Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0H01441g42742020570.0
YDR300C (PRO1)42841515290.0
Scas_588.1442341315150.0
KLLA0C10296g41841214110.0
Kwal_47.1818742141713890.0
AAL061C42041213320.0
YHR033W42341512431e-170
CAGL0D03894g48546512361e-168
Scas_690.3642442011481e-156
YER052C (HOM3)52740790.12
KLLA0F27599g52248780.13
Scas_715.4452840770.17
CAGL0J02882g53040750.29
Sklu_2260.352340740.46
Kwal_47.1816352240740.47
YGR184C (UBR1)195044720.79
ADR106W79837711.0
CAGL0H09350g196547701.5
YBR275C (RIF1)191665664.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0H01441g
         (420 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   796   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   593   0.0  
Scas_588.14                                                           588   0.0  
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   548   0.0  
Kwal_47.18187                                                         539   0.0  
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   517   0.0  
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   483   e-170
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   480   e-168
Scas_690.36                                                           446   e-156
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    35   0.12 
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...    35   0.13 
Scas_715.44                                                            34   0.17 
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    33   0.29 
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement         33   0.46 
Kwal_47.18163                                                          33   0.47 
YGR184C (UBR1) [2135] chr7 complement(859904..865756) Ubiquitin-...    32   0.79 
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    32   1.0  
CAGL0H09350g complement(912452..918349) similar to sp|P19812 Sac...    32   1.5  
YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein inv...    30   4.6  

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/420 (93%), Positives = 392/420 (93%)

Query: 1   MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXX 60
           MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHN         
Sbjct: 1   MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSI 60

Query: 61  XXXLHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQ 120
              LHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQ
Sbjct: 61  GVGLHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQ 120

Query: 121 YRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDC 180
           YRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDC
Sbjct: 121 YRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDC 180

Query: 181 LYTADPRSDPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHT 240
           LYTADPRSDPDAKPILIVPDLSKGLP                MQTKLVAAELATNAGVHT
Sbjct: 181 LYTADPRSDPDAKPILIVPDLSKGLPGVDTSSGSGSDVGTGGMQTKLVAAELATNAGVHT 240

Query: 241 IIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLAN 300
           IIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLAN
Sbjct: 241 IIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLAN 300

Query: 301 SISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVD 360
           SISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVD
Sbjct: 301 SISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVD 360

Query: 361 LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE
Sbjct: 361 LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/415 (68%), Positives = 338/415 (81%), Gaps = 4/415 (0%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K +TIVIKLG+SSLVDEKTKEP+LAIMSLIVETVVKLRR+GH             L  + 
Sbjct: 8   KSYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMR 67

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           M KRPKHL+EVQAIAAIGQ +LIGRWD LF+ F Q IAQILLTRNDILDW+QY+NAQNT+
Sbjct: 68  MNKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTI 127

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELL MGV+PI+NENDTLSV+EIKFGDNDTLSAIT+ LIHADYLFLLTDVDCLYT +PR+
Sbjct: 128 NELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRT 187

Query: 189 DPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAP 248
           +PDA PIL+VPDLSKGLP                M+TKLVAA+LATNAGVHT+IMKSD P
Sbjct: 188 NPDAMPILVVPDLSKGLPGVNTAGGSGSDVGTGGMETKLVAADLATNAGVHTLIMKSDTP 247

Query: 249 SNIYKIVKYIQSLHDTGEDNKV---FEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRH 305
           +NI +IV+Y+Q+L +  ++NKV   + GDL  LQ  E+EKL  + VP HTKF+AN    H
Sbjct: 248 ANIGRIVEYMQTL-ELDDENKVKQAYNGDLTDLQKREFEKLKALNVPLHTKFIANDNKHH 306

Query: 306 LRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGK 365
           L+N+EFWILHGLV+ GAV+ID+GAY ALTRKNKAGLLP GVI+++G+FHE+ECVD+KVGK
Sbjct: 307 LKNREFWILHGLVSKGAVVIDQGAYAALTRKNKAGLLPAGVIDVQGTFHELECVDIKVGK 366

Query: 366 RLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           +LP+G LDPD+PL  VG+ARCNY S E++KIKG  SD+IE ELGY +SEY+AHRE
Sbjct: 367 KLPDGTLDPDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRE 421

>Scas_588.14
          Length = 423

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/413 (68%), Positives = 336/413 (81%), Gaps = 2/413 (0%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K +T+VIKLG+SSLVDEKTKEP+LAIMSL+VETVVKLRRLGH             L  L 
Sbjct: 5   KCYTLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLN 64

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           ++KRPKHL+EVQAIAA+GQ +LIGRWD LF+ FGQ IAQIL+TRNDI+DW+QY+NAQNT+
Sbjct: 65  LDKRPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTI 124

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELLKMGVVPI+NENDTLS+ EIKFGDNDTLSAIT+ L+ ADYLFLLTDVDCLYT +PR+
Sbjct: 125 NELLKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRT 184

Query: 189 DPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAP 248
           +P+AKPIL+VPDL+KGLP                M+TKL+AA+LATNAGVHTIIMKSD P
Sbjct: 185 NPEAKPILVVPDLAKGLPGVNTSSGSGSDVGTGGMETKLIAADLATNAGVHTIIMKSDIP 244

Query: 249 SNIYKIVKYIQSLH-DTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRHLR 307
            NI KIV+Y+Q+   DT +  K ++GDL  LQ +E   L  + VP HT F+AN    HL+
Sbjct: 245 GNILKIVEYMQAQDLDTNKKQK-YQGDLSSLQDKELATLQSLHVPLHTTFIANDNLHHLK 303

Query: 308 NKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRL 367
           N+EFWILHGLVT G+VIID+GAY ALTRKNKAGLLPVG+I+IEG+FHE+ECVDLK+GKRL
Sbjct: 304 NREFWILHGLVTRGSVIIDQGAYNALTRKNKAGLLPVGIIDIEGTFHELECVDLKLGKRL 363

Query: 368 PNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           PNGELDP+ PL  VGRARCNY SLE+S+IKG QS++IE ELGY +SEY AHRE
Sbjct: 364 PNGELDPNTPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRE 416

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/412 (65%), Positives = 316/412 (76%), Gaps = 3/412 (0%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K F IVIKLG+SSLVDE+TKEP+L+IMSLIVETVVKLRR GH             L  + 
Sbjct: 3   KQFVIVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKTMN 62

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           M+ RPK LS+VQAIAA+GQ +LIGRWDSLF+ F Q IAQIL+TRNDI+DW+QY+NAQNT+
Sbjct: 63  MKGRPKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQNTI 122

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELL MGVVPI+NENDTLSV EIKFGDNDTLSAITA L  ADYLFLLTDVDCLYT +PR+
Sbjct: 123 SELLSMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRA 182

Query: 189 DPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAP 248
           +PDAKPIL+VPD+S+GLP                M+TKL+AAELATNAGVHTIIMKSD P
Sbjct: 183 NPDAKPILVVPDISQGLPGVNTDGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSDTP 242

Query: 249 SNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRHLRN 308
            NI KIV Y+Q   D   +      DL  LQL E + L    VP HT+F+ANS   HL+N
Sbjct: 243 ENISKIVLYMQERDDGVNE---LTQDLADLQLTEMQSLVNNHVPLHTRFIANSNHHHLKN 299

Query: 309 KEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRLP 368
           ++FW+LHGLV+ GAVIID GAY+ALTRKNKAGLLP GVIE++GSFHE EC+D+K+G R  
Sbjct: 300 RQFWMLHGLVSQGAVIIDIGAYEALTRKNKAGLLPAGVIEVQGSFHEHECIDIKLGVRDS 359

Query: 369 NGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           +G LD    L  VGRARCNY S E+SKIKG QSD+IE+ LGY +SEY+AHRE
Sbjct: 360 DGNLDKSVALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRE 411

>Kwal_47.18187
          Length = 421

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 318/417 (76%), Gaps = 12/417 (2%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K +TIVIKLG+SSLVDEKTKEP+LA M+++VETVV+LRR+GH             L  L 
Sbjct: 3   KTYTIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLN 62

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           ++KRPKHL++VQAIAA+GQ +LIGRWD+LF+ F Q IAQIL+TRNDI+DW+QY+NAQNT+
Sbjct: 63  LDKRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTI 122

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELL+MGVVPI+NENDTLSV EIKFGDNDTLSAITA L  ADYLFLLTDVDCLYT +PR+
Sbjct: 123 HELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRT 182

Query: 189 DPDAKPILIVP---DLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKS 245
           +P+AKPIL+VP    +S+G                  M TKL+AAELATNAGV+TIIMKS
Sbjct: 183 NPNAKPILVVPATSQMSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIMKS 242

Query: 246 DAPSNIYKIVKYIQ---SLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSI 302
             PSNI K+V Y+Q   S+     DN      +  LQ +E  +L    VP HT+F+A+  
Sbjct: 243 AEPSNISKVVSYMQNCESITGAAADN------VEHLQEQEMLRLQENCVPLHTRFVADES 296

Query: 303 SRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLK 362
             HL N+EFW+LHGLV+ GA++ID+GAY ALTRKNKAGLLP G+IE+EG+FHE EC+DLK
Sbjct: 297 QMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRKNKAGLLPAGLIEVEGNFHEHECIDLK 356

Query: 363 VGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHR 419
           VG RL  GELDP  P+T +GRARCNY S+E+ KIKG QSD+IEN LGY +SEY+AHR
Sbjct: 357 VGSRLATGELDPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHR 413

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/412 (61%), Positives = 305/412 (74%), Gaps = 4/412 (0%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           + FTIV+KLG+SSLVDE T EP+L+IMS IVETVVKLRR+GH             L  +G
Sbjct: 6   RKFTIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVG 65

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
            ++RPK LS++QAIAA+GQ +LI RWDSLF  F + IAQILLTRNDI+DWSQY+NAQNT 
Sbjct: 66  TDRRPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTF 125

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELL MGV PI+NENDTLS+  +KFGDNDTLSAITAGLI ADYLFL+TDVDCLYT +PR+
Sbjct: 126 HELLAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRT 185

Query: 189 DPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAP 248
           +PDAKPIL+VPDLS+GLP                M TK++AA+LATNAGVHTIIMKS+ P
Sbjct: 186 NPDAKPILVVPDLSQGLPGVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSERP 245

Query: 249 SNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSISRHLRN 308
            ++ +IV++++      E       D   LQ +E   L   GVP HT+F+AN     L  
Sbjct: 246 VDMVRIVEFME----WREQCTAVSADAETLQTDELNLLQEHGVPLHTRFIANVWQPSLNK 301

Query: 309 KEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRLP 368
           +EFWILHGLV+ G VIID+GAYKALTRKNKAGLLP GVI +EGSFHE+E VDLK+G R  
Sbjct: 302 REFWILHGLVSCGTVIIDKGAYKALTRKNKAGLLPAGVIAVEGSFHELEAVDLKIGVRKA 361

Query: 369 NGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           +G LD   PL  VGRARCNY S+E+ KIKG QS +IE  LGY +SEYIAHRE
Sbjct: 362 DGSLDESEPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRE 413

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  483 bits (1243), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 239/415 (57%), Positives = 299/415 (72%), Gaps = 5/415 (1%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K +TIVIKLG+SSLVDE TKEP+L+IM+LIVETV  L+R+GH             L  L 
Sbjct: 3   KAYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALN 62

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           +  +PK LSEVQAIAA+GQ +LI RW+ LF+ +G+  AQILLTRNDIL W+QY NA+NT+
Sbjct: 63  IPHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTI 122

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
            ELL MGV+PI+NENDTLS+ EI+FGDNDTLSAITA L+ AD+LFLLTDVDCLYT +PR+
Sbjct: 123 NELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRT 182

Query: 189 DPDAKPILIVPDLSKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAP 248
           +PDA+PI++VP+LS+GLP                M+TKL+AA+LA+NAG+ TI+MKSD P
Sbjct: 183 NPDARPIVLVPELSEGLPGVNTSSGSGSEVGTGGMRTKLIAADLASNAGIETIVMKSDRP 242

Query: 249 SNIYKIVKYIQSLHDTGEDNKVFEG---DLMKLQLEEYEKLDRMGVPFHTKFLANSISRH 305
             + KIV YIQ  H       +  G     + LQ  E E+L R  VP HTKFLAN     
Sbjct: 243 EYVPKIVDYIQ--HHFRPPRHIGNGTQQQFLDLQDTELEQLRRYDVPMHTKFLANDNKHK 300

Query: 306 LRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGVIEIEGSFHEMECVDLKVGK 365
           L+N+EFWILHGL+T GA+IIDE +Y  L  K+ A L P  VIE+  +FHE+ECVDLK+G+
Sbjct: 301 LKNREFWILHGLITKGAIIIDENSYDKLLSKDMASLTPNAVIEVRDNFHELECVDLKIGQ 360

Query: 366 RLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           RLPNGELD   P+  VG  R NY SLE++KIKG  S++I + LGY  SEY+AHRE
Sbjct: 361 RLPNGELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHRE 415

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  480 bits (1236), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 245/465 (52%), Positives = 316/465 (67%), Gaps = 56/465 (12%)

Query: 12  TIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILGMEK 71
           TIVIKLGTSSLVDEKT+EP+L+IM+ +VETV++L+R GH             L+ + M+K
Sbjct: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAMEMDK 63

Query: 72  RPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTVEEL 131
           +P  L+E+QAIAAIGQ +LIGRW  LF  +G+ IAQIL+TRNDIL W+QY+NAQNT+ +L
Sbjct: 64  KPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123

Query: 132 LKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPD 191
           L+MGVVPI+NENDTLS+ EIKFGDNDTLSAITA L+ AD+LFLLTDVDCLYT +PR++PD
Sbjct: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183

Query: 192 AKPILIVPDLSKGLP-XXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIMKSDAPSN 250
           AKPI+IVP++ +G+P                 M+TKL+AA+LATNAGV+TIIMKSDAPSN
Sbjct: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243

Query: 251 IYKIVKYI-----QSLHDTGEDNK--------------------------VFEGDLMKLQ 279
           +  IV Y+     + L+D  + ++                            E DL+ LQ
Sbjct: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303

Query: 280 LEEYEKLDRMGVPFHTKFLANSISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKN-- 337
             E +++    VP HT FLA  I  HL+N+EFWILHGLVT G +IIDE AY  LT ++  
Sbjct: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363

Query: 338 ----------------------KAGLLPVGVIEIEGSFHEMECVDLKVGKRLPNGELDPD 375
                                   GLLP  VIE++GSFHE+ECVD+KVGKRLPNG+LDPD
Sbjct: 364 EEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423

Query: 376 YPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
            PL  VGRARCN+ S+E+++IKG   D +++ LGY  SEY+AH++
Sbjct: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKD 468

>Scas_690.36
          Length = 424

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 229/420 (54%), Positives = 292/420 (69%), Gaps = 14/420 (3%)

Query: 9   KPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNXXXXXXXXXXXXLHILG 68
           K  TIVIKLG+SSLVDE T+EP+L+ M+ IVE V  L+RLGH             L  + 
Sbjct: 3   KSNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDAMN 62

Query: 69  MEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTV 128
           ++K+P  LSE+QAIAAIGQ KLIGRW+ LF  + + IAQILLTR DI  W+Q++NAQNT+
Sbjct: 63  LKKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTI 122

Query: 129 EELLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRS 188
             LLKMGVVPI+NENDTLSV EIKFGDNDTLSAIT+ L++ADYLFLLTDVDCLYT +P+ 
Sbjct: 123 NALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKV 182

Query: 189 DPDAKPILIVPDL-----SKGLPXXXXXXXXXXXXXXXXMQTKLVAAELATNAGVHTIIM 243
           + DAKPIL V D+     SK L                 M+TK+ AA+LATN G+HTIIM
Sbjct: 183 NKDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIM 242

Query: 244 KSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGVPFHTKFLANSIS 303
            S  P+NI KI++Y+++       N   +G +      E + L    VP HTKF+AN  S
Sbjct: 243 SSQTPANILKIIEYMET------SNLKVDGGVCSNNDLELKNLIAHDVPLHTKFIANENS 296

Query: 304 R-HLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNK--AGLLPVGVIEIEGSFHEMECVD 360
             +L+N+EFWILHGLVT G++IID+ +YK L RK +   GLLP+ +I+ E  FHE+ECV+
Sbjct: 297 ETYLKNREFWILHGLVTKGSIIIDKNSYKDLLRKKEKCKGLLPISIIDTEDQFHELECVE 356

Query: 361 LKVGKRLPNGELDPDYPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRE 420
           LKVG+RLPNG+++    L +VGRARCNY S EI+KIKG +SD+I   LGY +S Y+ H E
Sbjct: 357 LKVGERLPNGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNE 416

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P+A+
Sbjct: 231 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAKPI-LIVPD 200
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+ +  + PD
Sbjct: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDTVTPD 275

>Scas_715.44
          Length = 528

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267

>Kwal_47.18163
          Length = 522

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267

>YGR184C (UBR1) [2135] chr7 complement(859904..865756)
            Ubiquitin-protein ligase (N-recognin or E3 enzyme),
            involved in selection of substrates for the N-end rule
            pathway [5853 bp, 1950 aa]
          Length = 1950

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 248  PSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGV 291
            PSNI+    Y+ S  + G  N +  GDL  L L+ YE L+R+ +
Sbjct: 1750 PSNIFISAPYLNSHGEVGR-NAMRRGDLTTLNLKRYEHLNRLWI 1792

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 131 LLKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLI 167
           L +M ++ + NENDTLS ++I+ G N T   I   ++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>CAGL0H09350g complement(912452..918349) similar to sp|P19812
            Saccharomyces cerevisiae YGR184c UBR1, hypothetical start
          Length = 1965

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 245  SDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLMKLQLEEYEKLDRMGV 291
            S  PSNI+    Y+ S  + G  N +  GDL  L L+ YE L+++ +
Sbjct: 1772 SQPPSNIFISAPYLNSHGEVGR-NAMRRGDLTTLNLKRYEHLNKLWI 1817

>YBR275C (RIF1) [454] chr2 complement(751313..757063) Protein
           involved in telomere length regulation and
           transcriptional silencing, interacts with Rap1p [5751
           bp, 1916 aa]
          Length = 1916

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 287 DRMGVPFHTKFLANSISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKNKAGLLPVGV 346
           D +  P +  ++    S HL+N  F +LH L+        + A  AL RK K  + P+ V
Sbjct: 646 DHLITPIYEDYVFKYDSIHLQNVLFTVLHLLIGG------KNADVALERKYKKHIHPMSV 699

Query: 347 IEIEG 351
           I  EG
Sbjct: 700 IASEG 704

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,793,288
Number of extensions: 529789
Number of successful extensions: 1297
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1300
Number of HSP's successfully gapped: 25
Length of query: 420
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 316
Effective length of database: 12,995,837
Effective search space: 4106684492
Effective search space used: 4106684492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)