Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09339g58257330890.0
Scas_617.558158118920.0
YGR194C (XKS1)60058118160.0
Sklu_2014.363157116280.0
Kwal_33.1543858057116190.0
KLLA0E09746g58057716170.0
AGR324C56457514890.0
KLLA0B03806g383128711.4
KLLA0D10285g515164702.0
CAGL0L08228g33376683.1
CAGL0E03916g672136666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09339g
         (573 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces c...  1194   0.0  
Scas_617.5                                                            733   0.0  
YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokina...   704   0.0  
Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement        631   0.0  
Kwal_33.15438                                                         628   0.0  
KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces c...   627   0.0  
AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH] (1335916..1...   578   0.0  
KLLA0B03806g 343108..344259 similar to sp|P38698 Saccharomyces c...    32   1.4  
KLLA0D10285g 869754..871301 similar to sp|Q04489 Saccharomyces c...    32   2.0  
CAGL0L08228g 907157..908158 similar to sp|P25332 Saccharomyces c...    31   3.1  
CAGL0E03916g 371185..373203 similar to sp|P32190 Saccharomyces c...    30   6.8  

>CAGL0G09339g 891248..892996 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase, start by
           similarity
          Length = 582

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/573 (100%), Positives = 573/573 (100%)

Query: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60
           MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV
Sbjct: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60

Query: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQ 120
           GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQ
Sbjct: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQ 120

Query: 121 LYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENE 180
           LYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENE
Sbjct: 121 LYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENE 180

Query: 181 EDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGK 240
           EDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGK
Sbjct: 181 EDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGK 240

Query: 241 EDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDI 300
           EDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDI
Sbjct: 241 EDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDI 300

Query: 301 LVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQS 360
           LVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQS
Sbjct: 301 LVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQS 360

Query: 361 TSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKYVDKFDNN 420
           TSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKYVDKFDNN
Sbjct: 361 TSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKYVDKFDNN 420

Query: 421 RHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVY 480
           RHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVY
Sbjct: 421 RHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVY 480

Query: 481 FVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFD 540
           FVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFD
Sbjct: 481 FVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFD 540

Query: 541 SFLNRYFPTDELEEIKVDDITKKWEAYKDKIIP 573
           SFLNRYFPTDELEEIKVDDITKKWEAYKDKIIP
Sbjct: 541 SFLNRYFPTDELEEIKVDDITKKWEAYKDKIIP 573

>Scas_617.5
          Length = 581

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/581 (60%), Positives = 440/581 (75%), Gaps = 16/581 (2%)

Query: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60
           M    YYLGLDLSTQQLK LAI+  ++I  TE VDFD++LPHYNT KGVY +G+ +ECPV
Sbjct: 1   MSEPSYYLGLDLSTQQLKGLAINETLEIVVTETVDFDKELPHYNTTKGVYINGNDIECPV 60

Query: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHL-NDANGNLVD 119
           GMWLEA+DL+FEK+K  GF L+ V+AISGSCQQHGSVYW   A  LLK+L +D + +LV 
Sbjct: 61  GMWLEALDLLFEKFKKKGFSLNNVRAISGSCQQHGSVYWSQNANTLLKNLGSDTDKSLVS 120

Query: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179
            L PD FSR+TAPNWQDHSTG QC   E+K GGP+ LAEITGSRAHFRFTGPQIMKIAE 
Sbjct: 121 HLIPDAFSRQTAPNWQDHSTGSQCQSFERKVGGPQALAEITGSRAHFRFTGPQIMKIAEK 180

Query: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239
           E  NY NT ++SLVSSF+TS+LC +L P+EEAD+CGMN+YDI+ +++++ LL +I     
Sbjct: 181 EPGNYANTSSVSLVSSFITSLLCGELTPLEEADSCGMNLYDIRKRQFNEDLLSLIDSN-- 238

Query: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299
           ++++  KL     KC+ P  +G+I+ YFV KYGF+  C+I+P TGDNLATICSLPL+ ND
Sbjct: 239 EDNIRTKLMDPPLKCDKPVRLGSISKYFVQKYGFNPSCSIFPLTGDNLATICSLPLKTND 298

Query: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNEN- 358
           +LVSLGTSTTIL+VT+QY PSPNYHLF HP I + YM MICYCNG+LAREK+RD LNE  
Sbjct: 299 VLVSLGTSTTILLVTNQYQPSPNYHLFIHPTIPDHYMGMICYCNGALAREKIRDELNETG 358

Query: 359 QSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKYVDKFD 418
           +  SW  F+EAVLD+++D S EL +YFPLGEIVPSV AI KR  +D    EI   VD+F 
Sbjct: 359 EGNSWNLFNEAVLDDTIDNSDELGIYFPLGEIVPSVSAIYKRAKFDKATGEIKAIVDEFA 418

Query: 419 NNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSET------MVHFDYDSMKFSEYS 472
           N +HDAK IVESQALS R+R++PLLS    E N  K+E        V FDY  +  S+Y 
Sbjct: 419 NKKHDAKNIVESQALSCRIRISPLLS---KEGNSNKNEMTSNENGTVKFDYAEIPISDYL 475

Query: 473 SKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKK 532
           SKRPNR +FVGGASKNDAIVKKF++++GA+ GN+RLETPNSCALGGC+KA+WS L+   +
Sbjct: 476 SKRPNRAFFVGGASKNDAIVKKFAQIIGAQEGNYRLETPNSCALGGCYKAIWSQLYHLGE 535

Query: 533 IDEKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKIIP 573
             E  +FD +L+++FP  E+E I   D  K WE Y  KI+P
Sbjct: 536 TKE--SFDVYLDKHFPWGEVERICEPD-EKAWELYNKKIVP 573

>YGR194C (XKS1) [2144] chr7 complement(886076..887878) Xylulokinase,
           required for growth on D-xylulose [1803 bp, 600 aa]
          Length = 600

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/581 (58%), Positives = 427/581 (73%), Gaps = 14/581 (2%)

Query: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGDVVECPV 60
           M  + YYLG DLSTQQLKCLAI+ D++I H+E V+F++DLPHY+T KGVY HGD +ECPV
Sbjct: 17  MSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYHTKKGVYIHGDTIECPV 76

Query: 61  GMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLND-ANGNLVD 119
            MWLEA+DLV  KY+ A F L++V A+SGSCQQHGSVYW + A  LL+ LN     +L+ 
Sbjct: 77  AMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAESLLEQLNKKPEKDLLH 136

Query: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179
            +    F+R+TAPNWQDHST KQC + E+  GGPEK+A++TGSRAHFRFTGPQI+KIA+ 
Sbjct: 137 YVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSRAHFRFTGPQILKIAQL 196

Query: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239
           E + Y+ T+TISLVS+FLTSIL   LV +EEADACGMN+YDI+ +++ D LL +I     
Sbjct: 197 EPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRERKFSDELLHLIDSSSK 256

Query: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299
            + + +KL  +  K     + G I  YF+ KYGF++ C + P TGDNLATICSLPL KND
Sbjct: 257 DKTIRQKLMRAPMK---NLIAGTICKYFIEKYGFNTNCKVSPMTGDNLATICSLPLRKND 313

Query: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQ 359
           +LVSLGTSTT+L+VTD+YHPSPNYHLF HP + N YM MICYCNGSLARE++RD LN+ +
Sbjct: 314 VLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSLARERIRDELNKER 373

Query: 360 ------STSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEIVKY 413
                 +  WT F++AVLD+S  +  EL VYFPLGEIVPSV AI KRV+++PK   I + 
Sbjct: 374 ENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKRVIFNPKTGMIERE 433

Query: 414 VDKFDNNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSE-TMVHFDYDSMKFSEYS 472
           V KF + RHDAK IVESQALS RVR++PLLS +   S    +E T+V FDYD     +Y 
Sbjct: 434 VAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIVKFDYDESPLRDYL 493

Query: 473 SKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKK 532
           +KRP R +FVGGASKNDAIVKKF++V+GA  GNFRLETPNSCALGGC+KA+WS L+   K
Sbjct: 494 NKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGCYKAMWSLLYDSNK 553

Query: 533 IDEKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKIIP 573
           I   V FD FLN  FP   +E I  D   + W+ Y  KI+P
Sbjct: 554 I--AVPFDKFLNDNFPWHVMESIS-DVDNENWDRYNSKIVP 591

>Sklu_2014.3 YGR194C, Contig c2014 3590-5485 reverse complement
          Length = 631

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/571 (55%), Positives = 398/571 (69%), Gaps = 12/571 (2%)

Query: 5   GYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECPVGMW 63
           GY+LG DLSTQQLKCL +D  +Q+ H+EVVDFDRDLP Y+THKGVY + D  +E PV MW
Sbjct: 58  GYFLGFDLSTQQLKCLVVDQQLQLVHSEVVDFDRDLPEYHTHKGVYFNDDGSIEAPVAMW 117

Query: 64  LEAIDLVFEKYKGAG-FDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQLY 122
            +A+D +F        F L +V  ISGSCQQHGSVYW     + L++L DA   L+ QL 
Sbjct: 118 CDALDHLFAGLANQNVFSLDRVLGISGSCQQHGSVYWSKDGEEALRNL-DAQQTLLTQLA 176

Query: 123 PDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENEED 182
           P  FSR  APNWQDHSTG +C   E   GGP+ LA ITGSRAH+RFTGPQI K+A  E +
Sbjct: 177 PKAFSRSVAPNWQDHSTGNECKLFESSCGGPQGLAAITGSRAHYRFTGPQICKVAHREPE 236

Query: 183 NYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGKED 242
            Y NT  I+LVS+FL S+LC  + P+EEADACGMN+YDI  + YD  LL  I      E 
Sbjct: 237 VYANTANITLVSNFLASLLCGYIAPLEEADACGMNLYDIVNRDYDSGLLQNIDPDV--ES 294

Query: 243 LLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDILV 302
           + +KL GS T  ++   +  +++Y+V +YG + +C ++PFTGDNLATICSLPL+KND+LV
Sbjct: 295 IKRKLKGSPTPADNAGPLSCVSSYYVRRYGLNPQCQVFPFTGDNLATICSLPLKKNDVLV 354

Query: 303 SLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQSTS 362
           SLGTSTTIL+VTDQY+PSPNYHLF HP I   YM MICYCNGSLARE VRD L+ +   S
Sbjct: 355 SLGTSTTILIVTDQYYPSPNYHLFIHPTIPGLYMGMICYCNGSLARENVRDLLSADH--S 412

Query: 363 WTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYDPKNCEI-VKYVDKFDNNR 421
           W  F++A+LD S+D   E+ VYFPL EIVPSV + TKR  +   + +I ++ V++F + +
Sbjct: 413 WDPFNKALLDSSVDNHDEIGVYFPLSEIVPSVRSCTKRAKFTKSDNDINLEPVEQFSDIK 472

Query: 422 HDAKIIVESQALSARVRVAPLLS-GTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVY 480
           HD K IVESQALS RVR++PLLS      SN+  +   V FDYD+   SEY  KRP R +
Sbjct: 473 HDVKNIVESQALSCRVRISPLLSDNCAAASNNSSTSYTVKFDYDTFPISEY-RKRPRRAF 531

Query: 481 FVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFD 540
           FVGGAS+NDAIV+ F++V+GA  GN++LETPNSCALGGC+KALWS ++       K++FD
Sbjct: 532 FVGGASRNDAIVRTFAQVIGATEGNYKLETPNSCALGGCYKALWSYMYSGGFT--KLSFD 589

Query: 541 SFLNRYFPTDELEEIKVDDITKKWEAYKDKI 571
            FLN +F      E   D  T+ WE Y  KI
Sbjct: 590 LFLNEHFDWQHDAEFICDSETESWEYYNTKI 620

>Kwal_33.15438
          Length = 580

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/571 (55%), Positives = 401/571 (70%), Gaps = 15/571 (2%)

Query: 7   YLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECPVGMWLE 65
           YLG DLSTQQLKCL ID D+++ H+E ++FD+DL  Y T KGVY   D  VECPV MWLE
Sbjct: 9   YLGFDLSTQQLKCLVIDQDLKLLHSESIEFDKDLSSYKTEKGVYLRDDGTVECPVAMWLE 68

Query: 66  AIDLVFEKY-KGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVDQLYPD 124
           A+DLVF++  +    DL  V+A+SGSCQQHGSVYW      LL  L D   +L DQL+PD
Sbjct: 69  ALDLVFQRMSENKDVDLGSVRAMSGSCQQHGSVYWAEEGPKLLPTL-DFKQSLKDQLFPD 127

Query: 125 GFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAENEEDNY 184
            FSR  APNWQDHSTG +C Q E   GGP +LA +TGSRAH RFTGPQ+MKI++ E + Y
Sbjct: 128 AFSRSVAPNWQDHSTGSECQQFEDSVGGPVELARLTGSRAHHRFTGPQMMKISKKEPEVY 187

Query: 185 KNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFGKEDLL 244
           + T  ISLVSSFL S+L  +   +EEADACGMN+Y+I  + Y+D+LL  I        L 
Sbjct: 188 RKTAKISLVSSFLASVLAGEFTSLEEADACGMNLYNIDKRDYEDNLLRNIDDDLSG--LR 245

Query: 245 KKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDILVSL 304
           +KL G+   C+ P  +G+I++YFV KYG +++C ++PFTGDNLATICSL L+ ND+LVSL
Sbjct: 246 EKLGGAPINCDKPTPVGSISSYFVQKYGLNADCQVFPFTGDNLATICSLRLKPNDVLVSL 305

Query: 305 GTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQSTSWT 364
           GTSTTIL+VTDQYHPSPNYHLF HP I   YM MICYCNG+LAREK+RD L++  S  W 
Sbjct: 306 GTSTTILLVTDQYHPSPNYHLFIHPTIPKHYMGMICYCNGALAREKIRDQLSD--SHDWE 363

Query: 365 NFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYD-PKNCEIVKY--VDKFDNNR 421
            F+ AV   +++   E+A YFPLGEIVP+V ++ +R  ++  +  + VK   ++ F N  
Sbjct: 364 PFNAAVTSTTIENDNEIACYFPLGEIVPNVPSVCRRATFEKSETGDSVKLNILESFANVA 423

Query: 422 HDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEYSSKRPNRVYF 481
           HDA+ IVESQALS RVR++PLLS    ++N E  ++ V FDYD+   SEY  KRP R +F
Sbjct: 424 HDARNIVESQALSCRVRISPLLSSDCTDTNSEMGDSKVLFDYDNFPLSEY-RKRPRRAFF 482

Query: 482 VGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFDS 541
           VGGASKNDAIV  F++VLGA +GNFRLETPNSCALGGC++ALWS L     I     FD 
Sbjct: 483 VGGASKNDAIVNLFAQVLGATDGNFRLETPNSCALGGCYRALWSHLHYSNLISSP--FDQ 540

Query: 542 FLNRYFPTD-ELEEIKVDDITKKWEAYKDKI 571
           FLN  F  D +++ + + D  K W+ Y  KI
Sbjct: 541 FLNEAFRWDFDVQSLGLTD-EKDWKHYNTKI 570

>KLLA0E09746g 863295..865037 similar to sp|P42826 Saccharomyces
           cerevisiae YGR194c XKS1 xylulokinase singleton, start by
           similarity
          Length = 580

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/577 (55%), Positives = 404/577 (70%), Gaps = 16/577 (2%)

Query: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECP 59
           M   GYYLG DLSTQQLKCLAID  + I  T  ++FD+D PHYNT KGVY   + V++ P
Sbjct: 1   MSESGYYLGFDLSTQQLKCLAIDDQLNIVTTAAIEFDKDFPHYNTRKGVYIKDEGVIDAP 60

Query: 60  VGMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVD 119
           V MWLEAIDL FE+  G   DL +VK++SGSCQQHG+V+W     D L      + NLV 
Sbjct: 61  VAMWLEAIDLCFERL-GKCIDLKKVKSMSGSCQQHGTVFWNC---DHLPKDLQPSSNLVK 116

Query: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179
           QL    FSR  APNWQDHST KQC ++  K GGP++LA ITGS +H+RF+G QI K+ E 
Sbjct: 117 QL-ASCFSRDVAPNWQDHSTRKQCDELTDKVGGPQELARITGSSSHYRFSGSQIAKVHET 175

Query: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239
           E + Y NT+ ISLVSSFL S+L   +VP+EEADACGMN+Y I+   +++ LL V+     
Sbjct: 176 EPEVYANTKKISLVSSFLASVLVGDIVPLEEADACGMNLYGIEKHEFNEDLLSVVDEDIA 235

Query: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299
              + +KL    T  + P+ +G ++ YF  KYG + +C IYPFTGDNLATICSLPL+KND
Sbjct: 236 S--IKRKLFDPPTSSDEPKSLGPVSTYFQEKYGVNPDCQIYPFTGDNLATICSLPLQKND 293

Query: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLN-EN 358
           +L+SLGTSTTIL++TDQYH SPNYHLF HP + N YM MICYCNGSLAREK+RD +N E+
Sbjct: 294 VLISLGTSTTILLITDQYHSSPNYHLFIHPTVPNHYMGMICYCNGSLAREKIRDDINGES 353

Query: 359 QSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVLYD-PKNCEIVKYVDKF 417
           Q+  WT F+EA+LD SL    E+ +YFPLGEIVP++DA+TKR  +    N  ++  V+ F
Sbjct: 354 QTHDWTKFNEALLDNSLSNDNEIGLYFPLGEIVPNMDAVTKRCYFKYIDNKVVLTNVNMF 413

Query: 418 DNNRHDAKIIVESQALSARVRVAPLLS---GTVDESNDEKSETMVHFDYDSMKFSEYSSK 474
            + R DAK IVESQALS RVR++PLLS     ++E+   KSE  V FDYD    + Y +K
Sbjct: 414 PDKRLDAKNIVESQALSCRVRISPLLSEEANAINETQVLKSELKVKFDYDFFPLASY-AK 472

Query: 475 RPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKID 534
           RPNR +FVGGASKN+AI+K  + V+GAKNGN+RLET NSCALGGC+KALWS L  K++  
Sbjct: 473 RPNRAFFVGGASKNEAIIKTMANVIGAKNGNYRLETANSCALGGCYKALWSLL--KEQNP 530

Query: 535 EKVTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKI 571
           E  +FD +LN +F  +   E   +    KWE Y +KI
Sbjct: 531 ETPSFDRWLNAFFNWERDCEFVCNSDAAKWENYNNKI 567

>AGR324C [4635] [Homologous to ScYGR194C (XKS1) - SH]
           (1335916..1337610) [1695 bp, 564 aa]
          Length = 564

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/575 (53%), Positives = 385/575 (66%), Gaps = 25/575 (4%)

Query: 1   MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYNTHKGVYSHGD-VVECP 59
           M     YLG DLSTQQLKCLAID D+ IK T VVDFDRDL  Y T KGVY+  D VVE P
Sbjct: 1   MAESKLYLGFDLSTQQLKCLAIDEDLAIKCTAVVDFDRDLAGYETVKGVYTREDNVVESP 60

Query: 60  VGMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTGAGDLLKHLNDANGNLVD 119
           V MWLEA+DL FE+      DL  V+AISGSCQQH SVYW       ++ L+  +G L  
Sbjct: 61  VEMWLEALDLCFERL-AREVDLGAVEAISGSCQQHASVYWTEDVKTRIRELDSRSG-LRA 118

Query: 120 QLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFTGPQIMKIAEN 179
           QL P   SR  APNWQDHST  Q  Q E   GGP++LA++TGS+AHFRFTG QI KI + 
Sbjct: 119 QLGP-CLSRANAPNWQDHSTEAQREQFEAHCGGPQELAQLTGSKAHFRFTGLQIKKIRDT 177

Query: 180 EEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNIYDIKAKRYDDSLLDVISGKFG 239
           E      T +ISL SSFL S+L  KLVP EEADACGM +Y+I   RY + LL ++     
Sbjct: 178 EPATLTATPSISLASSFLASVLVGKLVPPEEADACGMILYNIAQHRYVEGLLQMVD---- 233

Query: 240 KEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKND 299
            + L  KL G+  +C++ + +G ++ YF  KYG ++ C IY  TGDNLATICSLPL+KND
Sbjct: 234 -DALFDKLCGNPVRCDNVRPLGTVSRYFKEKYGINTSCNIYQLTGDNLATICSLPLQKND 292

Query: 300 ILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNENQ 359
           +LVSLGTSTT+L VT++Y PSPNYH+F HP I   YM M+CYCNG+LARE+++D+L +  
Sbjct: 293 LLVSLGTSTTVLAVTEKYSPSPNYHMFIHPTIPGNYMGMVCYCNGALARERIKDTLGDE- 351

Query: 360 STSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVD-AITKRVLYDPKNCEIVKYVDKFD 418
            + W  F +A+ D+S+DTS EL VYFPL EIVPSVD  + KRV   PK    ++ V+ F 
Sbjct: 352 -SGWAAFSKALEDDSVDTSAELGVYFPLPEIVPSVDHPLVKRVRISPKG---LQEVESFA 407

Query: 419 NNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVH--FDYDSMKFSEYSSKRP 476
           +  HDAK IVESQALS RVRVAPLLS     +  E S+T  H  FD      +E+ ++RP
Sbjct: 408 SPAHDAKNIVESQALSCRVRVAPLLS-----TPPEISDTGGHAAFDGQQRDVAEF-TRRP 461

Query: 477 NRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEK 536
           NRV+FVGGASKNDAIV+    +LGAK GN+RLET NSCALGGC+KA WSDL  K+K +  
Sbjct: 462 NRVFFVGGASKNDAIVRAMPNILGAKGGNYRLETSNSCALGGCYKAFWSDLLYKQKTN-- 519

Query: 537 VTFDSFLNRYFPTDELEEIKVDDITKKWEAYKDKI 571
            +F  +L+  F  D   ++      +KW A   KI
Sbjct: 520 ASFADWLDSVFKWDRDCKMLCKTDNRKWAASLGKI 554

>KLLA0B03806g 343108..344259 similar to sp|P38698 Saccharomyces
           cerevisiae YHR201c PPX1 exopolyphosphatase singleton,
           start by similarity
          Length = 383

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 51/128 (39%), Gaps = 11/128 (8%)

Query: 431 QALSARVRVAPLLSGTVDESNDEKSETMVHFDYDSMKFSEY-----SSKRPNRVYFVGGA 485
           QA +A   V PLL G +    D+    + H   D++   EY      S   NR+Y     
Sbjct: 182 QACAAIKDVVPLLLGALLIDTDDMKHKVEHI--DTVALEEYKKLSQESVDTNRLYQKLRE 239

Query: 486 SKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKALWSDLWKKKKIDEKVTFDSFLNR 545
           +K+D     F ++L      F       C +    K++    W +++ D K   +S   +
Sbjct: 240 AKDDINGLYFHDILRKDYKEFNFNPETRCGIASVVKSIQ---WIERRFD-KANIESTCTK 295

Query: 546 YFPTDELE 553
           Y   + L+
Sbjct: 296 YIEENSLD 303

>KLLA0D10285g 869754..871301 similar to sp|Q04489 Saccharomyces
           cerevisiae YML096w singleton, start by similarity
          Length = 515

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 65/164 (39%), Gaps = 36/164 (21%)

Query: 245 KKLSGSVTKCNSPQLMGNIANYFVSKYGFDSECAIYPFTGDNLATICSLPLEKNDIL--- 301
           K L+G +  CNS  L   +  Y V +             G N A++ SL  E N +L   
Sbjct: 26  KDLTGPIQSCNSNTLFNELIPYIVRR-------------GPNYASLRSLS-EINAMLFSS 71

Query: 302 -VSLGTSTT--ILMVTDQYHPSPNYHLFTHPAIANCYMAMICYCNGSLAREKVRDSLNEN 358
            +SL T  T   +MV D+Y    N  L+    + NC  +   Y +  L +  V + + + 
Sbjct: 72  VLSLRTPFTKQSVMVQDRYLLQYNGELYNDDTVENCEHSDTEYISSLLEKHSVEEVVRK- 130

Query: 359 QSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVPSVDAITKRVL 402
               +  F  A+ D       E  VYF         D+I KR L
Sbjct: 131 ---CYGEFAYAITDLQ-----ERKVYF-------GRDSIGKRSL 159

>CAGL0L08228g 907157..908158 similar to sp|P25332 Saccharomyces
           cerevisiae YCR036w RBK1 ribokinase, start by similarity
          Length = 333

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 111 NDANG-NLVDQLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEITGSRAHFRFT 169
           NDA G  L+D L  DG         +  STG     +E+K GG  ++  + G+    +++
Sbjct: 67  NDAFGAQLLDTLRRDGVDVDQVKVLEGVSTGTATILVEEKLGGQNRILIVKGANGESKYS 126

Query: 170 GPQIMKI-AENEEDNY 184
             Q+  +  E +E  Y
Sbjct: 127 SQQLKDMFKETKEKEY 142

>CAGL0E03916g 371185..373203 similar to sp|P32190 Saccharomyces
           cerevisiae YHL032c GUT1 glycerol kinase, hypothetical
           start
          Length = 672

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 55/136 (40%), Gaps = 16/136 (11%)

Query: 403 YDPKNCEIVKYVDKFDNNRHDAKIIVESQALSARVRVAPLLSGTVDESNDEKSETMVHFD 462
           +DP+    +  + ++    H A+  VE+    AR  +  + +  + E+  EK  T   F 
Sbjct: 475 WDPEARGTIMGMSQYTTASHIARAAVEAVCFQARAILLAMSNDAMGEA--EKDST---FK 529

Query: 463 YDSMKFSEYSSKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRLETPNSCALGGCFKA 522
            +  +   Y     + +   GG S++D +++  +++LG      R  T    ALG    A
Sbjct: 530 TEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRRSPTAECTALGAAVAA 589

Query: 523 -----------LWSDL 527
                      LW DL
Sbjct: 590 NMAYERPQDRVLWRDL 605

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,865,616
Number of extensions: 965834
Number of successful extensions: 2739
Number of sequences better than 10.0: 17
Number of HSP's gapped: 2754
Number of HSP's successfully gapped: 17
Length of query: 573
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 466
Effective length of database: 12,891,983
Effective search space: 6007664078
Effective search space used: 6007664078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)