Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H01463g1361134067690.0
YDR301W (CFT1)1357135342020.0
Scas_588.131340134539540.0
AAL060W1305134834260.0
Kwal_47.181921307134233650.0
KLLA0C10274g1300134131400.0
CAGL0L01507g1296210810.32
CAGL0M11044g37987695.7
YNL253W (TEX1)42267687.8
CAGL0J00583g81781689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H01463g
         (1340 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces c...  2612   0.0  
YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-m...  1623   0.0  
Scas_588.13                                                          1527   0.0  
AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH] complement(2...  1324   0.0  
Kwal_47.18192                                                        1300   0.0  
KLLA0C10274g complement(879403..883305) similar to sgd|S0002709 ...  1214   0.0  
CAGL0L01507g 165212..169102 similar to sp|Q04693 Saccharomyces c...    36   0.32 
CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869 Saccha...    31   5.7  
YNL253W (TEX1) [4354] chr14 (170017..171285) Component of the TR...    31   7.8  
CAGL0J00583g 50462..52915 similar to sp|P18962 Saccharomyces cer...    31   9.9  

>CAGL0H01463g 142420..146505 similar to tr|Q06632 Saccharomyces
            cerevisiae YDR301w CFT1 pre-mRNA 3 -end processing factor
            CF II, start by similarity
          Length = 1361

 Score = 2612 bits (6769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1283/1340 (95%), Positives = 1283/1340 (95%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI
Sbjct: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120
            NDVALIPKH                 TGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT
Sbjct: 61   NDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120

Query: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXXX 180
            MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTG                         
Sbjct: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINEDEDEDYINNDKSKINDNSKKSL 180

Query: 181  XXXXXXXTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS 240
                   TQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS
Sbjct: 181  FKRKKGKTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS 240

Query: 241  QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF 300
            QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF
Sbjct: 241  QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF 300

Query: 301  LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILLF 360
            LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILLF
Sbjct: 301  LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILLF 360

Query: 361  DENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGF 420
            DENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGF
Sbjct: 361  DENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGF 420

Query: 421  QSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXXXFNLYSDEENDQV 480
            QSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNE        FNLYSDEENDQV
Sbjct: 421  QSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEDDDDDDDDFNLYSDEENDQV 480

Query: 481  NNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEISIV 540
            NNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEISIV
Sbjct: 481  NNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEISIV 540

Query: 541  CTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNIYE 600
            CTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNIYE
Sbjct: 541  CTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNIYE 600

Query: 601  IDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVVH 660
            IDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVVH
Sbjct: 601  IDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVVH 660

Query: 661  VSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFLS 720
            VSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFLS
Sbjct: 661  VSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFLS 720

Query: 721  GIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPDP 780
            GIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPDP
Sbjct: 721  GIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPDP 780

Query: 781  SIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDNAY 840
            SIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDNAY
Sbjct: 781  SIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDNAY 840

Query: 841  PKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWGEG 900
            PKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWGEG
Sbjct: 841  PKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWGEG 900

Query: 901  SVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLVSY 960
            SVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLVSY
Sbjct: 901  SVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLVSY 960

Query: 961  TKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDMKS 1020
            TKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDMKS
Sbjct: 961  TKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDMKS 1020

Query: 1021 SFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEIFK 1080
            SFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEIFK
Sbjct: 1021 SFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEIFK 1080

Query: 1081 EDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIVI 1140
            EDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIVI
Sbjct: 1081 EDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIVI 1140

Query: 1141 GDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKYA 1200
            GDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKYA
Sbjct: 1141 GDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKYA 1200

Query: 1201 PDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISKI 1260
            PDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISKI
Sbjct: 1201 PDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISKI 1260

Query: 1261 VPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFKD 1320
            VPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFKD
Sbjct: 1261 VPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFKD 1320

Query: 1321 MSMNRRSHIVQKLGKNSNLE 1340
            MSMNRRSHIVQKLGKNSNLE
Sbjct: 1321 MSMNRRSHIVQKLGKNSNLE 1340

>YDR301W (CFT1) [1129] chr4 (1063344..1067417) Component of pre-mRNA
            cleavage factor II [4074 bp, 1357 aa]
          Length = 1357

 Score = 1623 bits (4202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 791/1353 (58%), Positives = 1011/1353 (74%), Gaps = 28/1353 (2%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MNVYDDV+D TVVSHS+  HFTT+DY EL+V+RT++LS+Y+P R G+LYL +E K  G I
Sbjct: 1    MNVYDDVLDATVVSHSLATHFTTSDYEELLVVRTNILSVYRPTRDGKLYLTDEFKFHGLI 60

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120
             D+ LIP+                  TGVAK+S+L +N +T+SI+T+SLH+YE KF+  +
Sbjct: 61   TDIGLIPQKDSPLSCLLLC-------TGVAKISILKFNTLTNSIDTLSLHYYEGKFKGKS 113

Query: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXXX 180
            +++LA+ S LR++P  + A+LFNND++A LPF+                           
Sbjct: 114  LVELAKISTLRMDPGSSCALLFNNDIIAFLPFHVNKNDDDEEEEDEDENIDDSELIHSMN 173

Query: 181  XXXXXXXTQN--------NKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQP 232
                   T N        +K T PS+++  SEL    KNI DIQFL  FTK TI +LYQP
Sbjct: 174  QKSQGTNTFNKRKRTKLGDKFTAPSVVLVASELYEGAKNIIDIQFLKNFTKPTIALLYQP 233

Query: 233  QLAWCGNSQLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLI 292
            +L W GN+ +  LPT Y I++L+++ +  AT  +   I+ + +LP D HTI P  +G++I
Sbjct: 234  KLVWAGNTTISKLPTQYVILTLNIQPAESATKIESTTIAFVKELPWDLHTIVPVSNGAII 293

Query: 293  LGVNEIAFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFAL-IPS---- 347
            +G NE+AFLDNTGVLQS + LNS++DK L K ++I+ SS E+ F   +  ++ IPS    
Sbjct: 294  VGTNELAFLDNTGVLQSTVLLNSFADKELQKTKIINNSSLEIMFREKNTTSIWIPSSKSK 353

Query: 348  NENERSVENILLFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWA 407
            N    + E +LL D    I+ + +++EGRLL +F+I KLP+  D+L + SNP  ++ + A
Sbjct: 354  NGGSNNDETLLLMDLKSNIYYIQMEAEGRLLIKFDIFKLPIVNDLLKENSNPKCITRLNA 413

Query: 408  DGRLDTYTIFIGFQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXX 467
                    +FIGF SG+A +L+LN+L S IE  E      +     + +  +        
Sbjct: 414  TNSNKNMDLFIGFGSGNALVLRLNNLKSTIETREA-----HNPSSGTNSLMDINDDDDEE 468

Query: 468  XFNLYSDEENDQVNNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVK 527
              +LY+DE  +     ND   GT E+ +PF  + L  LRN+GPI S+ VGKVSSI+D VK
Sbjct: 469  MDDLYADEAPENGLTTNDSK-GTVETVQPFDIELLSSLRNVGPITSLTVGKVSSIDDVVK 527

Query: 528  GLPNPNKQEISIVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLI 587
            GLPNPNK E S+V TSG G GSHL  I  SVQP +E ALKFISIT+IWNL IKG+D++LI
Sbjct: 528  GLPNPNKNEYSLVATSGNGSGSHLTVIQTSVQPEIELALKFISITQIWNLKIKGRDRYLI 587

Query: 588  TTDSTQSQSNIYEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFR 647
            TTDST+S+S+IYE DNNF  HK GRLRRDATT++I+  G+ KRI+QVTTNHLYLYD  FR
Sbjct: 588  TTDSTKSRSDIYESDNNFKLHKGGRLRRDATTVYISMFGEEKRIIQVTTNHLYLYDTHFR 647

Query: 648  RFSTIKFDYEVVHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSG 707
            R +TIKFDYEV+HVSVMDPY+L+T+SRGDIK+FELE +NK+K +KV LPEIL EMVITSG
Sbjct: 648  RLTTIKFDYEVIHVSVMDPYILVTVSRGDIKIFELEEKNKRKLLKVDLPEILNEMVITSG 707

Query: 708  LILKSNMCNEFLSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYI 767
            LILKSNMCNEFL G+ KS  EQLLFTFVTADNQIIFFTKDHNDRIFQLNG+DQL +SLYI
Sbjct: 708  LILKSNMCNEFLIGLSKSQEEQLLFTFVTADNQIIFFTKDHNDRIFQLNGVDQLNESLYI 767

Query: 768  STYQLPDEIIPDPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGR 827
            STYQL DEI+PDPSIKQ+MINKLG+++K+EYLTILTFGGEIYQY+K   R SRFYRNV R
Sbjct: 768  STYQLGDEIVPDPSIKQVMINKLGHDNKEEYLTILTFGGEIYQYRKLPQRRSRFYRNVTR 827

Query: 828  NDHPITGAPDNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFG 887
            ND  ITGAPDNAY KGVS IERIMHY P+++GYSVIFVTG+ PYI++KEDDS P+IF FG
Sbjct: 828  NDLAITGAPDNAYAKGVSSIERIMHYFPDYNGYSVIFVTGSVPYILIKEDDSTPKIFKFG 887

Query: 888  NIPIVSMSRWGEGSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSI 947
            NIP+VS++ W E SV+C+DDIKNAR+Y+L  DN+YYGNKLP+++IKI ++L +YKTL  +
Sbjct: 888  NIPLVSVTPWSERSVMCVDDIKNARVYTLTTDNMYYGNKLPLKQIKISNVLDDYKTLQKL 947

Query: 948  VYHERTQLYLVSYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDEL 1007
            VYHER QL+LVSY K + YEA  EDG  +IGY   +P+A+ F+SG+LLINPKSW+VID++
Sbjct: 948  VYHERAQLFLVSYCKRVPYEALGEDGEKVIGYDENVPHAEGFQSGILLINPKSWKVIDKI 1007

Query: 1008 DLPDNSLVNDMKSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPG 1067
            D P NS+VN+M+SS IQI+++TKRKREYII G+  AT ED PPTG FHIYD+ EVVPEPG
Sbjct: 1008 DFPKNSVVNEMRSSMIQINSKTKRKREYIIAGVANATTEDTPPTGAFHIYDVIEVVPEPG 1067

Query: 1068 KPNTNFKLKEIFKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVF 1127
            KP+TN+KLKEIF+E++ G VS V  +SGRF+ISQSQK++VRD+Q+DNSVIPVAFLD+PVF
Sbjct: 1068 KPDTNYKLKEIFQEEVSGTVSTVCEVSGRFMISQSQKVLVRDIQEDNSVIPVAFLDIPVF 1127

Query: 1128 VTSLKTFGNLIVIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLV 1187
            VT  K+FGNL++IGDAMQG QF+GFDAEPYRMI+LG S++KF+ +S+EFLVN GD+YF  
Sbjct: 1128 VTDSKSFGNLLIIGDAMQGFQFIGFDAEPYRMISLGRSMSKFQTMSLEFLVNGGDMYFAA 1187

Query: 1188 TDRDSIMHVLKYAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQ 1247
            TD D  +HVLKYAPD+PN+LSGQRLVHCSSF LHS N+C MLLP+N+EF   Q    SFQ
Sbjct: 1188 TDADRNVHVLKYAPDEPNSLSGQRLVHCSSFTLHSTNSCMMLLPRNEEFGSPQ--VPSFQ 1245

Query: 1248 TITAQVDGSISKIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLR 1307
             +  QVDGS+ KIVP+ EE YRRLY IQQQIID+E QL GLNPRMER  N +Y +GHS+R
Sbjct: 1246 NVGGQVDGSVFKIVPLSEEKYRRLYVIQQQIIDRELQLGGLNPRMERLANDFYQMGHSMR 1305

Query: 1308 PMLDFNIIKRFKDMSMNRRSHIVQKLGKNSNLE 1340
            PMLDFN+I+RF  ++++RR  I QK G++++ E
Sbjct: 1306 PMLDFNVIRRFCGLAIDRRKSIAQKAGRHAHFE 1338

>Scas_588.13
          Length = 1340

 Score = 1527 bits (3954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1345 (54%), Positives = 987/1345 (73%), Gaps = 29/1345 (2%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MN+Y+DV+  TVVSHS+ GHFT+T   ELI++RT+++S+Y     G+L L+EE  L+ +I
Sbjct: 1    MNIYEDVLTATVVSHSITGHFTSTSQRELIIVRTNIISVYNTTDDGKLNLVEEFNLNAKI 60

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120
             D+ALIP+                  +GVAK+S++ ++ +T+S+ET+SLH+YEDK    +
Sbjct: 61   TDIALIPQE-------KSPLSCLVIASGVAKISIVRFDAVTNSLETLSLHYYEDKLSDIS 113

Query: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXXX 180
            ++ LA+ S+LR++P     +LFNND +A+LP ++G                         
Sbjct: 114  LVTLAKTSKLRVDPMNRALLLFNNDSIALLPLFSGNHEDEDEDDEEDDYDVTRGEVTTKR 173

Query: 181  XXXXXXXTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS 240
                    +N K    S I +  EL  +++N+ DIQFL  FTK T+ VLYQP+L W GN+
Sbjct: 174  SK------KNEKHVGQSKIFHVKELHQELQNVLDIQFLNDFTKPTLAVLYQPKLTWVGNT 227

Query: 241  QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF 300
            +L P PT++ I +L+++ +   T FD  II+ +  L  DW  + P   G +++G NE+A+
Sbjct: 228  ELNPQPTSFMIFTLNLRTNELETAFDVVIIATLHDLSWDWFQLLPISRGCVVMGNNEMAY 287

Query: 301  LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENER-SVENILL 359
            +DNTGVLQSI+ LNS++DK L + R+ID++  EVFFN    +    S + +    E +L+
Sbjct: 288  IDNTGVLQSIIHLNSFADKSLQRARIIDETELEVFFNEKVTYFWSASTDKKNIDDETLLI 347

Query: 360  FDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIG 419
             D +  ++ V L++EGRLLT+F++ KLP+  D L   SNP+ V+ +  +    +  +FIG
Sbjct: 348  IDASANLYYVRLEAEGRLLTKFDLIKLPIVNDALKDTSNPTCVARVDPNSSNSSMDLFIG 407

Query: 420  FQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXXXFNLYSDEENDQ 479
            + SGD+ +++LN+L SAIE  E    +   +KQ    Y+++         NLYSD+E+ +
Sbjct: 408  YLSGDSLVVRLNNLKSAIETRE----EHKESKQIFTGYDDDDDDED----NLYSDDESKE 459

Query: 480  VNNKNDRTFGTN----ESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQ 535
               K D     N    ++ +PF  ++L  LRNIGPI S+  GKV+S++ NVKGL NPN  
Sbjct: 460  ---KIDEELPDNKQLIQTVQPFDIEQLTSLRNIGPITSLVAGKVTSVDPNVKGLQNPNSN 516

Query: 536  EISIVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQ 595
            E S+V TSG G GSHL AI  SVQP VE ALKFIS+T+IW L +K KDK+L+TTDST+S+
Sbjct: 517  EYSMVATSGSGTGSHLTAIQPSVQPLVELALKFISVTQIWKLKMKNKDKYLVTTDSTKSK 576

Query: 596  SNIYEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFD 655
            S+IYEIDN F+ HK+GRLRRDATTIHI+  G+  RIVQVTTNHLYL+D  FRR + IKFD
Sbjct: 577  SDIYEIDNKFALHKEGRLRRDATTIHISMFGEGTRIVQVTTNHLYLFDTDFRRLTAIKFD 636

Query: 656  YEVVHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMC 715
            +EVVHVSVMDPY+LIT+ RGDIK++EL+   K+K  +V LPEIL EMV+TSG+ILKSNMC
Sbjct: 637  FEVVHVSVMDPYILITVLRGDIKIYELDALQKRKLFRVDLPEILKEMVVTSGVILKSNMC 696

Query: 716  NEFLSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDE 775
            NE+L G   S  EQLLFTFVTADNQIIFF ++HNDRIFQL G+DQL++ L+ISTYQLP+E
Sbjct: 697  NEYLHGHEDSEEEQLLFTFVTADNQIIFFLREHNDRIFQLCGVDQLKEGLFISTYQLPEE 756

Query: 776  IIPDPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGA 835
            ++PDPSIKQ+MINKLG+N+K+EYLTILTFGGEIYQYKKSR+RHS F++N G     ITGA
Sbjct: 757  VVPDPSIKQVMINKLGHNNKEEYLTILTFGGEIYQYKKSRTRHSCFFKNTGSTGMCITGA 816

Query: 836  PDNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMS 895
            PDNAY KGVS IERIMHYIP++ GYSVIF+TG+ PYIIM+EDDS P+IF F N+ IVS++
Sbjct: 817  PDNAYAKGVSSIERIMHYIPDYSGYSVIFLTGSVPYIIMREDDSSPKIFRFANLSIVSLA 876

Query: 896  RWGEGSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQL 955
            +WG+ SV+ +DDIKNAR+YSL+  + YYGN LP++KIKI   L+++ TL  I YHE++QL
Sbjct: 877  QWGKNSVMAVDDIKNARVYSLDNKDSYYGNSLPLKKIKISDSLEDFMTLTKITYHEKSQL 936

Query: 956  YLVSYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLV 1015
            +LVSY KE  YEA  EDG +++G   ++P+AK+F+SG+LLINP++W VID +D   NS++
Sbjct: 937  FLVSYAKEREYEALGEDGEIIVGSNDQVPHAKSFQSGILLINPRTWNVIDRVDFEVNSII 996

Query: 1016 NDMKSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKL 1075
            +DM+S  IQ+D+++++KREYI+ GI +   ED+P TG FHIYD+TEV+PEPGKP+TNFKL
Sbjct: 997  SDMRSMLIQLDSKSRKKREYIVAGITFIGTEDLPSTGAFHIYDLTEVIPEPGKPDTNFKL 1056

Query: 1076 KEIFKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFG 1135
            KEIFKEDIRG V+ V  ISGRFLI+QSQKIMVRDVQ+DNSV+PVAF D P+FV+  K+FG
Sbjct: 1057 KEIFKEDIRGSVNSVCDISGRFLINQSQKIMVRDVQEDNSVVPVAFYDTPIFVSDAKSFG 1116

Query: 1136 NLIVIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMH 1195
            N +++GD+MQG QF+GFDAEPYRMI LG S++ FE +SVEFL+N G+I F +TDR+ I+H
Sbjct: 1117 NFLILGDSMQGFQFLGFDAEPYRMIPLGRSVSSFETVSVEFLINAGEINFAITDREDILH 1176

Query: 1196 VLKYAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDG 1255
            VLKYAPD+PNTLSGQ+LVHCSSFNL+S N C ++LP+NDEF    +    FQ I  QVDG
Sbjct: 1177 VLKYAPDEPNTLSGQKLVHCSSFNLYSSNTCMLMLPRNDEFETSDKAPPKFQAIGGQVDG 1236

Query: 1256 SISKIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNII 1315
             I KI+P+KE+TYRRLY +QQQIIDKE QL GLNPRMER DN +Y L H +RPM+DFNII
Sbjct: 1237 GIFKIIPLKEDTYRRLYVVQQQIIDKEVQLGGLNPRMERLDNDFYQLTHVMRPMIDFNII 1296

Query: 1316 KRFKDMSMNRRSHIVQKLGKNSNLE 1340
            +RF ++S+ RR+H  QK G+ ++ +
Sbjct: 1297 RRFSELSIERRTHFAQKAGRRAHFD 1321

>AAL060W [127] [Homologous to ScYDR301W (CFT1) - SH]
            complement(241008..244925) [3918 bp, 1305 aa]
          Length = 1305

 Score = 1324 bits (3426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/1348 (49%), Positives = 917/1348 (68%), Gaps = 70/1348 (5%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MNV+D+VI+ TVV++SV GHFTTT   ELI+ RT++LS+      GRL L  E KLSGR+
Sbjct: 1    MNVFDEVINATVVNNSVTGHFTTTLREELIITRTNLLSVLHKDNEGRLVLAYEWKLSGRV 60

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120
            + ++L+P                   TG  ++S++ ++    ++ET SLH+Y+ KFE  +
Sbjct: 61   HGLSLVPHKSGLGRLAVL--------TGRGRVSIVRFDAENQTLETESLHYYDAKFEELS 112

Query: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXXX 180
             L +    +L  EP     ++ N D LA+LP                             
Sbjct: 113  ALTVGAAPRLEQEPAARCLLVHNGDCLAVLPL------------RGHEEEGEEAEEEEEH 160

Query: 181  XXXXXXXTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS 240
                     + ++   S ++  S L   IKN+KD++FL G  KS +GVLYQPQL+WCGN 
Sbjct: 161  PAKRARTDADGRLVGASTVMPASHLHSDIKNVKDMRFLRGLNKSAVGVLYQPQLSWCGNE 220

Query: 241  QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF 300
            +L      + I+SLD+            +I+ +  LP+  HTI P  +G ++ GVNE+ +
Sbjct: 221  KLTRQTMKFIILSLDLDDE------KSTVINMLQGLPNTLHTIIPLSNGCVLAGVNELLY 274

Query: 301  LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILLF 360
            +DNTG LQ  ++LN++S+  L   R+ D S  + FF          +  N R +  +LL 
Sbjct: 275  VDNTGALQGAISLNAFSNSGL-NTRIQDNSKLQAFFE--QPLCYFATQSNGRDI--LLLM 329

Query: 361  DENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGF 420
            DE   ++NV +++EGRLLT FN  +LP+  ++  +   P+S   I  +  L+T ++FIGF
Sbjct: 330  DEKARMYNVIIEAEGRLLTTFNCVQLPIVNEIFKRNMMPTS---ICGNMNLETGSLFIGF 386

Query: 421  QSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXXXFNLYSDEENDQV 480
            QSGDA  ++LN+L S++E       K  V++                   L +DE+  ++
Sbjct: 387  QSGDAMHVRLNNLKSSLE------HKGTVSE------------------TLETDEDYMEL 422

Query: 481  NNKNDRTFGTN-ESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEISI 539
               N      N E+  PF  + L  L NIGP+ S+ VGK SSIE  V  L NPNK E+SI
Sbjct: 423  YGNNAEKEKKNLETESPFDIECLDRLLNIGPVTSLAVGKASSIEHTVAKLANPNKDELSI 482

Query: 540  VCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNIY 599
            V TSG G GSHL  +  ++ P V++ALKFIS+T+IWNL IKGKDK+L+TTDS+Q++S+IY
Sbjct: 483  VATSGNGTGSHLTILENTIVPTVQQALKFISVTQIWNLKIKGKDKYLVTTDSSQTRSDIY 542

Query: 600  EIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVV 659
             ID +F   K    R++ TT+  A  G  KRIVQVT+  ++L+D+ F+R  T+ FD+EVV
Sbjct: 543  SIDRDFKPFKAADFRKNDTTVSTAVTGGGKRIVQVTSKGVHLFDINFKRMMTMNFDFEVV 602

Query: 660  HVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFL 719
            HV + DP++L+T S+GDIK++ELE ++KKKFVK  LP+ L E++IT G+IL+SNMCN+++
Sbjct: 603  HVCIKDPFLLLTNSKGDIKIYELEPKHKKKFVKTVLPDALKEIIITFGVILESNMCNKYI 662

Query: 720  SGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPD 779
            +G+ KS   QLLFTFVTADNQI+FFTKDHNDRIFQLNGID  +  L+ISTYQLP++I PD
Sbjct: 663  NGLEKSEEPQLLFTFVTADNQIVFFTKDHNDRIFQLNGIDDFRQKLFISTYQLPEDINPD 722

Query: 780  PSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHP--ITGAPD 837
            PSIKQ++I++LG+  K EYLTILTFGGE+Y Y+K      RF     + DH   ITGAP+
Sbjct: 723  PSIKQVIISRLGHKHKQEYLTILTFGGEVYLYRKCIDNPDRFI----KCDHELLITGAPE 778

Query: 838  NAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRW 897
            NAYPKGV G+ER+ HYI +++GYSVIF+TG  PYII+KED+S+PRIFPF NI +VSM+RW
Sbjct: 779  NAYPKGVQGVERVAHYIEDYNGYSVIFITGTVPYIIIKEDNSVPRIFPFANITLVSMTRW 838

Query: 898  GEGSVICIDDIKNARIYSLNQD-NIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLY 956
            GE SV+C+DD+KNARI +LN D + YYGNK+ + KI +   L++++TLN+I YHERTQ +
Sbjct: 839  GENSVMCVDDVKNARIMTLNLDRDRYYGNKMSLAKIYLEDPLEDFQTLNNITYHERTQTF 898

Query: 957  LVSYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVN 1016
            +VSY K I Y A +E+   L+GY P+  +A  F+SG++L++PKSWE+ID+++   NSL+N
Sbjct: 899  IVSYAKSIDYVALSEEDEPLVGYNPDKIHAMGFQSGIILLSPKSWEIIDKIEYGKNSLIN 958

Query: 1017 DMKSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLK 1076
            DM++  IQ+++ TKR+REY++VG  Y   ED+  TG F++YDITEVVPEPGKP+TN+K K
Sbjct: 959  DMRTMMIQLNSNTKRRREYLVVGNTYVRDEDIGGTGSFYLYDITEVVPEPGKPDTNYKFK 1018

Query: 1077 EIFKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGN 1136
            +IF+EDIRG VS V  ISGRF+ISQS K MVRD+Q+DNSV+PVAFLD+PVF+T  K+FGN
Sbjct: 1019 DIFQEDIRGTVSTVCEISGRFMISQSSKAMVRDIQEDNSVVPVAFLDMPVFITDAKSFGN 1078

Query: 1137 LIVIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHV 1196
            L++IGD+MQG  F+GFDAEPYRM+TLG S++K E + VEFLVNNGD+YFLVTDR+++MHV
Sbjct: 1079 LMIIGDSMQGFSFLGFDAEPYRMLTLGKSVSKLETMCVEFLVNNGDVYFLVTDRNNLMHV 1138

Query: 1197 LKYAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQR----YSRSFQTITAQ 1252
            LKYAPD+PN+LSGQRLVHC+SFNLHS N C  L+ KNDEF +  R    Y  SFQ I +Q
Sbjct: 1139 LKYAPDEPNSLSGQRLVHCTSFNLHSTNTCMRLIKKNDEFGKVSRGFGIYMPSFQCIGSQ 1198

Query: 1253 VDGSISKIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDF 1312
             DG+I K+VP+ E +YR LY IQQQ+IDKE QL GLNPRMER +N +Y +GH LRPMLDF
Sbjct: 1199 ADGTIFKVVPLSEASYRSLYLIQQQLIDKEVQLCGLNPRMERLENPFYQMGHILRPMLDF 1258

Query: 1313 NIIKRFKDMSMNRRSHIVQKLGKNSNLE 1340
             ++KRF  +S+  R  +  K G+ ++ E
Sbjct: 1259 TVLKRFATLSIPTRMTMASKAGRQAHAE 1286

>Kwal_47.18192
          Length = 1307

 Score = 1300 bits (3365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1342 (49%), Positives = 910/1342 (67%), Gaps = 53/1342 (3%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MNVYD++ D T VSH++ GHFT+  Y +LI  RT+VLS+YK     +L L+ E+KL GRI
Sbjct: 1    MNVYDEIFDATTVSHALLGHFTSEKYDQLIAARTNVLSVYKTDHE-KLVLLHEYKLHGRI 59

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYN-NMTSSIETISLHFYEDKFESA 119
              + L+P+                  TG AKLSL+ ++ NM   +ETISLH+YE +F   
Sbjct: 60   TGMVLVPQ-------LRSPLDCLMISTGKAKLSLVRFDPNMPIWLETISLHYYEAQFSEK 112

Query: 120  TMLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXX 179
            ++L+LA +S+LRI+P      LFN D+LAILP  TG                        
Sbjct: 113  SILELAESSKLRIDPEKRCVFLFNTDMLAILPL-TGHEDEDDDNQDHSHQAKKQKVGNDA 171

Query: 180  XXXXXXXXTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGN 239
                      +  +T  S+++  SEL   IKN+ DIQFL  F   T+ +LYQP+LAW GN
Sbjct: 172  ----------SRSLTGQSLVMRVSELHEDIKNVVDIQFLNSFNNPTLAILYQPRLAWTGN 221

Query: 240  SQLVP-LPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEI 298
             ++V   P  +  ++L    S          I  +  +P D H+I P  +  +++GVNEI
Sbjct: 222  EKVVSKTPMKFMALTLQDNKS--------TTIYHMKGIPHDVHSIIPLTNSCVLVGVNEI 273

Query: 299  AFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENIL 358
              +DNTG LQS + LNS++ K LP  + IDKSS +V FN    +    S    +  E ++
Sbjct: 274  MSVDNTGALQSTIQLNSFASK-LPGSKQIDKSSLQVMFNEPVVWT---SAMVSKDKEILI 329

Query: 359  LFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFI 418
            + D    +++V  +SEGRLL  F + KLP+  D+      P+ +  +    ++     FI
Sbjct: 330  IMDHRADLYSVISQSEGRLLLDFTLVKLPIASDIFKAHYLPTCILPLSGGIQMKMCQFFI 389

Query: 419  GFQSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXXXFNLYSDEEND 478
            GF SG+A M+K N+L SA E  E          QA    ++E          LY D+  D
Sbjct: 390  GFSSGNALMVKFNNLRSAFESNE---------IQAIELPHDEDEDYDA----LYGDD--D 434

Query: 479  QVNNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEIS 538
             +         T E++ PF+   +  L N+GPI S+ VGKVSS   N++GLPNPN+ EI+
Sbjct: 435  DLARPAVENMTTVEASIPFSIDLMDFLINVGPITSLAVGKVSSANPNIEGLPNPNRNEIA 494

Query: 539  IVCTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNI 598
            +V +SG+G G+++N +  SV P V++ALKF S+TKIW L I+ KDK+LITTDS   +S++
Sbjct: 495  LVSSSGHGIGAYINVMEPSVPPLVQQALKFTSVTKIWALKIRKKDKYLITTDSGAEKSDV 554

Query: 599  YEIDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEV 658
            +EI    +  K    +++ +T+ IA +G  KRIVQVTT  +YL++L F++  TI FD+EV
Sbjct: 555  FEIGQKITSIKPKHFKKNVSTVEIAKVGGGKRIVQVTTKAVYLFNLGFKKLMTISFDFEV 614

Query: 659  VHVSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEF 718
            VHVS+ DP++L+T S+G+IK++ELE +++ K  KVPLPE+L EM+ITSG+ILKS++CN++
Sbjct: 615  VHVSIFDPFILLTNSKGEIKIYELEPKHRNKLNKVPLPEVLEEMIITSGVILKSSICNQY 674

Query: 719  LSGIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIP 778
            +SG+     +QLLFTFV ADNQII F K+H+DR+FQLNG+D L D L++STYQLP++IIP
Sbjct: 675  MSGLEDPDKDQLLFTFVAADNQIILFPKEHHDRVFQLNGVDILNDMLFVSTYQLPEQIIP 734

Query: 779  DPSIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDN 838
            DPSIKQ+MIN LG N+K+EYLT+LTFGGEIY YKK     ++F++++  N+  ITGAP N
Sbjct: 735  DPSIKQVMINNLGKNNKEEYLTVLTFGGEIYMYKKI---GNKFFKSMRCNEFQITGAPGN 791

Query: 839  AYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWG 898
            AY KGVS IERI HY+  F+GYS+I VTG+ PY+I+KED S P+IF FGNIP+VS++ WG
Sbjct: 792  AYAKGVSSIERIAHYVKYFNGYSIILVTGSVPYMIIKEDFSTPKIFKFGNIPLVSLTPWG 851

Query: 899  EGSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLV 958
              SV+C+DDIKNARI +LN +   YGN+LP+R+IKIG     ++++  + +HERT +Y+ 
Sbjct: 852  ADSVLCVDDIKNARIVTLNNE-FSYGNRLPVRRIKIGDATNEFQSITGVAFHERTGMYIA 910

Query: 959  SYTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDM 1018
            SYTKEI YEA +E+G  LIG    +P+AK ++SG++L+NPK+W +ID  D   NSL+NDM
Sbjct: 911  SYTKEIEYEAISEEGEKLIGCDDSVPHAKGYQSGIILLNPKTWNIIDLADYGKNSLINDM 970

Query: 1019 KSSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEI 1078
            K+  IQ ++R KRKREY++VG  +   ED+   G F++YDITEVVPEPGKP+TN+KLK+I
Sbjct: 971  KTMLIQTNSRMKRKREYLVVGNTFVRDEDIGTMGSFYLYDITEVVPEPGKPDTNYKLKQI 1030

Query: 1079 FKEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLI 1138
            F E+ RG VS V  +SGRFLISQSQK++VRDVQ+DNSV+PVAFLD+PVFVT  K+ GNL+
Sbjct: 1031 FHEEFRGAVSSVCEVSGRFLISQSQKVLVRDVQEDNSVVPVAFLDIPVFVTDSKSCGNLL 1090

Query: 1139 VIGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLK 1198
            +IGDAMQG QFVGFDAEPYRMI LG S++KFEV+S+EFL+NNG+IYFLV+DR +I+HVLK
Sbjct: 1091 IIGDAMQGFQFVGFDAEPYRMIPLGRSVSKFEVMSLEFLMNNGNIYFLVSDRSNILHVLK 1150

Query: 1199 YAPDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSIS 1258
            YAPD+PN+LSGQ+LVHC+SFNLHS N C  LL KN EF        +FQ I AQ DGSI 
Sbjct: 1151 YAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNSEFKAANDLP-AFQAIGAQTDGSIF 1209

Query: 1259 KIVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRF 1318
            K+VP+ E TYRRLY ++QQ+I+K+ QL GLNP+MER  N +Y LGHSLRPMLDF +IK +
Sbjct: 1210 KVVPLSENTYRRLYMVEQQLIEKDIQLCGLNPKMERLQNDFYQLGHSLRPMLDFTVIKNY 1269

Query: 1319 KDMSMNRRSHIVQKLGKNSNLE 1340
              ++ N+R  +  K G+ ++ E
Sbjct: 1270 GALASNKRKQVAAKAGRQADHE 1291

>KLLA0C10274g complement(879403..883305) similar to sgd|S0002709
            Saccharomyces cerevisiae YDR301w CFT1 pre-mRNA 3 -end
            processing factor CF II, start by similarity
          Length = 1300

 Score = 1214 bits (3140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1341 (45%), Positives = 900/1341 (67%), Gaps = 61/1341 (4%)

Query: 1    MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIRSGRLYLMEEHKLSGRI 60
            MNV+D+++ PTVV+  + G+FT+ +  E +V RT+VLS+++  R+ +L L  E KL+G+I
Sbjct: 1    MNVFDEILQPTVVNKCLHGNFTSAEREEYVVARTNVLSVFRVSRAQKLVLAYEWKLAGKI 60

Query: 61   NDVALIPKHXXXXXXXXXXXXXXXXXTGVAKLSLLMYNNMTSSIETISLHFYEDKFESAT 120
             D+ L+P+                  +  +K+SL+ ++ +  S+ET+SLH+Y DKF + +
Sbjct: 61   IDMQLLPQ-------IGSPLKMLAILSSKSKVSLVRFDPVAESLETLSLHYYHDKFVNLS 113

Query: 121  MLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGXXXXXXXXXXXXXXXXXXXXXXXXX 180
               L   S + ++P     ++FN DVLAILP                             
Sbjct: 114  TSSLKTESIMAVDPLFRCLLVFNEDVLAILPL-----------KLNTEDMEIDEDENGIK 162

Query: 181  XXXXXXXTQNNKVTHPSIIINCSELGPQIKNIKDIQFLCGFTKSTIGVLYQPQLAWCGNS 240
                    +N  +T  SII+  S L   +K++ DI++L  F+K T+G+LYQP LAWCGN 
Sbjct: 163  EPMAKRLKRNQGITSDSIIMPISSLHKSLKHVYDIKWLNNFSKPTVGILYQPVLAWCGNE 222

Query: 241  QLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQLPSDWHTIAPTLSGSLILGVNEIAF 300
            +++     Y ++SLD++   D  T    +I+E++ LP+D HT+ P   G +++GVNE+ +
Sbjct: 223  KVLGNTMRYMVLSLDVE---DEKT---TVIAELADLPNDLHTLVPLKRGYVLIGVNELLY 276

Query: 301  LDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEVFFNTGSKFALIPSNENERSVENILLF 360
            +  +G LQS + LN+++   +   R+ D S   +F +  S +       ++     ++L 
Sbjct: 277  ISASGALQSCIRLNTFATSSI-NTRITDNSDMNIFLSKSSIYFYKALKRHDL----LILI 331

Query: 361  DENGCIFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGF 420
            DEN  ++N+  +SEG LLT+F+  ++P+  ++      P SV     D  L+T  + IGF
Sbjct: 332  DENCRMYNIITESEGNLLTKFDCVQVPIVNEIFKNSRLPLSVC---GDLNLETGRVLIGF 388

Query: 421  QSGDATMLKLNHLHSAIEVEEPTFMKDYVNKQASAAYNNEXXXXXXXXFNLYSDEENDQV 480
             SGDA  L+L +L  A                   A   +         + YS    +  
Sbjct: 389  LSGDAMFLQLKNLKVAF------------------AAKRQLVETVDDDDDEYSALYGESQ 430

Query: 481  NNKNDRTFGTNESNEPFTAQELMELRNIGPINSMCVGKVSSIEDNVKGLPNPNKQEISIV 540
            NN + R     E+ EPF    L  + NIGP+ S+ +GKV+S+E  ++ LPNPNK E SIV
Sbjct: 431  NNTHTRIV---ETQEPFDISLLDSIFNIGPLTSLTIGKVASVEPTIQRLPNPNKDEFSIV 487

Query: 541  CTSGYGDGSHLNAILASVQPRVEKALKFISITKIWNLHIKGKDKFLITTDSTQSQSNIYE 600
             TSG G GSHL A+ ++VQP +E+ALKF S T+IWNL IKGKDK+L+TTD+ + +S++Y+
Sbjct: 488  ATSGVGRGSHLTALHSTVQPHIEQALKFTSATRIWNLKIKGKDKYLVTTDADKEKSDVYQ 547

Query: 601  IDNNFSQHKQGRLRRDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVVH 660
            ID NF   +    R+D+ TI + T+ D+KRI+QVT+  LYL+D+ F+R + +  D E+VH
Sbjct: 548  IDRNFEPFRAQDFRKDSRTIGMETMDDDKRILQVTSGGLYLFDVDFKRLARLTIDIEIVH 607

Query: 661  VSVMDPYVLITLSRGDIKVFELENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFLS 720
              ++DPY+L T +RG+IK+++L+++NKKKF+K  LPE L E++ITSG I KSN+CN+FL 
Sbjct: 608  ACIIDPYILFTDARGNIKIYQLDSKNKKKFIKFKLPEALNEIIITSGSIFKSNICNKFLH 667

Query: 721  GIGKSTIEQLLFTFVTADNQIIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPDP 780
            G+  S+ EQLLFTFVT DNQ+IFFT+ HNDRIFQLNG+DQL+D L+ISTYQ+P+E+ PDP
Sbjct: 668  GLENSSQEQLLFTFVTGDNQVIFFTEKHNDRIFQLNGVDQLEDMLFISTYQIPEEMNPDP 727

Query: 781  SIKQIMINKLGNNSKDEYLTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHP-ITGAPDNA 839
            SIKQIM+N+LG++ K+E+LTILTFGGEIYQYKKS     +  +      HP ITGAP+NA
Sbjct: 728  SIKQIMLNRLGHHKKEEFLTILTFGGEIYQYKKSTKHSGKLLKC---KSHPLITGAPNNA 784

Query: 840  YPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWGE 899
            YP+GV+ IER+ HY PN++GYSV+F+TG  PYII+KED+S+ RIF   NIPIV+M+RWG+
Sbjct: 785  YPQGVNKIERVAHYFPNYNGYSVVFITGQVPYIIIKEDNSVCRIFRMTNIPIVTMARWGK 844

Query: 900  GSVICIDDIKNARIYSLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLVS 959
             SV+C+D+IKNAR+  L+ +  YYGN   +RKI I  +++ ++TL +I YHERT +Y++S
Sbjct: 845  NSVMCVDNIKNARVMKLDPE-CYYGNTQILRKIIIEDVVEEFETLGNIAYHERTGMYIIS 903

Query: 960  YTKEISYEAKAEDGSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDMK 1019
            YTK I Y+A +EDG  L+GY P  PN+  +KSG+LLINP +W +ID LDL +NS+VND+K
Sbjct: 904  YTKFIEYQALSEDGEPLVGYDPSKPNSTGYKSGLLLINPLTWNIIDRLDLSENSMVNDIK 963

Query: 1020 SSFIQIDTRTKRKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEIF 1079
            +  IQ++++T+RKRE +I+G  +   ED P TG   + DITEVV EPGKP++NFK K++F
Sbjct: 964  TMLIQLNSKTRRKRELVIIGSSFVKEEDQPSTGCLLVLDITEVVAEPGKPDSNFKFKQLF 1023

Query: 1080 KEDIRGIVSVVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIV 1139
            +E+IRG V+ V  ISGRF+I QS K +VRD+Q+DNS +PVAFLD+PVF+T  K+F NL++
Sbjct: 1024 EEEIRGSVNAVCEISGRFMIGQSSKALVRDMQEDNSAVPVAFLDMPVFITDAKSFSNLMI 1083

Query: 1140 IGDAMQGIQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKY 1199
            IGD+MQG  FVGFDAEPYRMI LG S +KF+V+++EFLVNNG+I F+VTDR + +HVL+Y
Sbjct: 1084 IGDSMQGFTFVGFDAEPYRMIVLGKSTSKFQVMNLEFLVNNGNINFIVTDRQNHLHVLRY 1143

Query: 1200 APDQPNTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISK 1259
            APD+ N+LSGQRLVHC+SFN+ + NN   L+ K+ EF      + ++  +  Q DGSI +
Sbjct: 1144 APDEANSLSGQRLVHCNSFNMFTTNNYMKLVRKHVEFGSK---TSNYIALGCQTDGSIFR 1200

Query: 1260 IVPVKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFK 1319
            ++P+ E +YRR Y +QQQ++D E  LAG N +MER DN+YYH GHSLRP LD  ++K++ 
Sbjct: 1201 MIPLNEASYRRFYLVQQQLLDHEIPLAGFNTKMERLDNEYYHKGHSLRPTLDSQVLKKYI 1260

Query: 1320 DMSMNRRSHIVQKLGKNSNLE 1340
             + + +R+ I  ++G++++ E
Sbjct: 1261 HLPITKRTTIENRVGRHASTE 1281

>CAGL0L01507g 165212..169102 similar to sp|Q04693 Saccharomyces
            cerevisiae YML049c RSE1 involved in RNA splicing and ER
            to Golgi transport, hypothetical start
          Length = 1296

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 88/210 (41%), Gaps = 40/210 (19%)

Query: 824  NVGRNDHPITGAPDNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNTPYIIMKEDDSLPRI 883
            N+ RN  P+     +  P+GVS I  I     ++  +  + +   T  I+   DDS+ + 
Sbjct: 430  NIIRNAIPLKEYVSSPLPQGVSNIFTIKTQYQSYHSFIFLTMINFTTVILKIADDSIEQY 489

Query: 884  FPFGNI------PIVSMSRWGEGSVI--CIDDIKNARIYSLNQDNIYYGNKL-PIRKIKI 934
             P  +         + ++  G+ S+I  C D+ +   + S +++N     K  P   + I
Sbjct: 490  IPASDTFKLKDDMTIHVATMGDNSIIQVCKDEFRQILLDSKDEENFKMNLKWYPPAGVSI 549

Query: 935  GSMLQNYKTLNSIVYHERTQLYLVSYTKEISYEAKAEDGSLLIGYK--PELP-------- 984
             S + N+           +QL L     EI Y  + E+ + LI YK  PELP        
Sbjct: 550  LSAVSNF-----------SQLILALSNNEIVY-LQLENNT-LIEYKNRPELPDVITSLAL 596

Query: 985  -NAKAFKSGVL-------LINPKSWEVIDE 1006
             N    KS +L       ++N  S E++DE
Sbjct: 597  LNDNTKKSEILAVGTSDNMVNVLSLEIVDE 626

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query: 615 RDATTIHIATIGDNKRIVQVTTNHLYLYDLTFRRFSTIKFD---YEVVHVSVMDPY---- 667
           +D  TIH+AT+GDN  I+QV  +      L  +     K +   Y    VS++       
Sbjct: 499 KDDMTIHVATMGDNS-IIQVCKDEFRQILLDSKDEENFKMNLKWYPPAGVSILSAVSNFS 557

Query: 668 -VLITLSRGDIKVFELENRNKKKFVKVP-LPEILTEMVI 704
            +++ LS  +I   +LEN    ++   P LP+++T + +
Sbjct: 558 QLILALSNNEIVYLQLENNTLIEYKNRPELPDVITSLAL 596

>CAGL0M11044g 1090429..1091568 weakly similar to sp|P24869
           Saccharomyces cerevisiae YPR119w CLB2 cyclin,
           G2/M-specific, hypothetical start
          Length = 379

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 252 ISLDMKFSIDATTFDKAIISEISQLP---------SDWHTIAPTLSGSLILGVNEIAFLD 302
           I+L++ F++D+      ++ +    P         +D  TI   L  SL    N +  +D
Sbjct: 15  INLNINFTMDSKIIKNYLLPKAIYKPGNKIGATIFNDNRTINNKLPLSLEKNANSLNIMD 74

Query: 303 NTGVLQSILTLNSYSDKVLPKVRVIDK 329
           NT VL+S+L  N   +K LP   +IDK
Sbjct: 75  NTNVLKSVLK-NYKCNKSLPYSSLIDK 100

>YNL253W (TEX1) [4354] chr14 (170017..171285) Component of the
           TRanscription-EXport (TREX) complex, which is involved
           in linking transcription to mRNA export, and may load
           mRNA export machinery onto both intron-lacking, and
           intron-containing pre-mRNA [1269 bp, 422 aa]
          Length = 422

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 366 IFNVDLKSEGRLLTQFNITKLPLGEDVLSQKSNPSSVSIIWADGRLDTYTIFIGFQSGDA 425
           I+  D+K +   +   NI+ +       SQ+ N    S+ W++G      IFIGF+SG  
Sbjct: 184 IYLFDVKKDHSSVCSLNISDI-------SQEDNDVVYSLAWSNGGSH---IFIGFKSGYL 233

Query: 426 TMLKLNH 432
            +LK  H
Sbjct: 234 AILKAKH 240

>CAGL0J00583g 50462..52915 similar to sp|P18962 Saccharomyces
           cerevisiae YHR028c DAP2 dipeptidyl aminopeptidase,
           hypothetical start
          Length = 817

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 12/81 (14%)

Query: 828 NDHPITGAPDNAYPKGVSGIERIMHYIPNFDGYSVIFVTGNT-------PYIIMKEDDSL 880
           N++   G PD  Y + V   +R + + PN D Y     T  T       PY   KEDD  
Sbjct: 225 NENVFNGIPDWVYEEEVFSNDRALWWSPNGD-YLAFLKTDETNVGEFSIPYYAQKEDDVY 283

Query: 881 PRI----FPFGNIPIVSMSRW 897
           P +    +P    P   +  W
Sbjct: 284 PEVKTIKYPKSGTPNPVVDLW 304

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 44,408,371
Number of extensions: 2039538
Number of successful extensions: 5456
Number of sequences better than 10.0: 19
Number of HSP's gapped: 5579
Number of HSP's successfully gapped: 24
Length of query: 1340
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1226
Effective length of database: 12,649,657
Effective search space: 15508479482
Effective search space used: 15508479482
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)