +E  +L K
Sbjct: 205 DASLLDVLDELRELQGNEQSLQKDLDFKKAKIVHLRQESDKLRK 248

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 70/173 (40%), Gaps = 26/173 (15%)

Query: 1009 SELRERATELDDSKQSIQDLIIKLKEQKL---NAVDKTFDKVSKNFVMIFEKIVPRGTAT 1065
            +ELRE    +    + ++ +  KLKE        +D    K+S  F  +F  +   G   
Sbjct: 895  AELRELEHTVPQQSKDLETIKAKLKEDHAVLEPKLDDIVSKISARFARLFNNVGSAGA-- 952

Query: 1066 LNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQD-EQLKVEQLSGGQKTVCA 1124
                 + L+   D +E              + I V F      ++L     SGG++ V  
Sbjct: 953  -----VRLEKPKDYAEW------------KIEIMVKFRDNAPLKKLDSHTQSGGERAVST 995

Query: 1125 IALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ---LSNNAQFICTT 1174
            +  ++A+Q    APF + DEI+  +D +  R V + + +     N +Q+   T
Sbjct: 996  VLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFLIT 1048

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
            Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 1116 SGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ 1163
            SGG++ V  +  ++A+Q    APF + DEI+  +D  + R V + + Q
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQ 1047

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 7/83 (8%)

Query: 3   IKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER- 61
           I ++ ++ F TY       + SP  N++IG NGSGKS +  AV   L+     + R ++ 
Sbjct: 38  IVKIRLENFVTYNYTEF--NLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQV 95

Query: 62  QGLIHQGAGASVMSASVEIVFHD 84
           +  I  G   S     +EIV  D
Sbjct: 96  EDFIKNGQDTS----KIEIVLKD 114

>Scas_719.6
          Length = 1096

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKR-EE 60
           YIK+V ++ F  + N  +  +  P  N ++G+NGSGKS    A+   L    S+  R   
Sbjct: 63  YIKKVSLRNFMCHENFEL--ELGPKLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 61  RQGLIHQGAGASVMSASVE 79
            + LI +G  ++ ++  +E
Sbjct: 121 LKELIKEGCYSAKITLVIE 139

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRR 1155
            V+ LSGG+K+   +AL+LA      +     DE D  +D+  RR
Sbjct: 994  VDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRR 1037

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 35/173 (20%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKR-EE 60
           +IK + +  F  + N ++     P  N ++G NGSGKS    A+   L    +   R   
Sbjct: 63  FIKEIKLTNFMCHSNFSL--RLGPRLNFIVGNNGSGKSAILTAITIGLGAKATTTNRGTS 120

Query: 61  RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINS---NGSSDEVRIRRTVGLKKDDY 117
            + LI QG   S      +IV       ++   G+NS        E+RI RT+  +++ Y
Sbjct: 121 LKDLIKQGCNTS------KIVI------VLCNEGLNSFEPGVYGKEIRIERTI--RREGY 166

Query: 118 ------------QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNA 158
                       +V+D+   K DL  +L+     ++NP   + Q    S   A
Sbjct: 167 SGSFSIRSEANKEVSDK---KRDLEVILDYFSIPVTNPMCFLSQDAARSFLTA 216

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRR 1155
            V+ LSGG+K+   IAL+LA  +   +     DE D  +D+  R+
Sbjct: 999  VDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRK 1042

>Kwal_26.9380
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 12/110 (10%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER 61
           +IK+V ++ F  + +  +  +  P  N ++G NGSGKS    A+   L    ++  R   
Sbjct: 69  FIKKVQLRNFMCHEHFEL--ELGPRLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 62  -QGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTV 110
            + LI +G      S+ + IV ++         G +      E+RI RT+
Sbjct: 127 LKDLIREG----CQSSKISIVLNNEGFG-----GYDQGTYGSEIRIERTI 167

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
            complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 102/188 (54%), Gaps = 11/188 (5%)

Query: 158  AKDKERLQLLEEVV-GAKSFEVKLKASMKQ---MDETEQKRAQIS-AEMEELESKLNEME 212
            +K+ E+LQ  E +   AK  E +L+++ ++   + +T Q    I+  E ++L+ +L +++
Sbjct: 846  SKETEKLQNFERLYDTAKKREEELRSAYEEAVKLKDTLQSETTINNEEYQKLQKELQQLK 905

Query: 213  KERKELE-KYNSLERDRKVLRYTLHD--RELQDIISQIESLDGDYNDTLGSSKKYILELE 269
            + R++   K   LER++  L+  +    R++     Q  ++  D +D     +K  LEL+
Sbjct: 906  ESREQSNTKIKELEREKSNLQKQIDSMKRQVDSSTKQAMAMKADKSDLESQLRKLKLELK 965

Query: 270  KRENMIKEVNEEIKNLQKSLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQNK 329
             +E  +KE+ +++ N  + LKLK    +E+A A   + LE+  +    +KD  EK K  K
Sbjct: 966  SKEKRVKELEQKVDNSGEDLKLKLQ-QVERAAATNNKRLEQLTSENKLMKDQMEKSK--K 1022

Query: 330  EQHDNDRK 337
            EQH++ R+
Sbjct: 1023 EQHESQRQ 1030

>YLR383W (RHC18) [3762] chr12 (885288..888632) Protein involved in
           recombination repair, homologous to S. pombe rad18 [3345
           bp, 1114 aa]
          Length = 1114

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 9/83 (10%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER 61
           YIK+VI++ F  + +  +  +     N ++G NGSGKS    A+   L    S   R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 62  -QGLIHQGAGASVMSASVEIVFH 83
            + LI +G        S +I+ H
Sbjct: 139 LKDLIREGC------YSAKIILH 155

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 1097 SISVSFNSKQDEQLK-VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRR 1155
            S+ +   +  DE+ + V+ LSGG+K+   +AL+LA      +     DE D  +D Q  R
Sbjct: 1000 SLEIYILTTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMD-QVNR 1058

Query: 1156 AVAQTI 1161
             +  T+
Sbjct: 1059 KIGTTL 1064

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 5/56 (8%)

Query: 1115 LSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ-LSNNAQ 1169
            +SGG+K   AIA +L    ++ AP   FDE  +ALD    +A+  TI Q  S+N++
Sbjct: 572  ISGGEKQRLAIARVL----LKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSK 623

>CAGL0H05071g 486899..490231 similar to sp|Q12749 Saccharomyces
           cerevisiae YLR383w RHC18, hypothetical start
          Length = 1110

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 140/358 (39%), Gaps = 58/358 (16%)

Query: 2   YIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREER 61
           YIK++ +  F  +RN  +  +  P  N ++G NGSGKS    A+   L    S   R   
Sbjct: 79  YIKKLTLHNFMCHRNFDV--ELGPGLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 62  -QGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVG-LKKDDYQV 119
            + LI  G  +S     + I   +       P G       D + I RT+       + +
Sbjct: 137 LKDLITAGCNSS----RITIYLSNSGIGAYVPKG---KQYGDTIIIERTISRTSTAGFSL 189

Query: 120 NDRNVT-----KGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAK 174
              N T     K DL  +L+     +SNP   + Q    S   A                
Sbjct: 190 KSENGTEISNKKRDLQEILDYFAIPISNPMCFLSQDSARSFLTAS-----------TPTD 238

Query: 175 SFEVKLKASMKQMDETEQKRA-----QISAEMEELESKLNEMEKERKELEKYNSLERD-R 228
            +   +K ++ Q  +   +RA     + +A ME     L E++      E+Y+  + D R
Sbjct: 239 KYNHFVKGTLLQQIKDYLERATEVHNESAAAMELHTESLRELQ------ERYDKAKTDLR 292

Query: 229 KVLRYTLHDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQK- 287
           ++ + +  +  L+ +  +   L+ D N         ++ + K +N I     EI  L + 
Sbjct: 293 QISKTSDLNERLKLLTGKSLWLNVDEN---------VMNINKLKNKISHYENEISKLTEK 343

Query: 288 ---------SLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDR 336
                    SLK + T+  +     L + +E+ E  +L  + I+E   + +++ +N++
Sbjct: 344 SDSRMNQIDSLKSEITIIEQGLSGKLSKMVEKEEQFQLMNEKIREAKSKYEQEENNEK 401

>CAGL0F04719g 475180..477294 highly similar to sp|P27472
           Saccharomyces cerevisiae YLR258w GSY2
           UDP-glucose--starch glucosyltransferase, start by
           similarity
          Length = 704

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 30/135 (22%)

Query: 881 DNQLTIQKRALQSIEKEIESTKAEITNK--ERILEKA-----NNQQRLLLKKLDEYQKDV 933
           +N  T++    Q++ K +E+T  E+T    +RI + A     N     L   LDE  K  
Sbjct: 361 NNSFTVEALRSQAVVKSLENTVDEVTRSIGKRIFDHAMKFPHNGITNELPTNLDELLKPS 420

Query: 934 DKTMIKKTTLATRKKE------------------IEQKIREVGIISEDTLDKFKTLSSED 975
           DK ++KK  LA R+                    I  KIREV + +  + D+ K +   +
Sbjct: 421 DKVLLKKRVLALRRPWGELPPIVTHNMVDEGQDLILNKIREVQLFNNAS-DRVKMIFHPE 479

Query: 976 LLLKLNEANKEISGM 990
            L     AN  I G+
Sbjct: 480 FL----NANNPILGL 490

>Scas_636.14
          Length = 608

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I + 
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>Kwal_33.13526
          Length = 1298

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 8/81 (9%)

Query: 8  IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREERQG-LIH 66
          I+ F +   ETI  +F     +++G+NGSGK+     +++  + D   L    + G  +H
Sbjct: 12 IRSFDSNERETI--EFGKPLTLIVGSNGSGKTTIIECLKYATTGD---LPPNSKGGAFVH 66

Query: 67 QG--AGASVMSASVEIVFHDP 85
               G   + A V++ F  P
Sbjct: 67 DPKITGEKDVRAQVKLAFTSP 87

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 17/142 (11%)

Query: 1075 GTDDNSELFTQSNEHTTPYEGVSISVSF-NSKQDEQLKVE-QLSGGQKTVCAIALILAIQ 1132
            GTD ++ +  +S+E TT   G S +      KQD +L +  + S GQK + +I + LA+ 
Sbjct: 1149 GTDVDT-IKIKSDEVTTSTRGKSYNYRVVMYKQDAELDMRGRCSAGQKVLASIIVRLALS 1207

Query: 1133 MVEP--APFYLFDEIDAALDKQYRRAVAQTISQL------SNNAQFICTTFRSDMV---- 1180
                        DE    LD++   ++A++++ +        N Q I  T     +    
Sbjct: 1208 ETFGVNCGVIALDEPTTNLDEENIESLAKSLNNIIEFRRHQRNFQLIVITHDEKFLRYMG 1267

Query: 1181 --DAANKFYRVKYENKQSSVIE 1200
              D A+ FY+VK +++Q S IE
Sbjct: 1268 AADFADHFYKVKRDDRQKSQIE 1289

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I + 
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>KLLA0C02915g 261280..265170 similar to sp|P12753 Saccharomyces
            cerevisiae YNL250w RAD50 DNA repair protein, start by
            similarity
          Length = 1296

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 15/111 (13%)

Query: 1105 KQDEQLKVE-QLSGGQKTVCAIALILAIQMV--EPAPFYLFDEIDAALDKQYRRAVAQTI 1161
            KQD +L +  + S GQK + AI + LA+             DE    LD++   ++A+++
Sbjct: 1177 KQDAELDMRGRCSAGQKVLAAIIIRLALSETFGVNCGVIALDEPTTNLDEENIESLARSL 1236

Query: 1162 SQL------SNNAQFICTTFRSDMVDA------ANKFYRVKYENKQSSVIE 1200
            + +        N Q I  T     ++       AN FY+VK +++Q S IE
Sbjct: 1237 ATIIEVRRHQKNFQLIVITHDEKFLNHMNASSYANHFYKVKRDDRQKSQIE 1287

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 186 QMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDRELQ 241
           ++D  E   AQI+ E +E  ++L E++  R  L KY+S +  ++VL   L +R+LQ
Sbjct: 60  EIDAIEDVFAQITQEQDEFNARLKELQDLRDSLSKYDSEKLRKQVLALQLLERDLQ 115

>Kwal_26.9480
          Length = 719

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 1115 LSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTI 1161
            +SGG+K   AIA +L    ++ AP   FDE  +ALD    +A+ +TI
Sbjct: 600  ISGGEKQRLAIARVL----LKDAPIMFFDEATSALDTHTEQALLRTI 642

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
            Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
            (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 120/254 (47%), Gaps = 29/254 (11%)

Query: 819  LNLTSETLSHLSVEIDTITAELESKLIPQQNDIKQKLLDSSDSIIE--QLLLDSEELEGR 876
            L +T ET   L   ++     L  KL+P        LLDSS++I++  ++    ++LE +
Sbjct: 770  LKVTFETYDRL---MENPWYNLYMKLLP--------LLDSSNTILKTKKIAEQVKQLENK 818

Query: 877  ASEADNQLTIQKRALQSIEKEIESTKA-------EITNKERILEKANNQQRLLLKKLDEY 929
             +E++   T+   A + +E+E+E  KA       E+   + +LE    +Q  + +K DE 
Sbjct: 819  LAESEKSTTVMVDAKRLVEQELEKVKALLLKETSELQQSQELLEATKTKQIQIQQKWDET 878

Query: 930  QKDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKFKTLSS--EDLLLKLNEANKEI 987
                D    +   L+     +  ++ +    S+ + DKF+ LS   E L + +NE   ++
Sbjct: 879  LSIKDSLETENLELSKEADNLRLELEKTKNASDLSEDKFRELSHDKEKLEITVNELKNKL 938

Query: 988  SGMRNINKRAFENYK-----KFNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDK 1042
              ++N ++RA ++ K     + ++ + E++E+   L D +  + D  I + + KL +++K
Sbjct: 939  DVVKN-DERALDSEKDKLIREISDLKKEIQEKTMSLKDMEAKVNDSEIAI-DVKLKSLEK 996

Query: 1043 TFDKVSKNFVMIFE 1056
                 S      FE
Sbjct: 997  HLAATSNRMKGFFE 1010

>YFR015C (GSY1) [1696] chr6 complement(174257..176383)
            UDP-glucose-starch glucosyltransferase (glycogen
            synthetase) isoform 1 [2127 bp, 708 aa]
          Length = 708

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 61/151 (40%), Gaps = 36/151 (23%)

Query: 882  NQLTIQKRALQSIEKEIESTKAEITNK--ERILEKA-----NNQQRLLLKKLDEYQKDVD 934
            N  T++    Q+I K +E+T  E+T    +RI E       N  +  L   LDE  K  +
Sbjct: 362  NSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSSE 421

Query: 935  KTMIKKTTLATRKK------------------EIEQKIREVGIISEDTLDKFKTLSSEDL 976
            K ++KK  LA R+                    I  +IR V + + D+ D+ K +   + 
Sbjct: 422  KVLLKKRVLALRRPYGELPPVVTHNMCDDANDPILNQIRHVRLFN-DSSDRVKVIFHPEF 480

Query: 977  LLKLNEANKEISGM------RNINKRAFENY 1001
            L     AN  I G+      R  +   F +Y
Sbjct: 481  L----NANNPILGLDYDEFVRGCHLGVFPSY 507

>Kwal_56.23429
          Length = 539

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   ++ I + 
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 513

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I + 
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   ++ I + 
Sbjct: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 1114 QLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICT 1173
            QLSGGQK   A+A      +++P+   + DE  +ALD Q    VAQ++ Q S   +   T
Sbjct: 569  QLSGGQKQRIALARAF---LLDPS-ILILDEATSALDSQSEEVVAQSLQQRSARGK--TT 622

Query: 1174 TFRSDMVDAANKFYRVKYENKQSSVIE 1200
               +  V       RV   N+  +V E
Sbjct: 623  ISIAHRVSTIQHSSRVIVLNRHGTVAE 649

>CAGL0K10626g complement(1031704..1033794) highly similar to
           sp|P23337 Saccharomyces cerevisiae YFR015c GSY1, start
           by similarity
          Length = 696

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 881 DNQLTIQKRALQSIEKEIESTKAEITN--KERILEKA-----NNQQRLLLKKLDEYQKDV 933
           +N  T++    Q++ K +E+T  E+T+   +RI E A     N     +   L+E  K  
Sbjct: 361 NNSFTVEALRSQAVVKSLENTVNEVTSLIGKRIFEHAMKFPHNGITNEIPNNLEELLKPS 420

Query: 934 DKTMIKKTTLATRKK 948
           DK ++KK  LA R+ 
Sbjct: 421 DKVLLKKRVLALRRP 435

>KLLA0E21362g complement(1900927..1902105) some similarities with
           sgd|S0002771 Saccharomyces cerevisiae YDR363w ESC2
           involved in silencing, hypothetical start
          Length = 392

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 20/104 (19%)

Query: 699 LEISAKLTEIKNELTEM-DNDIDSTNGSIRLVMNRKENMQSNLNTWKH------------ 745
           LE + KL E  +++ ++ D+DI+S+N SIRL +  K N +++++ W +            
Sbjct: 293 LESAPKLAERTDDVIDLLDSDIESSN-SIRLTLIDKANKRTSISVWPNTTFTEIANRYKT 351

Query: 746 --KLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGEKLTQLKI 787
              LS + N LL    E+ N    +    L+ G+  + + ++KI
Sbjct: 352 ISSLSEDANVLLIFDNEELNPAATV----LSEGLEEDDILEIKI 391

>KLLA0F19888g complement(1839682..1854429) similar to sp|Q12019
            Saccharomyces cerevisiae YLR106c, start by similarity
          Length = 4915

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/166 (19%), Positives = 78/166 (46%), Gaps = 7/166 (4%)

Query: 152  IVSLTNAKDKERLQLLEEVVGAKSFEVKLKASMKQMD-ETEQKRAQISAEMEELESKLNE 210
            +V  TNA   + ++L+  ++G K+ E  + + +  MD     ++  ++ ++  +  KL+E
Sbjct: 2052 LVGPTNAGKTDMVKLIASIIGKKTIEFSMNSDVDSMDILGGYEQLDLNRKVANIIQKLSE 2111

Query: 211  MEKERKELEKYNSLERDRKVLRYTLHDRELQDIISQIESLDGDYNDTLGSSKKYILELEK 270
            + ++   +      + +     + L+D   +  +S       ++ D +   +K+   L +
Sbjct: 2112 ILQQLITINLSTGTDTEALSPAFALYDFIKKSSVSSF-----NFTDFVHLFQKF-YSLTQ 2165

Query: 271  RENMIKEVNEEIKNLQKSLKLKATVDLEQAKAILEESLERSEAIKL 316
              + I E+N EI++L + +K  A V  E    +L +++E    + L
Sbjct: 2166 VHSTIDEINMEIQDLSEHMKKPAAVKFEWFDGMLVKAVEEGHWLIL 2211

>Sklu_2429.6 YLR258W, Contig c2429 11089-13209 reverse complement
          Length = 706

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 881 DNQLTIQKRALQSIEKEIESTKAEITN--KERILEKA----NNQQRLLLKKLDEYQKDVD 934
           +N  T+     Q++ + +EST  ++T    +R+ E A    +N +  +  +LDE  K  D
Sbjct: 361 NNSYTVDALKGQAVVRSLESTVKDVTALVGKRLFEHAMRYPHNGKSEIPTELDELLKPSD 420

Query: 935 KTMIKKTTLATRKKE 949
           K ++KK   A ++ E
Sbjct: 421 KVLLKKRVFALKRPE 435

>YNL121C (TOM70) [4474] chr14 complement(398684..400537) Mitochondrial
            specialized import receptor of the outer membrane, has
            tetratricopeptide (TPR) repeats [1854 bp, 617 aa]
          Length = 617

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 909  ERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKF 968
            E +LE+  N+Q +   KL E   D+D      T L+T+  + E+K ++  + S  ++  F
Sbjct: 204  EPMLERNLNKQAM--SKLKEKFGDIDTATATPTELSTQPAK-ERKDKQENLPSVTSMASF 260

Query: 969  KTLSSEDLLL----KLNEANKEI-SGMRNINKRAFENYKKFNE 1006
              +   +L      + NEA+KE+ +G+ N+ KR+ E+Y K +E
Sbjct: 261  FGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADE 303

>KLLA0E21406g 1904841..1905983 highly similar to sp|P38716
            Saccharomyces cerevisiae YHR112c, start by similarity
          Length = 380

 Score = 31.6 bits (70), Expect = 4.3,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 1070 RINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIAL 1127
            RI  Q +++ ++L +   EH + +EGV   V  +S Q E    EQL GG   V A+ L
Sbjct: 252  RIQTQ-SENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGYGPVFAVTL 308

>Kwal_23.3356
          Length = 301

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 644 LTNGLSISKQYKLSCITLDGDRVDGKGVLTGG-YLEQSKKSRLELLQTVALSKRQLLEIS 702
           + NG+S+  +  LSC  +   +    GVL    Y + SK   L+  Q   L + +L+++ 
Sbjct: 1   MRNGMSLLMRSALSCRNVATKKAANSGVLAADLYQDPSKWKSLKPDQIFELYRERLVKLG 60

Query: 703 AKLTEIKNELTEMDNDIDSTNGSIRLV 729
            +    K EL  + +  +ST  S R +
Sbjct: 61  TEYKPSKEELDALLSTAESTGVSPRAI 87

>Scas_706.21
          Length = 1304

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 8  IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDD 52
          I+ F +   ETI  +F     +++G+NGSGK+     +++  + D
Sbjct: 12 IRSFDSNDRETI--EFGKPLTLIVGSNGSGKTTIIECLKYATTGD 54

>CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces
           cerevisiae YEL043w, hypothetical start
          Length = 994

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 180 LKASMKQMDE----TEQKRAQISAEMEELESKLNEMEKERKELEKYNSL 224
           LK+S+K ++     T+ K  ++  ++ EL  K++ MEK+ KE EK NSL
Sbjct: 288 LKSSIKSLENSKLLTDTKSEKVKKKINELRFKISRMEKDMKEWEKENSL 336

>YJL109C (UTP10) [2806] chr10 complement(211917..217226) Component of
            U3 snoRNP (also called small subunit processome), which
            is required for 18S rRNA biogenesis [5310 bp, 1769 aa]
          Length = 1769

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 467  INLRRKYTANIDA-----RKEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLA 517
            +NLRR    ++ +     R E W+   + ++IS SLVN++   E S+ + + +++ 
Sbjct: 1616 VNLRRLVINSLTSSLKFDRDEYWKSTSRFELISVSLVNQLSNIENSIGKYLVKAIG 1671

>Scas_587.8
          Length = 715

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 1114 QLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ 1163
            QLSGGQK   A+A      ++ PA   + DE  +ALD Q    VA+ +S+
Sbjct: 586  QLSGGQKQRIALARAF---LLHPA-LLILDEATSALDSQSEEIVAKNLSE 631

>CAGL0J07788g complement(757051..760968) similar to sp|P12753
          Saccharomyces cerevisiae YNL250w RAD50 DNA repair
          protein, start by similarity
          Length = 1305

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 8  IKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDD 52
          I+ F +   ETI  +F     +++G NGSGK+     +++  + D
Sbjct: 12 IRSFDSNDRETI--EFGKPLTLIVGMNGSGKTTIIECLKYATTGD 54

>KLLA0D16236g complement(1366718..1369333) weakly similar to
           sp|P53278 Saccharomyces cerevisiae YGR130c, start by
           similarity
          Length = 871

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 14/99 (14%)

Query: 892 QSIEKEIESTKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIE 951
           Q  E ++E   AE+ NK   L ++      L KK        D+T  +   L   K  +E
Sbjct: 597 QEHESKVEELTAELDNKTSALNES------LAKK--------DETNAEIQALEEEKARLE 642

Query: 952 QKIREVGIISEDTLDKFKTLSSEDLLLKLNEANKEISGM 990
           Q+I+E   + +  + K +++ +++ L K+NE N EIS +
Sbjct: 643 QEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSL 681

>Kwal_14.2057
          Length = 733

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 20/87 (22%)

Query: 363 LQSEEKLIKHHLKE-----C------IEKQNNFLLKKGS--YARFKSKEERDEWINSKIK 409
           +Q EEK + HHLK+     C      +  + N L   G   Y +F+   E D+W N K+ 
Sbjct: 581 IQKEEKNVNHHLKQKKSEICTIIIAHLSTEGNLLWANGGAEYCKFEDAAE-DDWKNEKL- 638

Query: 410 ELSESINTMKASTTELKE-QKSSIDVK 435
               ++ +  +S  ELK   KSS+ VK
Sbjct: 639 ----NMQSKYSSLEELKSLYKSSVSVK 661

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,546,985
Number of extensions: 1645477
Number of successful extensions: 12844
Number of sequences better than 10.0: 859
Number of HSP's gapped: 11775
Number of HSP's successfully gapped: 1689
Length of query: 1200
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1087
Effective length of database: 12,684,275
Effective search space: 13787806925
Effective search space used: 13787806925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)