Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H02783g1785169776550.0
YJL076W (NET1)11895488482e-93
Scas_675.2413194386403e-67
Scas_711.389984635462e-56
Kwal_14.242112054855171e-52
AAL181C12214774582e-45
KLLA0C09394g11845044223e-41
CAGL0B03179g9273683042e-27
YKR010C (TOF2)7712492112e-16
Kwal_23.5534190752715.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H02783g
         (1758 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...  2953   0.0  
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   331   2e-93
Scas_675.24                                                           251   3e-67
Scas_711.38                                                           214   2e-56
Kwal_14.2421                                                          203   1e-52
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   181   2e-45
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   167   3e-41
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   121   2e-27
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...    86   2e-16
Kwal_23.5534                                                           32   5.8  

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
            Saccharomyces cerevisiae YJL076w NET1 required for rDNA
            silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score = 2953 bits (7655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1511/1697 (89%), Positives = 1511/1697 (89%)

Query: 1    MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60
            MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI
Sbjct: 1    MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60

Query: 61   FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120
            FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL
Sbjct: 61   FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120

Query: 121  SLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLNPESLAD 180
            SLQDSNGCDL              IVRVILNDELDISEITPVSSYRSIKRRRLNPESLAD
Sbjct: 121  SLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSIKRRRLNPESLAD 180

Query: 181  SKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQNSDDE 240
            SKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQNSDDE
Sbjct: 181  SKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQNSDDE 240

Query: 241  EVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGEQDTVSRSATVDPDKSRQQRLLS 300
            EVADRSFL                 DTNVRKITSRIGEQDTVSRSATVDPDKSRQQRLLS
Sbjct: 241  EVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDTVSRSATVDPDKSRQQRLLS 300

Query: 301  GTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSRRITSGMLQIPEPKIA 360
            GTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSRRITSGMLQIPEPKIA
Sbjct: 301  GTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSRRITSGMLQIPEPKIA 360

Query: 361  EMEKELLEGXXXXXXXXXXXXXXXXXXXXFIETERYYSEDSSETESNSGEINAKSSLHRQ 420
            EMEKELLEG                    FIETERYYSEDSSETESNSGEINAKSSLHRQ
Sbjct: 361  EMEKELLEGPSSPSTILPPIPDKIPMKKPFIETERYYSEDSSETESNSGEINAKSSLHRQ 420

Query: 421  TSIADNNGSPLRTNFLNEAVHLADLPELQKSEKASKPRKQVYGSITVNSSNLQPIPNNIN 480
            TSIADNNGSPLRTNFLNEAVHLADLPELQKSEKASKPRKQVYGSITVNSSNLQPIPNNIN
Sbjct: 421  TSIADNNGSPLRTNFLNEAVHLADLPELQKSEKASKPRKQVYGSITVNSSNLQPIPNNIN 480

Query: 481  NYVETNATKVRSTVNDFGIXXXXXXXXXXXXHSKMSDEDYESSDSNKTIFEXXXXXXXXX 540
            NYVETNATKVRSTVNDFGI            HSKMSDEDYESSDSNKTIFE         
Sbjct: 481  NYVETNATKVRSTVNDFGISSSSDDETTSETHSKMSDEDYESSDSNKTIFEDDDDDDDDD 540

Query: 541  XEANSTVVHIPTKPVLTRKSNKKIFQRDELLRLMEGDRDGLPVSIKRELLKMYPDFPPQK 600
             EANSTVVHIPTKPVLTRKSNKKIFQRDELLRLMEGDRDGLPVSIKRELLKMYPDFPPQK
Sbjct: 541  DEANSTVVHIPTKPVLTRKSNKKIFQRDELLRLMEGDRDGLPVSIKRELLKMYPDFPPQK 600

Query: 601  HDKKLGPESKLHPSHNAIPKSPGSDGDKQKNSAQIPHIXXXXXXXXXXXXXIYVEEVDET 660
            HDKKLGPESKLHPSHNAIPKSPGSDGDKQKNSAQIPHI             IYVEEVDET
Sbjct: 601  HDKKLGPESKLHPSHNAIPKSPGSDGDKQKNSAQIPHIEYSSEESSDSLSEIYVEEVDET 660

Query: 661  TKGQKKKPNRRNKNSEEPLSELHPLKETVIDIKQNGNRSVKENITESLDSNKEHGESVGK 720
            TKGQKKKPNRRNKNSEEPLSELHPLKETVIDIKQNGNRSVKENITESLDSNKEHGESVGK
Sbjct: 661  TKGQKKKPNRRNKNSEEPLSELHPLKETVIDIKQNGNRSVKENITESLDSNKEHGESVGK 720

Query: 721  NDFDVNNTEEMSRHQVNSNLHELPIKVHSTDSLSETNARNESGDNAYNYKTSKSADQNDD 780
            NDFDVNNTEEMSRHQVNSNLHELPIKVHSTDSLSETNARNESGDNAYNYKTSKSADQNDD
Sbjct: 721  NDFDVNNTEEMSRHQVNSNLHELPIKVHSTDSLSETNARNESGDNAYNYKTSKSADQNDD 780

Query: 781  LASTANNDIFKSLVDFRSLVAKIKKDKSENNPNGSAMRDNSQGSSNSPVLNSTSFPNVVN 840
            LASTANNDIFKSLVDFRSLVAKIKKDKSENNPNGSAMRDNSQGSSNSPVLNSTSFPNVVN
Sbjct: 781  LASTANNDIFKSLVDFRSLVAKIKKDKSENNPNGSAMRDNSQGSSNSPVLNSTSFPNVVN 840

Query: 841  NAAFGSTYTRKDTDKNVSLKDXXXXXXXXXXXXXXXXEQGPPIYPPETERSGKELIESKI 900
            NAAFGSTYTRKDTDKNVSLKD                EQGPPIYPPETERSGKELIESKI
Sbjct: 841  NAAFGSTYTRKDTDKNVSLKDNSKLVSSAVNASASQNEQGPPIYPPETERSGKELIESKI 900

Query: 901  KGLPPSKLIQEKSSTFRTPHSKSAQTTSPIAEVVSGHEVAVKQIEDMQQFKPLDVRKSTS 960
            KGLPPSKLIQEKSSTFRTPHSKSAQTTSPIAEVVSGHEVAVKQIEDMQQFKPLDVRKSTS
Sbjct: 901  KGLPPSKLIQEKSSTFRTPHSKSAQTTSPIAEVVSGHEVAVKQIEDMQQFKPLDVRKSTS 960

Query: 961  TSLLKKIPAKDVPVTQVKNTPSTKAVQDKETVGPATQHKSTQLEANSXXXXXXXXXXXXT 1020
            TSLLKKIPAKDVPVTQVKNTPSTKAVQDKETVGPATQHKSTQLEANS            T
Sbjct: 961  TSLLKKIPAKDVPVTQVKNTPSTKAVQDKETVGPATQHKSTQLEANSVPKKVPAKDVPVT 1020

Query: 1021 QVKNTPSTKAVQDKETVSPATQHKSTQLEANSXXXXXXXXXXXXTQVKNTPSTKAVQDKE 1080
            QVKNTPSTKAVQDKETVSPATQHKSTQLEANS            TQVKNTPSTKAVQDKE
Sbjct: 1021 QVKNTPSTKAVQDKETVSPATQHKSTQLEANSVPKKVPAKDVPVTQVKNTPSTKAVQDKE 1080

Query: 1081 TVSPATQHKSTQLEANSXXXXXXXXXXXXTQVKNTPSTKAVQDKETASPATEHKPSKRVD 1140
            TVSPATQHKSTQLEANS            TQVKNTPSTKAVQDKETASPATEHKPSKRVD
Sbjct: 1081 TVSPATQHKSTQLEANSVPKKVPAKDVPVTQVKNTPSTKAVQDKETASPATEHKPSKRVD 1140

Query: 1141 RKVLDSTQKEISITQNNSVQSKKVVQDNTVDVASHKQQDPYVSARDTLYTKLTGGEQGDN 1200
            RKVLDSTQKEISITQNNSVQSKKVVQDNTVDVASHKQQDPYVSARDTLYTKLTGGEQGDN
Sbjct: 1141 RKVLDSTQKEISITQNNSVQSKKVVQDNTVDVASHKQQDPYVSARDTLYTKLTGGEQGDN 1200

Query: 1201 HLSTSKATAKVDLPTKKLPNASNGNVVISQSPSDINASQTSTKNKVTPSSVENQSGSSKN 1260
            HLSTSKATAKVDLPTKKLPNASNGNVVISQSPSDINASQTSTKNKVTPSSVENQSGSSKN
Sbjct: 1201 HLSTSKATAKVDLPTKKLPNASNGNVVISQSPSDINASQTSTKNKVTPSSVENQSGSSKN 1260

Query: 1261 PNIASKNKQDITTSEKDNSISSQFTSEVDKHVEGNDSKSGIHVRSFDNVKSAPSEKDLNS 1320
            PNIASKNKQDITTSEKDNSISSQFTSEVDKHVEGNDSKSGIHVRSFDNVKSAPSEKDLNS
Sbjct: 1261 PNIASKNKQDITTSEKDNSISSQFTSEVDKHVEGNDSKSGIHVRSFDNVKSAPSEKDLNS 1320

Query: 1321 NTAPPVNNSQKTNGRNGLDEQLEQRVETVTRLPSPVKNKIREQQNRVNGKSQQLEAVTSP 1380
            NTAPPVNNSQKTNGRNGLDEQLEQRVETVTRLPSPVKNKIREQQNRVNGKSQQLEAVTSP
Sbjct: 1321 NTAPPVNNSQKTNGRNGLDEQLEQRVETVTRLPSPVKNKIREQQNRVNGKSQQLEAVTSP 1380

Query: 1381 ETTAVIGRLDGNNSNVIGNQSKKQTGTKEETDKKIRVTHNNTKRDSATTADLGSMGLGSR 1440
            ETTAVIGRLDGNNSNVIGNQSKKQTGTKEETDKKIRVTHNNTKRDSATTADLGSMGLGSR
Sbjct: 1381 ETTAVIGRLDGNNSNVIGNQSKKQTGTKEETDKKIRVTHNNTKRDSATTADLGSMGLGSR 1440

Query: 1441 SKNEGLIDVSSNMDPISTSDNMNLNTKVAVGSSSPALVDTQMNRMNRNPDTDSVNSVSSQ 1500
            SKNEGLIDVSSNMDPISTSDNMNLNTKVAVGSSSPALVDTQMNRMNRNPDTDSVNSVSSQ
Sbjct: 1441 SKNEGLIDVSSNMDPISTSDNMNLNTKVAVGSSSPALVDTQMNRMNRNPDTDSVNSVSSQ 1500

Query: 1501 LVNKAGIVRGISGHNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDYRKTRRLIVDVPKG 1560
            LVNKAGIVRGISGHNH                            KDYRKTRRLIVDVPKG
Sbjct: 1501 LVNKAGIVRGISGHNHDTATEESSTDDSSTDESSDESSSSEDESKDYRKTRRLIVDVPKG 1560

Query: 1561 PVIDKKITSSSIDQEHQNNSVQQNDNKIEGKKIEATTSGSNSTKKEPFVGVLQALPEKIR 1620
            PVIDKKITSSSIDQEHQNNSVQQNDNKIEGKKIEATTSGSNSTKKEPFVGVLQALPEKIR
Sbjct: 1561 PVIDKKITSSSIDQEHQNNSVQQNDNKIEGKKIEATTSGSNSTKKEPFVGVLQALPEKIR 1620

Query: 1621 PSLSSLSDLVSRGIPDVRESTIKGRSTAHQIVGGKXXXXXXXXXXXXXXXXXXXXGYKPT 1680
            PSLSSLSDLVSRGIPDVRESTIKGRSTAHQIVGGK                    GYKPT
Sbjct: 1621 PSLSSLSDLVSRGIPDVRESTIKGRSTAHQIVGGKGNSSNVSFSLGVSSSQQKSLGYKPT 1680

Query: 1681 VDKQASGVTKQIPVKPL 1697
            VDKQASGVTKQIPVKPL
Sbjct: 1681 VDKQASGVTKQIPVKPL 1697

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  331 bits (848), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 222/548 (40%), Positives = 299/548 (54%), Gaps = 64/548 (11%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60
           MYKLQV+LVPPS+Q     + + YG    +IA+ SQ LPN+ N         QS  D+S+
Sbjct: 1   MYKLQVVLVPPSLQAT-MPIQFGYGP---TIAESSQLLPNRTNM-------AQSAGDASL 49

Query: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120
                RS +   TP+Y+ Q   +KFL FTK  NTLL+LSDEI DKC+ MYPSL+ D++IL
Sbjct: 50  QYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEIL 109

Query: 121 SLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLNPESLAD 180
           SLQD++GCDL              IVRVIL +E+D+ +  PVS Y+S+KR +LN  S   
Sbjct: 110 SLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQS 169

Query: 181 SKDQSDFGVESQSIKVVKKR----GSTSNVIKGQSNINGRISTPLARQLY-PPSAIFEPQ 235
            + Q      S  +++ KKR     +T+  I+  +N + R+STPLARQ+Y PPS+     
Sbjct: 170 VQPQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSN 229

Query: 236 NSD--DEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGEQDTVSRSATVDPDKS 293
           NSD  DE++ +RSFL                 D   +KI S I E+D VSRSATVDPDK+
Sbjct: 230 NSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAG-KKIKSSIVEEDIVSRSATVDPDKT 288

Query: 294 RQQRLLSGTPVMSTMTPNRVTLTGQRVISEQ----------------RPNDSVLTFTNRH 337
           +QQRLLSGTP+MSTMTPNRVTLTGQRV+SE                   N      T + 
Sbjct: 289 KQQRLLSGTPIMSTMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQD 348

Query: 338 INE--PSHSRRITSGMLQIPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXXXFIETER 395
           IN   P  + RITSGML+IPEP+I+E+EKEL EG                    ++E   
Sbjct: 349 INRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGE 408

Query: 396 YYSEDSSETESN----SGEINAKSSLHR-QTSIADNNGSPLRTNFLNEA----VHLADLP 446
            Y  D S +  N      E ++K+SL R Q+SIADNNGSP++ + L +A    VHLA+LP
Sbjct: 409 NYESDDSSSSENQETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELP 468

Query: 447 E--------------LQKSEKASKPRKQVYGSITVNSSNLQPI----PNNINNYVETNAT 488
           +                K ++   PRK    +I    S  +P     P  + N+++ N  
Sbjct: 469 KASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQV 528

Query: 489 KVRSTVND 496
           + +   ND
Sbjct: 529 REKEDTND 536

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 57/101 (56%), Gaps = 10/101 (9%)

Query: 1548 RKTRRLIVDVPKGPVIDKKITSSSIDQEHQ--NNSVQQNDNKI---EGKKIEATTSGSNS 1602
            RK RR++V+ P+ PV     +SS I+      N  +    +KI   +   + +  S  + 
Sbjct: 1008 RKARRVVVNTPREPVR----SSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSK 1063

Query: 1603 TKKEPFVGVLQALPEKIRPSLSSLSDLVSRGIPDVRESTIK 1643
            T   P   +L  LP K+RPSLSSLSDLVSRGIPDV+E T K
Sbjct: 1064 TTSNP-SSILHDLPRKVRPSLSSLSDLVSRGIPDVKEKTSK 1103

>Scas_675.24
          Length = 1319

 Score =  251 bits (640), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 177/438 (40%), Positives = 233/438 (53%), Gaps = 51/438 (11%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTF---NNTFNGQSQPD 57
           MYKLQV+LVPPS +++   L+Y   Q ++S      Q  N  NG+     +  NG     
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSS------QFMNDGNGSNILPKSMINGTGDMS 54

Query: 58  SSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADL 117
                  T +  S++ PNY  Q   KKFLHFTK  N+LL LSDE+  KC+ MYP+L  DL
Sbjct: 55  MQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNEDL 114

Query: 118 DILSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLN--- 174
           +IL+LQD NGCDL              +V V++ +ELD+S     S YR+ KR++LN   
Sbjct: 115 EILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNGG 174

Query: 175 PESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNING----RISTPLARQLYPPSA 230
            + L  S      G    ++K+ KKR STS+ I+  +  NG    RISTPLA Q+YP   
Sbjct: 175 AQQLKTSPRTQSTG----ALKIEKKRPSTSSGIRNPT-TNGNSTLRISTPLANQIYPSPI 229

Query: 231 IFEPQNSDDE--EVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGEQDTVSRSATV 288
           +    NSDDE  +V +RSFL                 + + ++I S I E+DTVSRS TV
Sbjct: 230 MKMTNNSDDERDDVRERSFLPPPSQPQSPPIRISSGINQS-KRIRSTIVEEDTVSRSGTV 288

Query: 289 DPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISE-----------------QRPNDSVL 331
           DPDKS+QQ +L GTP   TMTPNRVTLTGQRV+SE                 Q PN S  
Sbjct: 289 DPDKSKQQVMLPGTPANYTMTPNRVTLTGQRVLSENYNTNGNNNGLIFVSSTQGPNKS-- 346

Query: 332 TFTNRHINEPSHSR-RITSGMLQIPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXXXF 390
               +   +P+ S  RITSGML+IPEP+IAE+E+EL EG                    +
Sbjct: 347 ----QQGQQPTLSTPRITSGMLRIPEPRIAEIERELHEGPSSPASALPAKSDRIPMKKPY 402

Query: 391 IETERYYSEDSSETESNS 408
           +ET     +D S+ ES S
Sbjct: 403 LET---MEQDDSDRESTS 417

>Scas_711.38
          Length = 998

 Score =  214 bits (546), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 171/463 (36%), Positives = 242/463 (52%), Gaps = 49/463 (10%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60
           M++LQV LVP   QN         GQ     + ++ QL N       +T N    P +  
Sbjct: 3   MFRLQVELVP---QN---------GQLAQQTSIENSQL-NHTRSFIPSTENSFQYPYNRF 49

Query: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120
                  N S+ T N       KKFL FTK  N L  LS EI +KC++MYP L  +L+I 
Sbjct: 50  LSFGLPLNFSIPTKN-------KKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIE 102

Query: 121 SLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLN-----P 175
           +L+DS  CDL              +V+VIL +++D   +  VS+Y+SIKRR+ N     P
Sbjct: 103 TLRDSTDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQP 162

Query: 176 ESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQ 235
            S   S+ Q++ GV      + +K+    +  K  SN+  RISTPLA+Q+Y P    + +
Sbjct: 163 LSNKVSQQQAN-GV----YGIPRKQYLAISSTKTPSNVGRRISTPLAQQIY-PDIDEQLE 216

Query: 236 NSDDEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGEQDTVSRSATVDPDKSRQ 295
           N +D   ADRSFL                 D + +KI   I + D+VSRS  VDPDKS+Q
Sbjct: 217 NEEDRNAADRSFLPPPAQPQSPQIRVSSGIDRS-KKIDG-IAKDDSVSRSEVVDPDKSKQ 274

Query: 296 QRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSH-----SRRITSG 350
           QRLL GTP+M+TMTPNRVTLTGQRV+SE   ++S+    N   N         +RR+ S 
Sbjct: 275 QRLLLGTPIMTTMTPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQRLSSNSNRRVNSA 334

Query: 351 MLQ-IPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXXXFIE-TERYYSEDSSETESNS 408
           +L+ IPEPKI E+EK L  G                    F+      YS+++  ++S++
Sbjct: 335 VLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFLTGVSSSYSDENISSDSST 394

Query: 409 GEINAKSSLHRQTSIADNNGSPLRTNFLNE-----AVHLADLP 446
              +++ +L RQ+SIADNNGSP++ N  NE     ++ LA+LP
Sbjct: 395 ---HSRPTLQRQSSIADNNGSPVK-NSPNEENNPDSMQLAELP 433

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 23/26 (88%)

Query: 1614 ALPEKIRPSLSSLSDLVSRGIPDVRE 1639
             LP K+RPSL+SLSDL+ +GIPDV+E
Sbjct: 891  GLPPKVRPSLNSLSDLIYKGIPDVKE 916

>Kwal_14.2421
          Length = 1205

 Score =  203 bits (517), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 164/485 (33%), Positives = 244/485 (50%), Gaps = 84/485 (17%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKV--NGTFNNTFNGQSQPDS 58
           MYKLQV+LVPP      F+L       N   AD SQ LP  +  NG+   T  G ++P+ 
Sbjct: 1   MYKLQVVLVPPGFSGVTFAL-----PTNPPTADNSQVLPPNIVSNGS---TILGANRPE- 51

Query: 59  SIFPVLTRSNSSLLTPNYYAQRS----MKKFLHFTKANNTLLDLSDEINDKCKAMYPSLE 114
                 T S+++L   ++ +       ++K LHFTK  NTL  L++EI ++C  +YP+L 
Sbjct: 52  --LGQQTGSSNNLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLT 109

Query: 115 ADLDILSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLN 174
             +++L+LQDSN CDL              +VR +L +++++S+    + Y S KRRRLN
Sbjct: 110 RPVEVLTLQDSNECDLDPDYLVKDVFNVDNVVRAVLRNDIELSDDQSQTLY-SAKRRRLN 168

Query: 175 PESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEP 234
             SL +   Q +       + + KKR    ++++  S +  R+STPLA Q+YPP A    
Sbjct: 169 -SSLPNPSGQPNV------LHIAKKR---PHMLRNSSAM--RVSTPLANQIYPP-ATGRQ 215

Query: 235 QNSD--DEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGE-------QDTVSRS 285
            NSD  D++V DRS L                      +I+S +G        +DTVSRS
Sbjct: 216 VNSDYEDDDVGDRSVLPPPQPQSQPI------------RISSGVGSAKKINFNEDTVSRS 263

Query: 286 ATVDPDKSRQQRLLSGTPVM-----STMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINE 340
             VDPDKSRQQRL SGTP+      +  TPNR+ +    + +++  N S  T        
Sbjct: 264 EAVDPDKSRQQRLPSGTPMRHINNGTATTPNRLNVLDGTLQADEVTNKSSATPV------ 317

Query: 341 PSHSRRITSGMLQIPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXXXFIETERYYSED 400
            + ++RITSGML+IPEPKI+E+E EL +G                     ++ +++   D
Sbjct: 318 -ATNKRITSGMLRIPEPKISEIENELRQGPASPSAELPPRPDRIP-----MKKQQFPQSD 371

Query: 401 SSETESNSG---------------EINAKSSLHRQTSIADNNGSPLRTNFLNEAVHLADL 445
             E   +SG               E  +K S  RQTSIADNNGSP++       V+LA+L
Sbjct: 372 DEEQSQSSGNENPTLMEKANNLILEHGSKPSASRQTSIADNNGSPIKDGNKIGNVNLAEL 431

Query: 446 PELQK 450
           P++ +
Sbjct: 432 PQVGR 436

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  181 bits (458), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 233/477 (48%), Gaps = 61/477 (12%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60
           MYKLQV+LVPPSI+     +    G  +NS   Q    P     + ++   G+ +  S I
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPI----STSSIAGGRGEFSSGI 56

Query: 61  FPVLTRSNS---SLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADL 117
               T +N+   S L   +  +   +KFLHFTK  N+L +L+DEI +KC  MYP L  + 
Sbjct: 57  G--NTSANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEP 114

Query: 118 DILSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSI--KRRRLNP 175
           +I++LQD N CDL               VRV+L ++LD +     +  R+I  K+R+LN 
Sbjct: 115 EIVTLQDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLDEA-----AGDRTIYMKKRKLN- 168

Query: 176 ESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQ 235
            + A     +   V++  + V KKR S    IK  +    R+STPLA Q+YPP    +  
Sbjct: 169 -TGAAGVPAAGGSVQAAVLNVAKKRAS----IKTSA---LRVSTPLANQIYPPPTKKQ-V 219

Query: 236 NSD--DEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKITSRIGEQD-TVSRSATVDPDK 292
           NSD  D++VAD+S L                          RI   D  VS+S TVDP+K
Sbjct: 220 NSDFEDDDVADKSILPPPPPQSPPIRISSGMDQ-------KRINMNDNAVSKSETVDPNK 272

Query: 293 SRQQRLLSGT---PVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHINEPSHSR-RIT 348
           SRQQRL SGT   PV    TPNRV+LTG  V+SE        T + +    P  +  RIT
Sbjct: 273 SRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSES-------TVSQKSTATPIITNIRIT 325

Query: 349 SGMLQIPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXXXF---IETERYYSEDSSETE 405
           SGML+IPEP+++E+EKEL EG                    +   ++ +   S  SS TE
Sbjct: 326 SGMLRIPEPRLSEVEKELKEGPASPAVDLPARPSRIPMKKPYNPSMQQDEDLSSSSSSTE 385

Query: 406 SNSGEINAKSSLHR----------QTSIADNNGSPL-RTNFLNEAVHLADLPELQKS 451
            N   +  ++ L R           ++IAD+ GSP  ++ F    + L +LP  +KS
Sbjct: 386 DNVPAVPYENELERSGPTMATRQSSSTIADDQGSPTKKSRFEKNNIGLVELPSPRKS 442

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  167 bits (422), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 166/504 (32%), Positives = 232/504 (46%), Gaps = 93/504 (18%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQL---------------PNKVNGT 45
           M+KLQV+LVP     +     +N+G    S++ +S Q                P   N  
Sbjct: 1   MFKLQVVLVPAGANRS-----FNFGLP--SVSSESSQFILPVQQQVLQQGGNAPQLANNI 53

Query: 46  FNNTFNGQSQPDSSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDK 105
                 G   P+ S     T   SS +T ++  +  +KKFL FTK  NTL  LS EI DK
Sbjct: 54  PAQNGIGALDPNVSTN---TAYLSSFMT-SHITRPKLKKFLIFTKPTNTLYQLSQEILDK 109

Query: 106 CKAMYPSLEADLDILSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITP--VS 163
           C  +YP+L  +L+I +LQD + CDL               VRVIL +++D+ E  P    
Sbjct: 110 CNKIYPNLSTELEIDTLQDVDECDLDPDFVVKDVFNVYNTVRVILRNDVDL-ESNPDRQE 168

Query: 164 SYRSIKRRRLNPESLADSKDQSDFGVE-SQSIKVVKKRGSTSNVIKGQSNINGRISTPLA 222
           S  S KRR+LN     +S+  +  G    Q + V K+R       +   N   RISTPLA
Sbjct: 169 SLYSSKRRKLN---NGNSQQNTSTGATLDQPVTVAKRRP------QALKNSALRISTPLA 219

Query: 223 RQLYPPSAIFEPQ--NSD-------DEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKIT 273
            Q+YPP +   P+  NSD       D+E+ D+S L                      KI 
Sbjct: 220 HQIYPPPSQRNPKQVNSDYEEDEYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRLKIN 279

Query: 274 SRIGEQDTVSRSATVDPDKSRQQRLLSGTPV--MSTM-TPNRVTLTG--QRVISEQRPND 328
              G +DTVS+S TVDP K++QQRL SGTP+  M+ + TPNR       Q+     R N 
Sbjct: 280 ---GSEDTVSKSETVDPSKAKQQRLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRIN- 335

Query: 329 SVLTFTNRHINEPSHSRRITSGMLQIPEPKIAEMEKELLEGXXXXXXXXXXXXXXXXXXX 388
           S    TN         +RITSGML+IPEP+I+EME+ + EG                   
Sbjct: 336 STPVVTN---------KRITSGMLRIPEPRISEMERTMHEGLSSPAAGLLPPKSAK---- 382

Query: 389 XFIETERYYSEDSSETESNSGE-----------INAKSSL------HRQTSIADNNGSPL 431
             I  ++ Y  D  ++ S+ GE           +N+K+ L         +SIAD+NGSP 
Sbjct: 383 --IPMKKQYIPDEHDSSSSEGEFTEDKESVPVRVNSKAPLPVSVQSRAPSSIADDNGSPT 440

Query: 432 RTNFLNEA----VHLADLPELQKS 451
           + + L+      V +ADLP  +KS
Sbjct: 441 KKSPLDATKRMNVKVADLPPQRKS 464

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 166/368 (45%), Gaps = 80/368 (21%)

Query: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60
           MYKLQV+L+ P  QN                     QL  K NG    + +G +  D +I
Sbjct: 1   MYKLQVVLIQP--QN---------------------QL--KANGY---SIDGDNSDDQTI 32

Query: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEAD-LDI 119
                   +++    +  +   +KFLHFTK  NTLL L+DEI ++   +Y +L  +  +I
Sbjct: 33  --------TTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEI 84

Query: 120 LSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDEL------------DISEITPVSSYRS 167
           LSLQD N CDL               V VIL +EL            D+ +   +S+Y S
Sbjct: 85  LSLQDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSS 144

Query: 168 IKRRRLNPESLADSKDQSDFG----VESQSIKVVKKRGSTSNVIKGQSNINGRISTPLAR 223
           +++RR              FG    +E Q +  V KR   +N+    +N+  R+++PLA 
Sbjct: 145 VRKRR----------SSKAFGNSSRIEPQIL--VPKRSKPNNLAPLSNNL--RVTSPLAN 190

Query: 224 QL----YPPSAIFEPQN------SDDEEVADRSFLXXXXXXXXXXXXXXXXXDTNVRKIT 273
           ++       S +   +N      ++   + DRSFL                   + ++I 
Sbjct: 191 EISNDEINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIG-DGKRIF 249

Query: 274 SRIGEQDTVSRSATVDPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTF 333
           S     D VSRS  VDPDKS+QQ ++   P+    TPNRV L+GQRVISE +P    L F
Sbjct: 250 SESQNLDVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISESQPKS--LVF 307

Query: 334 TNRHINEP 341
           + + IN P
Sbjct: 308 SKKRINSP 315

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 121/249 (48%), Gaps = 23/249 (9%)

Query: 1   MYKLQVLLVPPSIQN--NNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDS 58
           M++LQ++LVPPS Q+         N  Q+ + +   ++ +    N + NN  +      S
Sbjct: 4   MWRLQIVLVPPSAQDIITFLEARLNTPQSVSPMVQYNEDIITH-NNSINNCSDPSPTSPS 62

Query: 59  SIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLD 118
           S   + +  +S  +  NY    + KKFLHFT  +NTLL LS+EI  K   +YP+ +  ++
Sbjct: 63  SQNSIQSNRSSDFI--NYLP--NCKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIE 118

Query: 119 ILSLQDSNGCDLXXXXXXXXXXXXXXIVRVILNDELDISEITPVSSYRSIKRRRLNPESL 178
           I+SLQD +GCDL              +V VIL DELD S    +S  +  ++RR      
Sbjct: 119 IVSLQDRHGCDLDSEFIIKDVFENDGVVLVILKDELDWSRNQHISLLQLARQRRRQ---- 174

Query: 179 ADSKDQSDFGVESQSIKVVKKRGS------TSNVIKGQSNIN-----GRISTPLARQLYP 227
            D+K  +   V  +  K+ K+  S      T ++I   S  N      R+STPL  ++ P
Sbjct: 175 -DNKPSTKSIVTEKRKKISKEDLSSISNKDTMHLIAKSSLKNNFINKSRVSTPLMNEILP 233

Query: 228 PSAIFEPQN 236
            ++ ++  N
Sbjct: 234 LASKYDALN 242

>Kwal_23.5534
          Length = 1907

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 1312 APSEKDLNSNTAPPVNNSQKTNGRNGLDEQLEQRVETVTRLPSPVKNKIREQ 1363
            A  +KDL+S  A      QK N  N L +++ Q+ +T  +L     NK+REQ
Sbjct: 851  AQKQKDLDSVLAKEAELKQKLNESNELQQEIMQKKDTELKLKLDESNKLREQ 902

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.122    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,628,599
Number of extensions: 2272036
Number of successful extensions: 10205
Number of sequences better than 10.0: 552
Number of HSP's gapped: 10061
Number of HSP's successfully gapped: 767
Length of query: 1758
Length of database: 16,596,109
Length adjustment: 116
Effective length of query: 1642
Effective length of database: 12,580,421
Effective search space: 20657051282
Effective search space used: 20657051282
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 69 (31.2 bits)