Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H01485g2172149791e-136
Sklu_1122.12412165992e-78
YDR302W (GPI11)2192015869e-77
Kwal_47.181962582145812e-75
KLLA0C10252g2172165651e-73
Scas_588.122152155408e-70
AAL059W2172135303e-68
ACL197W22643730.16
KLLA0A02651g22450710.29
Sklu_2030.222350661.1
YJR040W (GEF1)77959652.0
CAGL0I01628g77459616.6
Scas_698.10d28834606.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H01485g
         (214 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces c...   381   e-136
Sklu_1122.1 YDR302W, Contig c1122 522-1247                            235   2e-78
YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved ...   230   9e-77
Kwal_47.18196                                                         228   2e-75
KLLA0C10252g complement(878425..879078) similar to sgd|S0002710 ...   222   1e-73
Scas_588.12                                                           212   8e-70
AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH] complement(...   208   3e-68
ACL197W [852] [Homologous to ScYBL064C - NSH] complement(16998.....    33   0.16 
KLLA0A02651g complement(238735..239409) similar to ca|CA4416|IPF...    32   0.29 
Sklu_2030.2 , Contig c2030 1315-1986                                   30   1.1  
YJR040W (GEF1) [2934] chr10 (507660..509999) Voltage-gated chlor...    30   2.0  
CAGL0I01628g complement(132246..134570) similar to sp|P37020 Sac...    28   6.6  
Scas_698.10d                                                           28   6.9  

>CAGL0H01485g 146756..147409 similar to tr|Q06636 Saccharomyces
           cerevisiae YDR302w GPI11, start by similarity
          Length = 217

 Score =  381 bits (979), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/214 (87%), Positives = 188/214 (87%)

Query: 1   MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVYIY 60
           MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVYIY
Sbjct: 1   MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVYIY 60

Query: 61  VKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXXXX 120
           VKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILAC       
Sbjct: 61  VKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACIVLSIPV 120

Query: 121 XXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWIS 180
                 FGAP             HCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWIS
Sbjct: 121 VVIIILFGAPLLELLWETWLLALHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWIS 180

Query: 181 CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG
Sbjct: 181 CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214

>Sklu_1122.1 YDR302W, Contig c1122 522-1247
          Length = 241

 Score =  235 bits (599), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 151/216 (69%), Gaps = 3/216 (1%)

Query: 1   MPVKKRTPLKHKSVSFSDD--ITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVY 58
           MPVKKR   K K+VSFSDD  + + +  +H +K+ + + PPV++R+T+LTIP+HL+ L+Y
Sbjct: 24  MPVKKRVTPK-KTVSFSDDESLNRARQLNHKKKRIDHDNPPVYVRRTYLTIPFHLLPLLY 82

Query: 59  IYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXX 118
            ++K+ +NY+   LL   +P QILY +FQFNK+T+YGNK LK N  L  +S+ AC     
Sbjct: 83  YFIKISDNYDVVSLLWYSIPPQILYLVFQFNKSTVYGNKILKTNLGLLFVSLGACLLLSV 142

Query: 119 XXXXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCW 178
                   FGA              HC FL++PAVYSV NCDFKVG++K+YFI IV+GCW
Sbjct: 143 PAMVIIVLFGAFFTELLKETWLLALHCCFLSFPAVYSVFNCDFKVGVFKKYFISIVIGCW 202

Query: 179 ISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           ISC+VIPLDWDRDWQ WPIPIVIGAYLGAF G++ G
Sbjct: 203 ISCIVIPLDWDRDWQNWPIPIVIGAYLGAFTGYSLG 238

>YDR302W (GPI11) [1130] chr4 (1067723..1068382) Protein involved in
           glycosylphosphatidylinositol (GPI) biosynthesis, with
           similarity to GPI-anchor biosynthesis protein PIG-F [660
           bp, 219 aa]
          Length = 219

 Score =  230 bits (586), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 112/201 (55%), Positives = 136/201 (67%), Gaps = 1/201 (0%)

Query: 15  SFSDDITQTQHNHHHRKKQNGERPPVFIRKT-WLTIPWHLIALVYIYVKVFNNYNTAELL 73
           SFSDD T T H +  +K  + +RPPV++RKT  +T P+HL+AL+Y YV V +N+NT +LL
Sbjct: 16  SFSDDTTLTTHQNREKKNVDHDRPPVYVRKTPLMTFPYHLVALLYYYVFVSSNFNTVKLL 75

Query: 74  ACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXXXXXXXXXXFGAPXXX 133
           + L+P Q+ Y + QFNK T+YGNK +K NYSL  I +                FGAP   
Sbjct: 76  SFLIPTQVAYLVLQFNKCTVYGNKIIKINYSLTIICLGVTFLLSFPTMLLTILFGAPLMD 135

Query: 134 XXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWISCVVIPLDWDRDWQ 193
                     H +FLAYPAVYSV NCDFKVGLWK+YFI IVVG WISCVVIPLDWDRDWQ
Sbjct: 136 LLWETWLLSLHFAFLAYPAVYSVFNCDFKVGLWKKYFIFIVVGGWISCVVIPLDWDRDWQ 195

Query: 194 AWPIPIVIGAYLGAFVGFAYG 214
            WPIPIV+G YLGA VG+  G
Sbjct: 196 NWPIPIVVGGYLGALVGYTIG 216

>Kwal_47.18196
          Length = 258

 Score =  228 bits (581), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 149/214 (69%), Gaps = 3/214 (1%)

Query: 1   MPVKKRTPLKHKSVSFSDD--ITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVY 58
           M  KKR   K K+VSFSDD  ++++Q +++ + + + + PPVF++KT LT+P HLIAL+Y
Sbjct: 41  MAPKKRGAFK-KTVSFSDDESLSRSQISNNKKHRSDTDGPPVFLKKTLLTVPVHLIALLY 99

Query: 59  IYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXX 118
            Y+KV  +++T  LL  L+PLQ+LY I QFNK+T+YG K LK   SL  I+++A      
Sbjct: 100 YYIKVSKDFDTVILLYALIPLQVLYLIIQFNKSTVYGRKILKIKLSLVPITLVATLLLTV 159

Query: 119 XXXXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCW 178
                    GAP             HC FLA+PAVYSV NC+FKVG++K+YFI I +GCW
Sbjct: 160 PCMLIIILMGAPFAMLLQETWLLAAHCCFLAFPAVYSVFNCEFKVGIFKKYFISIAIGCW 219

Query: 179 ISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFA 212
           ISC+VIPLDWDRDWQ+WPIP+++GAY+GAF G++
Sbjct: 220 ISCIVIPLDWDRDWQSWPIPLIVGAYVGAFFGYS 253

>KLLA0C10252g complement(878425..879078) similar to sgd|S0002710
           Saccharomyces cerevisiae YDR302w GPI11 GPI11 - protein
           involved in glycosylphosphatidylinositol (GPI)
           biosynthesis, start by similarity
          Length = 217

 Score =  222 bits (565), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 146/216 (67%), Gaps = 4/216 (1%)

Query: 1   MPVKKRTPLKHKSVSFSDD--ITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVY 58
           M  +KR  +K K+VSFSDD  +T    N+H +   + + PPV++RK+W  IP+HL+AL+Y
Sbjct: 1   MHNRKRKTVK-KTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLY 59

Query: 59  IYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXX 118
            ++K + ++N   LL  ++P Q++Y IF+FNK TIYG KRL+ N+ L  I++ AC     
Sbjct: 60  WFLK-YTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSI 118

Query: 119 XXXXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCW 178
                   FGAP             HC FL YPAVY V NC+FKVG +K+YFI +V+GCW
Sbjct: 119 PCLAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCW 178

Query: 179 ISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           ISC VIPLDWDRDWQAWP+P+++GAYLG+F+GF+ G
Sbjct: 179 ISCFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIG 214

>Scas_588.12
          Length = 215

 Score =  212 bits (540), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 140/215 (65%), Gaps = 4/215 (1%)

Query: 1   MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNG-ERPPVFIRKTWLTIPWHLIALVYI 59
           M  KKR  +K K V+FSDD T  +  H  RKK  G E PPV++RK  + IPWHL+ L+Y 
Sbjct: 1   MATKKRNQVK-KKVTFSDDNTMVRQTH--RKKNVGHEHPPVYVRKNIMIIPWHLLVLLYW 57

Query: 60  YVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXXX 119
           Y+ V  +Y T +LL  L+P Q+LY IFQFN+ T+YGNK +K N  L  IS+         
Sbjct: 58  YLYVALDYPTDKLLYALIPTQLLYLIFQFNQYTVYGNKIIKLNVPLVFISMGCTILLSIP 117

Query: 120 XXXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWI 179
                  FGAP             HC FLAYPA+YSV NCDFKVGLWK+YFI IVVG W+
Sbjct: 118 ALVLIILFGAPFLEKLKESLLLALHCCFLAYPAMYSVFNCDFKVGLWKKYFITIVVGAWL 177

Query: 180 SCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           SCVVIPLDWDR WQAWP+P ++G+YLGAFVG+  G
Sbjct: 178 SCVVIPLDWDRPWQAWPVPAIVGSYLGAFVGYTIG 212

>AAL059W [128] [Homologous to ScYDR302W (GPI11) - SH]
           complement(245111..245764) [654 bp, 217 aa]
          Length = 217

 Score =  208 bits (530), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 129/213 (60%)

Query: 1   MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRKTWLTIPWHLIALVYIY 60
           M  KKR   K K VSFSDD   ++     +       PPV++R+TW TIP+HLI L Y +
Sbjct: 1   MTTKKRPVGKKKFVSFSDDDALSRTGRLPKNLPQHGSPPVYVRRTWQTIPFHLIVLSYWF 60

Query: 61  VKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFNYSLAAISILACXXXXXXX 120
           +K  N Y+  +    LVP Q+LY   QFN AT+YGNK LK NY+L A+S + C       
Sbjct: 61  IKHSNGYDVRKCTWLLVPCQVLYLALQFNPATVYGNKILKLNYALLAVSGVTCILLTIPC 120

Query: 121 XXXXXXFGAPXXXXXXXXXXXXXHCSFLAYPAVYSVLNCDFKVGLWKRYFILIVVGCWIS 180
                 FGAP             HC  L+YPAVYSVLN DFKVG +K+YFI I VGCWIS
Sbjct: 121 MLLVVLFGAPFLEMLDKTWLLSLHCCVLSYPAVYSVLNSDFKVGFFKKYFISIAVGCWIS 180

Query: 181 CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAY 213
           C+ IPLDWDR WQ WPIP+V+GA LGA  G+ +
Sbjct: 181 CLAIPLDWDRPWQEWPIPLVVGAQLGAMFGYTF 213

>ACL197W [852] [Homologous to ScYBL064C - NSH]
           complement(16998..17678) [681 bp, 226 aa]
          Length = 226

 Score = 32.7 bits (73), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 39  PVFIRKTWLTIPWHLIALVYIYVKVFNNYNTAELLACLVPLQI 81
           PV +R T+   P  +I LV  Y  +    NTAELL CL  LQ+
Sbjct: 128 PVPLRSTYFVDPNKVIRLVQSY-PLSTGRNTAELLRCLDSLQL 169

>KLLA0A02651g complement(238735..239409) similar to
           ca|CA4416|IPF11888 Candida albicans unknown function,
           start by similarity
          Length = 224

 Score = 32.0 bits (71), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 34  NGERPPVFIRKTWLTIPWHLIALVYIYVKVFNNYNTAELLACLVPLQILY 83
           NGE     +R  ++  P  ++ L+ +Y  +    NTAE+L CL  LQ++Y
Sbjct: 125 NGEPALTPLRAVYIIDPNKIVRLIQLY-PLSTGRNTAEVLRCLDSLQLVY 173

>Sklu_2030.2 , Contig c2030 1315-1986
          Length = 223

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 33  QNGERPPVFIRKTWLTIPWHLIALVYIYVKVFNNYNTAELLACLVPLQIL 82
           Q+G+  P+ IR  ++  P   I L+ +Y  +    NTAE+L CL  LQ++
Sbjct: 124 QSGK--PIPIRCVYIIDPKKEIRLLQVY-PISTGRNTAEILRCLDSLQLV 170

>YJR040W (GEF1) [2934] chr10 (507660..509999) Voltage-gated chloride
           channel, has effects on intracellular iron metabolism
           [2340 bp, 779 aa]
          Length = 779

 Score = 29.6 bits (65), Expect = 2.0,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 12/59 (20%)

Query: 165 LWKRYFILIVVGCWIS---------CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           LWK Y++ +V    +           ++  + +DRDW+   IPI I   LG F G  YG
Sbjct: 299 LWKSYYVALVAITTLKYIDPFRNGRVILFNVTYDRDWKVQEIPIFIA--LGIFGGL-YG 354

>CAGL0I01628g complement(132246..134570) similar to sp|P37020
           Saccharomyces cerevisiae YJR040w GEF1 voltage-gated
           chloride channel protein, hypothetical start
          Length = 774

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 12/59 (20%)

Query: 165 LWKRYFILIVVGCWIS---------CVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYG 214
           LWK Y+I +V    +           V+  + +DRDW    +PI +   LG F G  YG
Sbjct: 305 LWKSYYIALVAITTLKLINPFRNGKVVLFHVTYDRDWSTQEVPIFV--LLGIFGGL-YG 360

>Scas_698.10d
          Length = 288

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 1  MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQN 34
          +PVK+R  L  K+ +FS  ++Q++H  H   K N
Sbjct: 61 VPVKERKVLTEKTNNFSTLLSQSRHTSHKSSKMN 94

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.143    0.491 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,420,129
Number of extensions: 246375
Number of successful extensions: 816
Number of sequences better than 10.0: 14
Number of HSP's gapped: 803
Number of HSP's successfully gapped: 14
Length of query: 214
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 117
Effective length of database: 13,238,163
Effective search space: 1548865071
Effective search space used: 1548865071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 59 (27.3 bits)