Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09317g24624212721e-180
Scas_647.724624211661e-164
YGR195W (SKI6)24624211411e-160
Kwal_33.1545324524210941e-153
Sklu_1267.227324210841e-151
KLLA0D09625g24524210281e-143
ACR035W2462429991e-139
Sklu_1989.12232131262e-08
YGR095C (RRP46)2231401244e-08
Scas_716.302281361201e-07
KLLA0D14993g2251481192e-07
KLLA0F18304g2361401183e-07
CAGL0G03113g2331381103e-06
Kwal_23.39692242211086e-06
Sklu_1879.12381451061e-05
AFR109W2371401024e-05
Scas_621.17239129981e-04
AAR035C25297651.8
CAGL0E03223g248147652.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09317g
         (242 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09317g complement(890158..890898) highly similar to sp|P46...   494   e-180
Scas_647.7                                                            453   e-164
YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the exo...   444   e-160
Kwal_33.15453                                                         426   e-153
Sklu_1267.2 YGR195W, Contig c1267 529-1350                            422   e-151
KLLA0D09625g complement(813773..814510) highly similar to sp|P46...   400   e-143
ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH] complement(...   389   e-139
Sklu_1989.1 YGR095C, Contig c1989 348-1019                             53   2e-08
YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein c...    52   4e-08
Scas_716.30                                                            51   1e-07
KLLA0D14993g complement(1266752..1267429) similar to sp|P53256 S...    50   2e-07
KLLA0F18304g complement(1689187..1689897) similar to sp|P48240 S...    50   3e-07
CAGL0G03113g complement(289747..290448) similar to sp|P53256 Sac...    47   3e-06
Kwal_23.3969                                                           46   6e-06
Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement          45   1e-05
AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH] complement(...    44   4e-05
Scas_621.17                                                            42   1e-04
AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH] (406091..40...    30   1.8  
CAGL0E03223g complement(297800..298546) similar to sp|P48240 Sac...    30   2.0  

>CAGL0G09317g complement(890158..890898) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3-5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA, start by similarity
          Length = 246

 Score =  494 bits (1272), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT
Sbjct: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT
Sbjct: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
           LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN
Sbjct: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV
Sbjct: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>Scas_647.7
          Length = 246

 Score =  453 bits (1166), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 210/242 (86%), Positives = 236/242 (97%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSR+EIYSPEGLRLDGRRWNELRRFE +INTH HA+DGSSYLEQGNNKVITLVKGPKEPT
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFECSINTHSHASDGSSYLEQGNNKVITLVKGPKEPT 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           L+SQMD +KAILK++VNIT+FSKFERSKSSHKNERRVLEMQTAL+RTFEKNVML++YPRT
Sbjct: 61  LRSQMDTEKAILKISVNITQFSKFERSKSSHKNERRVLEMQTALIRTFEKNVMLNIYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
           LIDIE+HVLQQDGGIMG+L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NSLEEN
Sbjct: 121 LIDIEVHVLQQDGGIMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDVNSLEEN 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS+VTLGVVGKSEKLSLL +EDKIPLDR+E VLAIGIAGAHR+RDLM++E+R HAEKRV
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLETVLAIGIAGAHRVRDLMDEELRKHAEKRV 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>YGR195W (SKI6) [2145] chr7 (888885..889625) Component of the
           exosome 3'-5' exoribonuclease complex involved in 3'
           processing of ribosomal 5.8S rRNA, of snoRNAs and of U4
           snRNA, and in degradation of poly(A)- mRNAs, confers
           antiviral activity by repressing replication of
           double-stranded RNA viruses [741 bp, 246 aa]
          Length = 246

 Score =  444 bits (1141), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 207/242 (85%), Positives = 233/242 (96%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSR+EIYSPEGLRLDGRRWNELRRFES+INTHPHAADGSSY+EQGNNK+ITLVKGPKEP 
Sbjct: 1   MSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPR 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           LKSQMD  KA+L V+VNITKFSKFERSKSSHKNERRVLE+QT+LVR FEKNVML++YPRT
Sbjct: 61  LKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
           +IDIEIHVL+QDGGIMG+L+NGI+LALIDAGI+M+DY+SGISVGLYDTTPLLD NSLEEN
Sbjct: 121 VIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEEN 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS VTLGVVGKSEKLSLL +EDKIPLDR+ENVLAIGIAGAHR+RDLM++E+R HA+KRV
Sbjct: 181 AMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRV 240

Query: 241 AN 242
           +N
Sbjct: 241 SN 242

>Kwal_33.15453
          Length = 245

 Score =  426 bits (1094), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 228/242 (94%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSR+EIYSPEGLR+DGRRWNELRR E AINTH +A+DGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 1   MSRLEIYSPEGLRVDGRRWNELRRLECAINTHANASDGSSYLEQGNNKIITLVNGPQEPK 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           L+SQM++ +A L V VNIT+FSK ERSKSSHKNERRVLEMQTALVRTFEKNVMLH+YPRT
Sbjct: 61  LRSQMNVNQATLSVAVNITRFSKIERSKSSHKNERRVLEMQTALVRTFEKNVMLHLYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
            IDI+IHVLQQDGG+MG+L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NS+EEN
Sbjct: 121 QIDIQIHVLQQDGGLMGSLINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSVEEN 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS+VTLGVVGKSEKLSLL +EDKIPLDR+E+VLAIGIAG+HRIR+LM+QE+R H EKR+
Sbjct: 181 AMSSVTLGVVGKSEKLSLLLVEDKIPLDRLESVLAIGIAGSHRIRELMDQELRKHGEKRL 240

Query: 241 AN 242
           AN
Sbjct: 241 AN 242

>Sklu_1267.2 YGR195W, Contig c1267 529-1350
          Length = 273

 Score =  422 bits (1084), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 197/242 (81%), Positives = 224/242 (92%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSR+EIYSPEGLRLDGRRWNELRRF+ +INTHP+AADGSSYLEQGNNK+ITLV GP+EP 
Sbjct: 28  MSRLEIYSPEGLRLDGRRWNELRRFDCSINTHPNAADGSSYLEQGNNKIITLVNGPQEPA 87

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           L+SQ +   A + VTVNITKFSK ERSKSSHKNERRVLEMQT+LVRTFEKNVML +YPRT
Sbjct: 88  LRSQTNPSHATMNVTVNITKFSKMERSKSSHKNERRVLEMQTSLVRTFEKNVMLQLYPRT 147

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
           LIDI+IHVLQQDGGIMG L+NGI+LALIDAGIAMYDY+SG+S+GLYDTTPLLD+NSLEEN
Sbjct: 148 LIDIQIHVLQQDGGIMGALINGITLALIDAGIAMYDYISGVSIGLYDTTPLLDLNSLEEN 207

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS++TLGVVGKSEKLSLL +EDK+PLDR E+VLAIGIAGAH IRDLM++E+R H EKR+
Sbjct: 208 AMSSITLGVVGKSEKLSLLLVEDKVPLDRFESVLAIGIAGAHIIRDLMDKELRRHGEKRL 267

Query: 241 AN 242
            N
Sbjct: 268 TN 269

>KLLA0D09625g complement(813773..814510) highly similar to sp|P46948
           Saccharomyces cerevisiae YGR195w SKI6 3 -5
           exoribonuclease required for 3 end formation of 5.8S
           rRNA singleton, start by similarity
          Length = 245

 Score =  400 bits (1028), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 180/242 (74%), Positives = 218/242 (90%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           MSR EIYSPEGLR+DGRRWNELR F  +INTHP+AADGSSYLEQGNNK+ITLV GP+EP+
Sbjct: 1   MSRFEIYSPEGLRVDGRRWNELRSFNCSINTHPNAADGSSYLEQGNNKIITLVAGPQEPS 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
            +SQ++ ++A L VT+N+TKF+K ERSKSSHKNERR LE Q +LVRTFEKN+MLH+YPRT
Sbjct: 61  SRSQVNTKQATLSVTINLTKFAKMERSKSSHKNERRTLEWQASLVRTFEKNLMLHLYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
            ID+++H LQ DGGI+G +LNGI+LALIDAGIAMYD+VSG+SVGLYDTTPLLD+NSLEEN
Sbjct: 121 SIDVQVHALQLDGGILGAMLNGITLALIDAGIAMYDFVSGVSVGLYDTTPLLDLNSLEEN 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS+VT+G +GKSEKLSLL +EDK+PLDR+E+V+AIGIAG HRIRDLM++E+R H + RV
Sbjct: 181 AMSSVTIGTIGKSEKLSLLMVEDKVPLDRLESVMAIGIAGTHRIRDLMDKELRKHGKTRV 240

Query: 241 AN 242
            N
Sbjct: 241 EN 242

>ACR035W [1083] [Homologous to ScYGR195W (SKI6) - SH]
           complement(422233..422973) [741 bp, 246 aa]
          Length = 246

 Score =  389 bits (999), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 177/242 (73%), Positives = 214/242 (88%)

Query: 1   MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQGNNKVITLVKGPKEPT 60
           M + EIYSPEGLRLDGRRWNELRRFE +INTHP AADGSSYLEQGNNK+ITLV GP EP 
Sbjct: 1   MFKTEIYSPEGLRLDGRRWNELRRFECSINTHPTAADGSSYLEQGNNKLITLVTGPHEPA 60

Query: 61  LKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRT 120
           L+SQ++  KA L VTVN+TKF+  ERSK+ HKNERR+LEMQTALVRTFEKNVML +YPRT
Sbjct: 61  LRSQVNPSKATLTVTVNMTKFAAAERSKTGHKNERRILEMQTALVRTFEKNVMLQLYPRT 120

Query: 121 LIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSGISVGLYDTTPLLDINSLEEN 180
            ID+++HVLQ DGG++G+++NGI+LALIDAGIAMY+Y+SGISVGLYDTTPLLD+N LEE 
Sbjct: 121 AIDVQVHVLQNDGGVLGSMINGITLALIDAGIAMYEYISGISVGLYDTTPLLDLNRLEEQ 180

Query: 181 AMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRV 240
           AMS  TLGVVGKSEKLSLL +EDK+PLDR+E+V+++GIAG HR+RD+M++ +R H + R+
Sbjct: 181 AMSCFTLGVVGKSEKLSLLLVEDKVPLDRLESVMSLGIAGTHRVRDMMDKVLRQHGKIRL 240

Query: 241 AN 242
            N
Sbjct: 241 EN 242

>Sklu_1989.1 YGR095C, Contig c1989 348-1019
          Length = 223

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 92/213 (43%), Gaps = 30/213 (14%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGSS +E    KVI  V GP EP  + ++  Q A L++ V  +K     R K      R 
Sbjct: 13  DGSSQVECSATKVICSVTGPVEPKARQELPTQLA-LEIVVRPSKGVPNTREKLMEDKIRG 71

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVL-------QQDGGIMGTLLNGISLALID 149
           VL     LVR        ++YPR L  +   VL       Q     +G  +N   LAL+D
Sbjct: 72  VLT--PVLVR--------YLYPRQLCQLTFQVLESGESEEQYTVKELGCCINAAYLALVD 121

Query: 150 AGIAMYDYVSGISVGLYDTTPLLDINSLEENAMSAVTLGVVGKSEKLSLLQIEDKIPLDR 209
           AGIA+    S +SV +     +L+ N +  N     T   + +S    L+ +E      +
Sbjct: 122 AGIALKS--SFVSVPIC----ILEQNKIVTNP----TAHQLAQSVSTHLISMEVGSGGTQ 171

Query: 210 IENVLAIGIAGAHRIRDLMEQEIRAHAEKRVAN 242
           +ENVL +   G  +   L   ++ A  EK   N
Sbjct: 172 VENVLLVDSNGDFQENQLF--DVLAEGEKECIN 202

>YGR095C (RRP46) [2055] chr7 complement(675673..676344) Protein
           component of the exosome 3'-5' exoribonuclease complex
           involved in 3'end processing of multiple small RNA
           species [672 bp, 223 aa]
          Length = 223

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 60/140 (42%), Gaps = 18/140 (12%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGSS     + KVI  V GP EP  + ++  Q A L++ V   K     R K      R 
Sbjct: 14  DGSSEFVSQDTKVICSVTGPIEPKARQELPTQLA-LEIIVRPAKGVATTREKVLEDKLRA 72

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQ--QDGG-----IMGTLLNGISLALID 149
           VL   T L+         H YPR L  I   +L+  +D        +   +N   LAL+D
Sbjct: 73  VL---TPLITR-------HCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVD 122

Query: 150 AGIAMYDYVSGISVGLYDTT 169
           AGIA+    + I + +   T
Sbjct: 123 AGIALNSMCASIPIAIIKDT 142

>Scas_716.30
          Length = 228

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 60/136 (44%), Gaps = 18/136 (13%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGSS +E    K+I  V GP EP  + ++  Q A L++ +         R  +   N R 
Sbjct: 14  DGSSLIESKQTKIICSVTGPIEPKSRQELPTQLA-LEIII---------RPAAGVPNTRE 63

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDGG-------IMGTLLNGISLALID 149
            L M+  L       +  ++YPR L  I + +L             + T +N   +ALID
Sbjct: 64  KL-MEDKLRAVITPIITRYLYPRQLCQITLQILNSGESELEFAQRELATCINATLIALID 122

Query: 150 AGIAMYDYVSGISVGL 165
           AGIA+    + + + L
Sbjct: 123 AGIALNSMCACVPIAL 138

>KLLA0D14993g complement(1266752..1267429) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing singleton, hypothetical start
          Length = 225

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 66/148 (44%), Gaps = 17/148 (11%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGSS +     KVI  V GP EP  + ++  Q A L++ V   +  +  R K      R 
Sbjct: 12  DGSSVVSNSGTKVICSVSGPMEPKSRQELPTQLA-LEIIVKPAEGVQSTREKLMEDQIRS 70

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQ----QDGGI--MGTLLNGISLALIDA 150
           VL     L R        +++PR  + I + VL+    +D  +  +   +N   LAL+DA
Sbjct: 71  VL--TPVLAR--------YLHPRQFVQICLQVLEAGESRDYTVKEVSVCVNAAVLALVDA 120

Query: 151 GIAMYDYVSGISVGLYDTTPLLDINSLE 178
           G+ +    SG  +G+      L +N  E
Sbjct: 121 GVPLLSMCSGTCIGITTEGKQLVVNPTE 148

>KLLA0F18304g complement(1689187..1689897) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport singleton, start by similarity
          Length = 236

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 65/140 (46%), Gaps = 26/140 (18%)

Query: 36  ADGSSYLEQGNNK-----VITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSS 90
           A+GSSYLE  +       V++ V GP+      Q        K +V+I    +F+     
Sbjct: 55  ANGSSYLEYMDGTSDQVLVMSSVFGPRPLRGSFQS-------KASVSI----QFKEVTLE 103

Query: 91  HKNERRVLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDGG----------IMGTLL 140
           H N   + E+ T L   F   + +  YP++ IDI I ++Q              I+ T +
Sbjct: 104 HLNTGEIKEICTFLTNVFNAVINVEKYPKSGIDIFIDLIQHSNSNPTEEANIVNILPTCI 163

Query: 141 NGISLALIDAGIAMYDYVSG 160
           N I++AL+DAGI + D VS 
Sbjct: 164 NSITMALVDAGIEIIDLVSA 183

>CAGL0G03113g complement(289747..290448) similar to sp|P53256
           Saccharomyces cerevisiae YGR095c RRP46 involved in rRNA
           processing, hypothetical start
          Length = 233

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGS+ L   +  V+  V GP EP  + ++  + A L+V V   K     R K      R 
Sbjct: 16  DGSAKLLMNSTNVLCAVTGPVEPKARQELPTEMA-LEVIVRPAKGVPTPREKYLEDKIRA 74

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQ-------QDGGIMGTLLNGISLALID 149
           +          F   +  H YPR L  I   +++        +   +   +N   LAL++
Sbjct: 75  I----------FTPLITRHKYPRQLCQITCQIMEAGENEQLHNQKELSACVNSALLALVN 124

Query: 150 AGIAMYDYVSGISVGLYD 167
           AG+A+ D  + +++ + D
Sbjct: 125 AGVALNDLAAAVTIAVID 142

>Kwal_23.3969
          Length = 224

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 95/221 (42%), Gaps = 30/221 (13%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGS  ++ G   V+  V GP EP  + ++  Q A L++ V   K     R K      R 
Sbjct: 13  DGSCKIQCGETSVLCSVTGPIEPKARQELPSQLA-LEIVVRPCKGVPNTREKLLEDQIRG 71

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQ---DGGI----MGTLLNGISLALID 149
           VL     L R        ++YPR L  I   +L+    D       + + +N   LALID
Sbjct: 72  VL--TPILAR--------YLYPRQLCQICFQILESGEPDESYSVKELNSCINAAYLALID 121

Query: 150 AGIAMYDYVSGISVGLYDTTPLLDINSLEENAMSAVTLGVVG--------KSEKLSLLQI 201
           +GI +    + + + +      + IN   +  + + +  ++         K++K+ L++ 
Sbjct: 122 SGIGLQSSFASVCLSVNGPNNEICINPASDQLIRSTSSHLLALEMGPGSKKTQKVLLIES 181

Query: 202 EDKIPLDRIENVLAIGIAGAHRIRDLMEQEIRAHAEKRVAN 242
                  ++ +VL+ G     ++     QE+R+  E++++N
Sbjct: 182 HGAFTEQQLLDVLSKGEEACLQVA----QELRSAVERKISN 218

>Sklu_1879.1 YGR158C, Contig c1879 329-1045 reverse complement
          Length = 238

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 67/145 (46%), Gaps = 35/145 (24%)

Query: 36  ADGSSYLE-------QGNNKVITLVKGPK----EPTLKSQMDIQKAILKVTVNITKFSKF 84
           ++GSSYLE       Q +  +IT V GP+      T ++ + IQ       V + KF+  
Sbjct: 51  SNGSSYLEVTDENKTQYHALLITSVYGPRPIRGSFTSRASLTIQFK----EVTLEKFTTG 106

Query: 85  ERSKSSHKNERRVLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQD---------GGI 135
           E           + E+   L   F   V L  YP++ IDI ++++Q             +
Sbjct: 107 E-----------IKEVCNFLTNIFNAVVNLERYPKSGIDIFLNLIQHSSTDNQETDIASV 155

Query: 136 MGTLLNGISLALIDAGIAMYDYVSG 160
           + T +NGI+LAL +AGI + D VS 
Sbjct: 156 IPTCINGITLALTNAGIEILDMVSA 180

>AFR109W [3301] [Homologous to ScYGR158C (MTR3) - SH]
           complement(632965..633678) [714 bp, 237 aa]
          Length = 237

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 29/140 (20%)

Query: 36  ADGSSYLE----QGNNKVITLVKGPK--EPTLKSQMDIQKAILKVTVNITKFSKFERSKS 89
           A+GSSYLE      N  ++T   GP+    +  S+  I     +VT+        ER  S
Sbjct: 54  ANGSSYLEVKAETHNTLLVTTAYGPRPIRGSFTSRAAISVHFKEVTL--------ERWDS 105

Query: 90  SHKNERRVLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQD----------GGIMGTL 139
                  V EM   L   F   + +  YP++ IDI ++++Q              ++   
Sbjct: 106 GE-----VTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDC 160

Query: 140 LNGISLALIDAGIAMYDYVS 159
           ++GI+LAL+DAGI + D V+
Sbjct: 161 ISGITLALMDAGIELKDVVA 180

>Scas_621.17
          Length = 239

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 36  ADGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNER 95
            +GS+ +E     ++T V GPK  +++     Q  I   T+ + K    E  +++     
Sbjct: 56  CNGSTLIESSKFSLLTSVYGPK--SIRGSFTSQGTI---TIQL-KNGVVENYQTTE---- 105

Query: 96  RVLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDGG----IMGTLLNGISLALIDAG 151
            + E+ + LV  F   V L  YP++ IDI ++++    G    ++  L+ GI LAL+D G
Sbjct: 106 -LKEVSSWLVGIFNSVVNLENYPKSGIDIFVNLIIDKQGDISKLIPFLIMGICLALVDGG 164

Query: 152 IAMYDYVSG 160
           I + D V+G
Sbjct: 165 IEIIDIVTG 173

>AAR035C [221] [Homologous to ScYGR095C (RRP46) - SH]
           (406091..406849) [759 bp, 252 aa]
          Length = 252

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 38/97 (39%), Gaps = 11/97 (11%)

Query: 37  DGSSYLEQGNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERR 96
           DGSS         I  V GP EP  + ++  Q   L V V         R K     E +
Sbjct: 48  DGSSKFSTAAASAICGVSGPIEPKARQEIP-QHLALDVIVRPAAGPPTTREK---LLEDK 103

Query: 97  VLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDG 133
           V    T +V TF       ++PR L  I + VL+  G
Sbjct: 104 VRATITPVVETF-------LHPRQLCQITLQVLKSVG 133

>CAGL0E03223g complement(297800..298546) similar to sp|P48240
           Saccharomyces cerevisiae YGR158c MTR3 involved in mRNA
           transport, start by similarity
          Length = 248

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 37/147 (25%)

Query: 36  ADGSSYLEQGNNKV-------ITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSK 88
            +GS+ +E  + K+       IT V GPK  +++     Q A L + +      K+E   
Sbjct: 51  CNGSALVEIKDTKITHHQTSLITSVYGPK--SVRGSFTSQ-ASLSIQLKNGLLEKYE--- 104

Query: 89  SSHKNERRVLEMQTALVRTFEKNVMLHVYPRTLIDIEIHVLQQDG--------------- 133
                 R + E+   L   F   + L  YP++ IDI I++  +                 
Sbjct: 105 -----SRELKEVANFLTSIFNSVINLKRYPKSGIDIFIYITYEKSLENFKEQEPAAPVRK 159

Query: 134 ----GIMGTLLNGISLALIDAGIAMYD 156
                I+   ++ I++ALIDA I + D
Sbjct: 160 SNIYKILPHCISSITMALIDADIEIID 186

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,143,051
Number of extensions: 285315
Number of successful extensions: 909
Number of sequences better than 10.0: 28
Number of HSP's gapped: 896
Number of HSP's successfully gapped: 28
Length of query: 242
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 143
Effective length of database: 13,168,927
Effective search space: 1883156561
Effective search space used: 1883156561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)