Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09361g42942220810.0
AGR323C4024368181e-106
Sklu_2014.24154368171e-105
Scas_617.74204297991e-103
YGR193C (PDX1)4104287594e-97
Kwal_33.154354104137378e-94
KLLA0E09768g4054317352e-93
Scas_694.104791862435e-22
YNL071W (LAT1)4822012418e-22
AER364W4532132232e-19
CAGL0J10186g4691852222e-19
Kwal_23.47254721902161e-18
Sklu_2037.44711942027e-17
KLLA0F04741g473811893e-15
AAR071W2231123830.044
YMR207C (HFA1)212385770.23
Kwal_56.23934442117740.40
YBR208C (DUR1,2)183548730.75
YLR121C (YPS3)50885691.7
Scas_720.74223186701.8
KLLA0B02805g114078682.3
Scas_719.31116273673.7
Sklu_2393.454657664.1
KLLA0F20834g61681654.8
KLLA0D16522g46889655.1
Scas_584.463153655.5
Kwal_27.11951186947656.1
Kwal_26.790826569646.2
AGL200W436110647.3
YDR148C (KGD2)463145647.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09361g
         (422 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   806   0.0  
AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   319   e-106
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        319   e-105
Scas_617.7                                                            312   e-103
YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   296   4e-97
Kwal_33.15435                                                         288   8e-94
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   287   2e-93
Scas_694.10                                                            98   5e-22
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...    97   8e-22
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...    91   2e-19
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    90   2e-19
Kwal_23.4725                                                           88   1e-18
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         82   7e-17
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...    77   3e-15
AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C (H...    37   0.044
YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein w...    34   0.23 
Kwal_56.23934                                                          33   0.40 
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    33   0.75 
YLR121C (YPS3) [3534] chr12 complement(388745..390271) GPI-ancho...    31   1.7  
Scas_720.74                                                            32   1.8  
KLLA0B02805g complement(250482..253904) similar to sgd|S0004402 ...    31   2.3  
Scas_719.31                                                            30   3.7  
Sklu_2393.4 , Contig c2393 3530-5170 reverse complement                30   4.1  
KLLA0F20834g complement(1942016..1943866) weakly similar to sp|P...    30   4.8  
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    30   5.1  
Scas_584.4                                                             30   5.5  
Kwal_27.11951                                                          30   6.1  
Kwal_26.7908                                                           29   6.2  
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    29   7.3  
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    29   7.6  

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/422 (95%), Positives = 402/422 (95%)

Query: 1   MLSARVLLNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSW 60
           MLSARVLLNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSW
Sbjct: 1   MLSARVLLNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSW 60

Query: 61  KFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPED 120
           KFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPED
Sbjct: 61  KFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPED 120

Query: 121 DLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTT 180
           DLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTT
Sbjct: 121 DLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTT 180

Query: 181 ADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAE 240
           ADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAE
Sbjct: 181 ADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAE 240

Query: 241 YVNRNQKLDLSNIERIVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPI 300
           YVNRNQKLDLSNIERIVLEVNSEE                    SGKTGKLAKPAQVEPI
Sbjct: 241 YVNRNQKLDLSNIERIVLEVNSEEGGDGQAQAQAQAQAQGQGQDSGKTGKLAKPAQVEPI 300

Query: 301 RIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPR 360
           RIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPR
Sbjct: 301 RIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPR 360

Query: 361 SARFDVEYSLLETTDGSEDIFDLLGPGEVKEGKQVYSLEVSVTVNDKYDDAVEKADRFME 420
           SARFDVEYSLLETTDGSEDIFDLLGPGEVKEGKQVYSLEVSVTVNDKYDDAVEKADRFME
Sbjct: 361 SARFDVEYSLLETTDGSEDIFDLLGPGEVKEGKQVYSLEVSVTVNDKYDDAVEKADRFME 420

Query: 421 CL 422
           CL
Sbjct: 421 CL 422

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  319 bits (818), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 250/436 (57%), Gaps = 63/436 (14%)

Query: 8   LNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDS 67
           + RSQL  +        +   R F  +     ++PF MPAMSPTMEKGGIVSWKFK  + 
Sbjct: 1   MFRSQLYKQ-----SARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEP 55

Query: 68  FNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKI 127
           F AGDV+LEVETDKAQIDVEAQDDGKLA I++GDGSKDV VG+ +AF A+ EDDLS L+I
Sbjct: 56  FQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEI 115

Query: 128 PEVTESMKQVSSGSGKEDQ---KPAKSEE-PAPLQRKEGKNVSESKTAKSSGDVLTTADA 183
           P+V      V+S + KE +    P  SE+ PAP ++   K VS          +L  AD 
Sbjct: 116 PKV------VTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNG--------ILQQADK 161

Query: 184 SQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVN 243
           +QTLLPSV+  L  NG++ E+A ANIKASG NGRILKGDVL Y GKI  DSVVKV+EY+ 
Sbjct: 162 NQTLLPSVITLLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIK 221

Query: 244 RNQKLDLSNIERIVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPIR-- 301
           + + LDLSNIE                               G   K A+P    P    
Sbjct: 222 KFEHLDLSNIE-----------------------LRPAQPPKGAADKKAEPKPAPPAYRT 258

Query: 302 IQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRS 361
           + E ++L+V   V F RF  A+++YI +     H + L+N  S+R+D LFE+L++V PR 
Sbjct: 259 LHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPYSDRFDPLFEELLSVQPRE 318

Query: 362 ARFDVEYSLLETT------DGSEDIFDLL---------GPGEVKEGKQVYSLEVSVTVND 406
            RF+V Y +L  T         EDIFD+L          P   +     Y+L++ + V +
Sbjct: 319 PRFEVSYDVLPLTVVPSSPKPKEDIFDILSGNSVESKPAPSSSEPSAHEYALDLYLKVEN 378

Query: 407 KYDDAVEKADRFMECL 422
           K+ D+  +A RF++ +
Sbjct: 379 KFSDSETRAARFIDYI 394

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  319 bits (817), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 247/436 (56%), Gaps = 47/436 (10%)

Query: 1   MLSARVLLNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSW 60
           ML   V  N +      + L    +  SR F S         F MPAMSPTMEKGG+V W
Sbjct: 1   MLRYTVFRNSAAYAASAKLL----LTSSRGFHSAATLYKAQAFTMPAMSPTMEKGGVVEW 56

Query: 61  KFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPED 120
           K+K  + F+AGDVLLEVETDKAQIDVEAQDDGKLA II  +GSKD+ VG+ IA+ A+ +D
Sbjct: 57  KYKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAAIIIDNGSKDIKVGETIAYLAEVDD 116

Query: 121 DLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTT 180
           DL+TL+IP+   +  + +    +    PA + EP    +K+    SE K    SG +L+T
Sbjct: 117 DLATLEIPKQEPAAPKPTPKKQETAPTPAATPEP----KKDNAPTSEPKKDTPSG-ILST 171

Query: 181 ADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAE 240
           A+ SQTL PSV   L +NGIS EDAL NIKASG NGRILKGDVLAY GKI  D VVKV E
Sbjct: 172 ANPSQTLFPSVQSLLHENGISVEDALNNIKASGPNGRILKGDVLAYLGKISNDCVVKVTE 231

Query: 241 YVNRNQKLDLSNIERIVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPI 300
           Y+   + LDL+NIE    E+  E                      G +  L KP   EP+
Sbjct: 232 YIKSGESLDLTNIELKKPELKLE---------------------LGTSKTLLKP---EPV 267

Query: 301 RIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPR 360
              E + L V   V   +  +++R YI++    +HEQP+  + S+ YD +FE+L+T +PR
Sbjct: 268 VFTETLTLRVPSAVSSDQLSKSLRSYINEANYLSHEQPVNASTSDYYDPIFEELITPEPR 327

Query: 361 SARFDVEYSLLE-----TTDGSEDIFDLL-GPGEVKEGKQV--------YSLEVSVTVND 406
             RF V Y L       +    +DIFDLL G        QV        YSL+VSV VN 
Sbjct: 328 QPRFSVSYQLTPLVPVLSPKQHDDIFDLLSGTSAATSSPQVEQPSKTTEYSLDVSVQVNG 387

Query: 407 KYDDAVEKADRFMECL 422
           K+DDA  KA RF+E L
Sbjct: 388 KFDDATLKAQRFIEYL 403

>Scas_617.7
          Length = 420

 Score =  312 bits (799), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 245/429 (57%), Gaps = 45/429 (10%)

Query: 17  RQCLTG-VSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLL 75
           R CL G     L R    +R  L    F MPAMSPTMEKGGIVSWKFK  + F++GDVLL
Sbjct: 8   RSCLQGQTRRSLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDVLL 67

Query: 76  EVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMK 135
           EVETDKAQIDVEAQDDGKLAKI++GDGSKDV VG+ IA+ AD +DDLSTLKI    E   
Sbjct: 68  EVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKISAEEEEQV 127

Query: 136 QVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTTADASQTLLPSVVMAL 195
           +V+  S  E++  + ++EP     +  K   ES  A     VL  A ++QTLLPSV + L
Sbjct: 128 KVTPVSKVEEKTTSGNKEPL----QNTKKAKESPIATDKNGVLQVAKSNQTLLPSVSLLL 183

Query: 196 ADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNIER 255
           A N ISKEDA+ NIKASG +G +LKGDVLAY GKI + S++KV+EYV   +K D S+IE 
Sbjct: 184 AANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSHIEL 243

Query: 256 IVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPIRIQEEILLEVRRGVD 315
             L                               K++K    EP+ +  EI L+V   V 
Sbjct: 244 GSL--------------TKAEPPQSEKLEDKAIEKISK----EPVLLHSEITLKVPSNVS 285

Query: 316 FTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLL---- 371
             R +  V+ +I++ ++YTH  PL N  S+ +D +FEDL+T  PR  RF V Y L     
Sbjct: 286 RERLDNTVKSFIEEGFEYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVE 345

Query: 372 ----ETTDGSEDIFDLL----------GP----GEVKEGKQVYSLEVSVTVNDKYDDAVE 413
                T    EDIFDLL          GP     E       ++L + + V+DKY D+ +
Sbjct: 346 EEERFTRKDREDIFDLLAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQ 405

Query: 414 KADRFMECL 422
           KA+RF+E +
Sbjct: 406 KAERFLEYM 414

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  296 bits (759), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 175/428 (40%), Positives = 250/428 (58%), Gaps = 51/428 (11%)

Query: 14  LCKRQCLTGVSVGLSRC-FSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGD 72
           + K   L   +  L++C + ++   L V  F MPAMSPTMEKGGIVSWK+K  + F+AGD
Sbjct: 5   ISKVSTLKSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGD 64

Query: 73  VLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTE 132
           V+LEVETDK+QIDVEA DDGKLAKI++ +GSKDV VG+ IA+ AD +DDL+T+K+P+   
Sbjct: 65  VILEVETDKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEAN 124

Query: 133 SMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTTADASQTLLPSVV 192
           +    ++    E +KP+     A  Q  +   V+  KT   S      A+  QTLLPSV 
Sbjct: 125 T----ANAKSIEIKKPSADSTEATQQHLKKATVTPIKTVDGS-----QANLEQTLLPSVS 175

Query: 193 MALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSN 252
           + LA+N ISK+ AL  I  SG+NGR+LKGDVLAY GKI QDSV KV E++ +N++LDLSN
Sbjct: 176 LLLAENNISKQKALKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSN 235

Query: 253 IERIVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPIRIQEEILLEVRR 312
           I+ I L+    E                      +T    KP ++ P+  +E+++     
Sbjct: 236 IKPIQLKPKIAE--------------------QAQTKAADKP-KITPVEFEEQLVFHAPA 274

Query: 313 GVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLE 372
            + F +   ++  ++ + YQ++H  PL +T S+ +D +FEDLVT+ PR  RF   Y L++
Sbjct: 275 SIPFDKLSESLNSFMKEAYQFSHGTPLMDTNSKYFDPIFEDLVTLSPREPRFKFSYDLMQ 334

Query: 373 T--------TDGSEDIFDLLGPGEVKEG-----------KQVYSLEVSVTVND-KYDDAV 412
                    T G EDIFDLL   +               K  Y L ++V+VN+ K++DA 
Sbjct: 335 IPKANNMQDTYGQEDIFDLLTGSDATASSVRPVEKNLPEKNEYILALNVSVNNKKFNDAE 394

Query: 413 EKADRFME 420
            KA RF++
Sbjct: 395 AKAKRFLD 402

>Kwal_33.15435
          Length = 410

 Score =  288 bits (737), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 239/413 (57%), Gaps = 76/413 (18%)

Query: 43  FLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDG 102
           F MPAMSPTMEKGG+V WKFK  + F+AGDVLLEVETDKAQIDVEAQDDGKLAKI+  DG
Sbjct: 32  FAMPAMSPTMEKGGVVEWKFKVGEPFSAGDVLLEVETDKAQIDVEAQDDGKLAKILVNDG 91

Query: 103 SKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEP-------A 155
           +KD+ VG+ IA+ A+PEDDL+TL++P+              E+++  K+ EP       A
Sbjct: 92  AKDINVGEPIAYLAEPEDDLATLELPQ-------------SENKQSTKAPEPKVEKDVKA 138

Query: 156 PLQRKEGKNVSESKTAKSS-----------GDVLTTADASQTLLPSVVMALADNGISKED 204
             Q+ +G   SE K  K +             V+  AD +QTLLPSV + L  N IS ED
Sbjct: 139 SAQKGQG---SEPKAQKQTQVSSSSGSKDVSGVMVKADPAQTLLPSVQLLLHANNISNED 195

Query: 205 ALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNIERIVLEVNSEE 264
           AL NI+ASG NGRILKGDVL+Y GK+ Q+++ K+ +Y+ + + LDLSNIE    E  S+ 
Sbjct: 196 ALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGEVLDLSNIELKKPEPASKA 255

Query: 265 XXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPIRIQEEILLEVRRGVDFTRFERAVR 324
                                          + EP+   E++ L+V   V F +F R+++
Sbjct: 256 PESV--------------------------VKKEPVIFTEQLHLKVEPNVTFEQFSRSLK 289

Query: 325 EYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLETTDGS------E 378
            YID+    +H +P+ N  S+ YD+LFE+L+T +PR  RF V Y ++     S      +
Sbjct: 290 SYIDEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQD 349

Query: 379 DIFDLLG-----PGEVKEGKQVYSLEV----SVTVNDKYDDAVEKADRFMECL 422
           DIFDLL      P   + G  + S EV    SV V+DK+ DA  KA+RF++ +
Sbjct: 350 DIFDLLAGTKNTPASTESG-NLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYV 401

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  287 bits (735), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 178/431 (41%), Positives = 239/431 (55%), Gaps = 66/431 (15%)

Query: 17  RQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLE 76
           R CL        R     R  L    F MPAMSPTME+GG+V WKFK  D+F+AGDVLLE
Sbjct: 9   RACL--------RQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGDVLLE 60

Query: 77  VETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQ 136
           VETDKA IDVEAQDDGKLAKI++ +G+KD+ VG+ IA+ AD +DDL+TL+ P+  E+   
Sbjct: 61  VETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPVEA--- 117

Query: 137 VSSGSGKEDQKP--AKSEEPAPLQRKEGK-NVSESKTAKSSGDVLTTADASQTLLPSVVM 193
                 K++ KP   K EE  P+++ + K   S SKT   +G V   A+ASQTL PSV+ 
Sbjct: 118 ------KKESKPVETKKEEAKPVEKTDKKKQTSASKTPSKNGSV--QANASQTLFPSVLS 169

Query: 194 ALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNI 253
            L +N IS  DAL  IKA+G NGRILKGDVLAY GKI QDS+ KV EY+  ++KLDL+NI
Sbjct: 170 LLEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNI 229

Query: 254 E-RIVLEVNSEEXXXXXXXXXXXXXXXXXXXXSGKTGKLAKPAQVEPIRIQEEILLEVRR 312
           E R   E  +                                    P+ + E+I L V  
Sbjct: 230 ELRPARETAAAAAAAQAAKPAKPL----------------------PLVLSEQITLHVPE 267

Query: 313 GVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLE 372
            V +++   A+  Y+ +     H++PL N  SE YD LFE+L+  +P   RF V Y++++
Sbjct: 268 NVTYSQLSAAIASYVKECSFLAHDEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVD 327

Query: 373 --------TTDGSEDIFDLLGPGEVKEGKQ-------------VYSLEVSVTVNDKYDDA 411
                   T+    DIFDLL     +E +Q              Y+L VSV V++   DA
Sbjct: 328 LEPTPRHRTSSPQPDIFDLLSGTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDA 387

Query: 412 VEKADRFMECL 422
            ++A+ F+  L
Sbjct: 388 KQRAENFVAQL 398

>Scas_694.10
          Length = 479

 Score = 98.2 bits (243), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 102/186 (54%), Gaps = 18/186 (9%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MP++SPTM  G +V+W  +  D    GDVL E+ETDKAQ+D E QDDG LAKI+  +G+K
Sbjct: 43  MPSLSPTMTHGNLVAWSKQVGDQLAPGDVLAELETDKAQMDFEFQDDGYLAKILVPEGTK 102

Query: 105 DVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKE--DQKPAKSE----EPAPLQ 158
           DV +   IA   +  DD++  K  ++ +S    ++ +  E  ++KP + E    +  P Q
Sbjct: 103 DVPINKPIAVYVEDADDVAAFKDFKIEDSADAAATTTTTEVKEEKPQQPEKINAQQQPTQ 162

Query: 159 RKEGKNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRI 218
           + + +  S      ++G ++ +  A +  L        +NG+    AL   K SG +GRI
Sbjct: 163 KSKEQKSSPVTQEDTTGRIIASPLAKKIAL--------ENGV----ALKGFKGSGPHGRI 210

Query: 219 LKGDVL 224
           +K DVL
Sbjct: 211 VKDDVL 216

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score = 97.4 bits (241), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 99/201 (49%), Gaps = 18/201 (8%)

Query: 29  RCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEA 88
           RC++S      +    MPA+SPTM +G + +W  KE D  + G+V+ E+ETDKAQ+D E 
Sbjct: 26  RCYASYPEHTIIG---MPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETDKAQMDFEF 82

Query: 89  QDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTES---MKQVSSGSGKED 145
           Q+DG LAKI+  +G+KD+ V   IA   + + D+   K  ++ +S    K  +     E 
Sbjct: 83  QEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSDSKTSTKAQPAEP 142

Query: 146 QKPAKSEEPAPLQRKEGKNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDA 205
           Q   K E PA   +       +S  A   G +  +  A    L        + GIS    
Sbjct: 143 QAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLAKTIAL--------EKGIS---- 190

Query: 206 LANIKASGANGRILKGDVLAY 226
           L ++  +G  GRI K D+ +Y
Sbjct: 191 LKDVHGTGPRGRITKADIESY 211

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 105/213 (49%), Gaps = 14/213 (6%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MPA+SPTM +G +  W  KE D  + G+VL EVETDKAQ+D E Q++G LAKI+  +G+K
Sbjct: 36  MPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKAQMDFEFQEEGFLAKILVPEGAK 95

Query: 105 DVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKN 164
           DV V   IA   + E D++  K  +V ES  +  S      ++ A ++            
Sbjct: 96  DVPVNKPIAVYVEEEGDVAAFKDFKVEESAAE--SKDAPAKEEAAPAKAAPAAAAPAKAA 153

Query: 165 VSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVL 224
              + +A S G ++ +  A    L        + GIS    L  +  +G NGRI K DV 
Sbjct: 154 KKSTGSAASGGRIMASPLAKTIAL--------EKGIS----LKEVTGTGPNGRITKEDVE 201

Query: 225 AYAGKIQQDSVVKVAEYVNRNQKLDLSNIERIV 257
            Y  K  + +    A      + + +SN+ R++
Sbjct: 202 KYLAKAPKKTESAAAPAAATYEDVPISNMRRVI 234

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 99/185 (53%), Gaps = 14/185 (7%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MPA+SPTM +G +  W  KE DS   GDVL E+ETDKAQ+D E QD+G LAKI+   G+K
Sbjct: 40  MPALSPTMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTK 99

Query: 105 DVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRKEGKN 164
           DV V   IA   + E D++  K   V ++    SS +   +++  + ++    + K  K 
Sbjct: 100 DVAVSRPIAVYVEDEADVAAFKDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKK 159

Query: 165 VSESKTAKS---SGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKG 221
            ++S +  S   SGD +  +  ++T+            + K  AL ++K +G  GRI K 
Sbjct: 160 AAKSNSTPSSVASGDRIIASPLAKTI-----------ALEKGIALKSVKGTGPRGRITKA 208

Query: 222 DVLAY 226
           DV  Y
Sbjct: 209 DVEKY 213

>Kwal_23.4725
          Length = 472

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 94/190 (49%), Gaps = 20/190 (10%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MPA+SPTM +G +  W  K  D    G+ + E+ETDKAQ++ E Q+DG LAKI+  +GSK
Sbjct: 37  MPALSPTMTQGNLAVWLKKAGDKLEPGEAIAEIETDKAQMEFEFQEDGYLAKILVPEGSK 96

Query: 105 DVLVGDVIAFTADPEDDLS-----TLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQR 159
           D+ VG  IA   + E D+      T +     +          +  Q+ A+ EE      
Sbjct: 97  DLPVGKPIAVYVEEEGDVGAFADFTAEEAAPEKPAAAPEKKQDEPQQQAAQKEESG---- 152

Query: 160 KEGKNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRIL 219
           K  K  S + +A  SGD +  +  ++T+      AL D GIS    L  +  +G  GRI 
Sbjct: 153 KPAKKSSGATSAAPSGDRIIASPLAKTI------AL-DKGIS----LKAVTGTGPRGRIT 201

Query: 220 KGDVLAYAGK 229
           K DV  Y  K
Sbjct: 202 KADVEEYLSK 211

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 82.4 bits (202), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/194 (32%), Positives = 95/194 (48%), Gaps = 26/194 (13%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MPA+SPTM +G +  W  K  DS + G+V+ E+ETDKAQ+D E Q++G LAKI+  +G+K
Sbjct: 37  MPALSPTMTQGNLAVWSKKVGDSLSPGEVIAEIETDKAQMDFEFQEEGFLAKILVPEGTK 96

Query: 105 DVLVGDVIAFTADPEDDLSTLKIPEVTESMK---------QVSSGSGKEDQKPAKSEEPA 155
           D+ V   IA   + E D+   K   V +S           +      +   KPA S    
Sbjct: 97  DIPVNKPIAVYVEEEGDVEAFKDFTVDDSASPAKKEAPKEEAPKEEEQAATKPASS---T 153

Query: 156 PLQRKEGKNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGAN 215
           P Q K   + S S ++  +G +  +  A    L        + GI    AL N+  +G +
Sbjct: 154 PSQNK--SSSSSSSSSAHAGRIFASPLAKTIAL--------EKGI----ALKNVTGTGPH 199

Query: 216 GRILKGDVLAYAGK 229
           GRI K D+  +  K
Sbjct: 200 GRITKADIETFLAK 213

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 50/81 (61%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           MPA+SPTM +GG+  W     D    GDVL EVETDKAQ+D E Q++G LAKI+   G+K
Sbjct: 37  MPALSPTMVQGGLTEWSKNVGDRLEPGDVLAEVETDKAQMDFEFQEEGYLAKILVPAGTK 96

Query: 105 DVLVGDVIAFTADPEDDLSTL 125
           D+ V   +A   + E D+   
Sbjct: 97  DIPVNKPLAVYVEEESDVPAF 117

>AAR071W [257] [Homologous to ScYNR016C (ACC1) - SH; ScYMR207C
           (HFA1) - SH] complement(466791..473486) [6696 bp, 2231
           aa]
          Length = 2231

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 32  SSTRMSLDVSPFLM-----PAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDV 86
           ++TR+S+D    L+     P    T   G +V++  +  D   AG    E+E  K Q+ +
Sbjct: 681 AATRLSIDHQTTLLETENDPTQLRTPSPGKLVNFLVESGDHLEAGQPYAEIEVMKMQMPL 740

Query: 87  EAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQ 146
            AQ+ G L +++R  GS  +  GD++A      DD S +K     E M         E  
Sbjct: 741 IAQESGVL-QLLRQPGST-LAAGDILAILT--LDDPSKVKYAMPFEGMLPDLGAPVIEGT 796

Query: 147 KPA 149
           KPA
Sbjct: 797 KPA 799

>YMR207C (HFA1) [4163] chr13 complement(677192..683563) Protein with
           similarity to acetyl-CoA carboxylase [6372 bp, 2123 aa]
          Length = 2123

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 7/85 (8%)

Query: 34  TRMSLDVSP-FLMPAMSPTM----EKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEA 88
           TR+S+D +  FL   ++PT       G +V +  +  D   AG    E+E  K Q+ + A
Sbjct: 602 TRLSIDSNTIFLEAELNPTQVISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVA 661

Query: 89  QDDGKLAKIIRGDGSKDVLVGDVIA 113
           + DG + +++R  GS  +  GDVIA
Sbjct: 662 KSDG-VIELLRQPGSI-IEAGDVIA 684

>Kwal_56.23934
          Length = 442

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           +P M+ ++ +G +  +  +  +     ++L  +ETDK  ++V A   GK+ K +      
Sbjct: 60  VPPMAESLTEGSLKEYTKQVGEFIKQDELLATIETDKIDVEVNAPTSGKVTK-LNFQPED 118

Query: 105 DVLVGDVIA-FTADPEDDLSTLKIPEVT--ESMKQVSSGSGKEDQKPA--KSEEPAP 156
            V VGD +A   A  E   S    P+ T  E  KQ S  + K++Q+ A  K +E AP
Sbjct: 119 TVTVGDDLAEIEAGAEAPASGQDAPKETSQEQPKQSSESAPKKEQEAAAPKPQETAP 175

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 66   DSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIA 113
            D   AG  LL +E  KA++ + A   GK+ KI  G+G   V  GD++A
Sbjct: 1783 DVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDM-VDSGDIVA 1829

>YLR121C (YPS3) [3534] chr12 complement(388745..390271) GPI-anchored
           aspartyl protease [1527 bp, 508 aa]
          Length = 508

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 97  IIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAP 156
           II   G+   ++GD     A    DL   +I     S+ Q   G+GKE+ +  KS  P+ 
Sbjct: 361 IIPQAGNATAILGDSFLRNAYVVYDLDNYEI-----SLAQAKYGTGKENVEVIKSTVPSA 415

Query: 157 LQRKEGKNV-SESKTAKSSGDVLTT 180
           ++     N  S   +A S G++ TT
Sbjct: 416 IRAPSYNNTWSNYASATSGGNIFTT 440

>Scas_720.74
          Length = 2231

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 33  STRMSLDVSPFLM-----PAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVE 87
           +TR+S+D    L+     P    T   G +V +  +  D   AG    E+E  K Q+ + 
Sbjct: 682 ATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVESGDHIAAGQPYAEIEVMKMQMPLV 741

Query: 88  AQDDGKLAKIIRGDGSKDVLVGDVIA 113
           AQ+ G + ++++  GS  +  GD+IA
Sbjct: 742 AQETG-IIQLLKQPGST-LSAGDIIA 765

>KLLA0B02805g complement(250482..253904) similar to sgd|S0004402
           Saccharomyces cerevisiae YLR410w VIP1, start by
           similarity
          Length = 1140

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 287 KTGKLAKPAQVEPIRIQEEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPL----ENT 342
           + GK A P    P ++ E  L+ ++R VD   + + + ++          Q      E++
Sbjct: 736 RMGKEAPPQFAWPAKMPEPYLV-IKRVVDLMNYHKKIMDHNFATKNVEEMQTCWCCAEDS 794

Query: 343 M--SERYDSLFEDLVTVD 358
           M   ER+D LF++ VTVD
Sbjct: 795 MLFKERWDKLFKEFVTVD 812

>Scas_719.31
          Length = 1162

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 13/73 (17%)

Query: 343 MSERYDSLFEDLVT---VDPR--SARFD-VEYSLLETTDGSEDIFDLLGPGEVKEGKQVY 396
             ER+D LF++ VT   VDP   S  +D ++Y  L      E+IFD   PGE  E   + 
Sbjct: 794 FKERWDKLFKEFVTVEKVDPSKISELYDTMKYDALHNRQFLENIFD---PGESNE---LI 847

Query: 397 SLEVS-VTVNDKY 408
            LE+S  ++ DKY
Sbjct: 848 GLELSERSLVDKY 860

>Sklu_2393.4 , Contig c2393 3530-5170 reverse complement
          Length = 546

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 6/57 (10%)

Query: 319 FERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLETTD 375
           F +   ++I D ++ +HEQPL+    E      EDL TV        +E SL +  D
Sbjct: 350 FNQYSHQFIHDYFELSHEQPLQEDSGE------EDLSTVVTNDYEMQIEQSLNDQAD 400

>KLLA0F20834g complement(1942016..1943866) weakly similar to
           sp|P34761 Saccharomyces cerevisiae YNL197c WHI3 involved
           in regulation of cell size, start by similarity
          Length = 616

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 32  SSTRMSLDVSPFLM-PAMSPTMEKGGIVSWK--FKENDSFNAGDVLLEVETDKAQIDVEA 88
           SS  +S +V+P L  P  S + ++  ++  +  F  +D F+A +  +      AQ  ++ 
Sbjct: 206 SSGSVSSNVAPTLTSPPQSSSRKRPSLLGQRSRFSFSDPFSAENPHIPPAQTSAQTPLQN 265

Query: 89  QDDGKLAKIIRGDGSKDVLVG 109
            D GK   ++ GDG  D + G
Sbjct: 266 IDAGKSFLLMEGDGINDTIWG 286

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 27  LSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDV 86
           L+  F + R +  V    +P M+ ++ +G +  +  K  D     ++L  +ETDK  ++V
Sbjct: 69  LNTRFMAVRHATSVP---VPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKIDVEV 125

Query: 87  EAQDDGKLAKIIRGDGSKD--VLVGDVIA 113
            +   G +AK+   + S D  V VG+ IA
Sbjct: 126 ISPISGTIAKL---NFSPDDTVTVGEEIA 151

>Scas_584.4
          Length = 631

 Score = 29.6 bits (65), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 170 TAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRILKGD 222
           +A+S+ D +T++ A+   +P +  A  D+ +SKE  L N+K   +   +LKG+
Sbjct: 128 SAESANDGVTSSSATPMAVPLINTAKLDDSLSKEKLLTNLKLQQS---LLKGN 177

>Kwal_27.11951
          Length = 1869

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 66   DSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVI 112
            D   AGD L+ VE  K ++ V A   GK+ K++  +G   V  GDV+
Sbjct: 1820 DVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGDM-VEAGDVV 1865

>Kwal_26.7908
          Length = 265

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 337 QPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLETTDGSEDIFDLL-----GPGEVKE 391
           +P + T+SE   S+++DL T   ++   DV Y++  + +  +++   L      PG    
Sbjct: 96  EPCQKTLSESQKSIYDDLKTYASKNFAGDVSYAVYSSGNAQDEVIIALVSTKYSPGNFWN 155

Query: 392 G--KQVYSL 398
           G  + +YS 
Sbjct: 156 GHWRSIYSY 164

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 46/110 (41%), Gaps = 24/110 (21%)

Query: 45  MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSK 104
           +P M+ ++ +G +  +  +  +     ++L  +ETDK  I+V A   G + K+       
Sbjct: 65  VPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVSGTVTKL------- 117

Query: 105 DVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKE-DQKPAKSEE 153
                        PED ++      V E + Q+  G+     QKPA  EE
Sbjct: 118 ----------NFKPEDTVT------VGEELAQIEEGAAPAGGQKPAAKEE 151

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 56/145 (38%), Gaps = 27/145 (18%)

Query: 31  FSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQD 90
           FS T      +   +P M+ ++ +G +  +     D     ++L  +ETDK  I+V +  
Sbjct: 64  FSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPV 123

Query: 91  DGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSG----SGKEDQ 146
            G + K+                    PED ++      V E + QV  G     G  + 
Sbjct: 124 SGTVTKL-----------------NFKPEDTVT------VGEELAQVEPGEAPAEGSGES 160

Query: 147 KPAKSEEPAPLQRKEGKNVSESKTA 171
           KP  +E+  P Q    +  S  +TA
Sbjct: 161 KPEPTEQAEPSQGVAARENSSEETA 185

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,595,447
Number of extensions: 539031
Number of successful extensions: 1931
Number of sequences better than 10.0: 84
Number of HSP's gapped: 1904
Number of HSP's successfully gapped: 88
Length of query: 422
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 318
Effective length of database: 12,995,837
Effective search space: 4132676166
Effective search space used: 4132676166
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)