Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09295g76775535110.0
Scas_617.47914567938e-94
YGR196C (FYV8)8174417825e-92
Kwal_33.154559143705812e-63
KLLA0D09603g8203735201e-55
ACR036C7543043132e-29
CAGL0H09240g642101770.46
Scas_681.3044139684.6
Scas_645.3708194677.4
CAGL0A01045g48383667.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09295g
         (755 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces c...  1357   0.0  
Scas_617.4                                                            310   8e-94
YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of...   305   5e-92
Kwal_33.15455                                                         228   2e-63
KLLA0D09603g 811234..813696 weakly similar to sp|P46949 Saccharo...   204   1e-55
ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH] (423030..42...   125   2e-29
CAGL0H09240g complement(905670..907598) some similarities with s...    34   0.46 
Scas_681.30                                                            31   4.6  
Scas_645.3                                                             30   7.4  
CAGL0A01045g complement(104865..106316) highly similar to sp|P08...    30   7.8  

>CAGL0G09295g 887666..889969 similar to sp|P46949 Saccharomyces
           cerevisiae YGR196c, start by similarity
          Length = 767

 Score = 1357 bits (3511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/755 (89%), Positives = 679/755 (89%)

Query: 1   MDESQVERKKSYRWVSASQATYDGAGWDXXXXXXXXXXXQPKLGKLDESLPSLPKLNYDN 60
           MDESQVERKKSYRWVSASQATYDGAGWD           QPKLGKLDESLPSLPKLNYDN
Sbjct: 1   MDESQVERKKSYRWVSASQATYDGAGWDSSSESETETRSQPKLGKLDESLPSLPKLNYDN 60

Query: 61  TDVSQYKXXXXXXXXXXXXKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDKDTLL 120
           TDVSQYK            KAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDKDTLL
Sbjct: 61  TDVSQYKEEDDEDTDNRTEKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDKDTLL 120

Query: 121 TSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQEAVFGNHSP 180
           TSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQEAVFGNHSP
Sbjct: 121 TSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQEAVFGNHSP 180

Query: 181 RKDIDSDLPNGKEDQKLNGSRLGLLNESIDNESDMPSVDETRSKDVDENGXXXXXXXXXX 240
           RKDIDSDLPNGKEDQKLNGSRLGLLNESIDNESDMPSVDETRSKDVDENG          
Sbjct: 181 RKDIDSDLPNGKEDQKLNGSRLGLLNESIDNESDMPSVDETRSKDVDENGEKDREDRFDY 240

Query: 241 XXXXXXXXXXXXXXQAQKASLEELQSEFDSDPQTSNIAKSLEGMNLEHDAEEESVKTNRD 300
                         QAQKASLEELQSEFDSDPQTSNIAKSLEGMNLEHDAEEESVKTNRD
Sbjct: 241 YDDDSEFSIDSEIKQAQKASLEELQSEFDSDPQTSNIAKSLEGMNLEHDAEEESVKTNRD 300

Query: 301 SNVSDLQKDQRXXXXXXXXXXXXXXLELPLTESSSDELESADHGDALSFTESIQYDQSDG 360
           SNVSDLQKDQR              LELPLTESSSDELESADHGDALSFTESIQYDQSDG
Sbjct: 301 SNVSDLQKDQREINESNIENSDNDSLELPLTESSSDELESADHGDALSFTESIQYDQSDG 360

Query: 361 DSEPNQGDDASLVSNRVQQNNVNTDAESADDIAKDKMDDHASGMDFEEDEVLNSTLTDGD 420
           DSEPNQGDDASLVSNRVQQNNVNTDAESADDIAKDKMDDHASGMDFEEDEVLNSTLTDGD
Sbjct: 361 DSEPNQGDDASLVSNRVQQNNVNTDAESADDIAKDKMDDHASGMDFEEDEVLNSTLTDGD 420

Query: 421 VHVHKSGYFKKLVAEELGDKKLDDGKSLNNVASTQTASTEDKVASDTEDVQESKADNDDT 480
           VHVHKSGYFKKLVAEELGDKKLDDGKSLNNVASTQTASTEDKVASDTEDVQESKADNDDT
Sbjct: 421 VHVHKSGYFKKLVAEELGDKKLDDGKSLNNVASTQTASTEDKVASDTEDVQESKADNDDT 480

Query: 481 KNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGFVRDEKGELVDLTPASMKPR 540
           KNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGFVRDEKGELVDLTPASMKPR
Sbjct: 481 KNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGFVRDEKGELVDLTPASMKPR 540

Query: 541 VVSTYSEIESTWNAFPSEDADDLETIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASL 600
           VVSTYSEIESTWNAFPSEDADDLETIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASL
Sbjct: 541 VVSTYSEIESTWNAFPSEDADDLETIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASL 600

Query: 601 YRDSNQSDAVGSQDRARAASVTRKVSKEGVNIAQPTSQEINKLSEQNTMPTRDLNKIISS 660
           YRDSNQSDAVGSQDRARAASVTRKVSKEGVNIAQPTSQEINKLSEQNTMPTRDLNKIISS
Sbjct: 601 YRDSNQSDAVGSQDRARAASVTRKVSKEGVNIAQPTSQEINKLSEQNTMPTRDLNKIISS 660

Query: 661 NSTHAIKLENLRDYRNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYAN 720
           NSTHAIKLENLRDYRNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYAN
Sbjct: 661 NSTHAIKLENLRDYRNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYAN 720

Query: 721 ADDLSRKXXXXXXXXXXXXXXXHLRKKVLQHSLKP 755
           ADDLSRK               HLRKKVLQHSLKP
Sbjct: 721 ADDLSRKNTVINTVTNVNQNVNHLRKKVLQHSLKP 755

>Scas_617.4
          Length = 791

 Score =  310 bits (793), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 196/456 (42%), Positives = 267/456 (58%), Gaps = 67/456 (14%)

Query: 347 LSFTESIQYDQSDGDSEPNQGDDASLVSN---RVQQNNVNTDAESADDIAKDKMDDHASG 403
           LS+TESI+Y  S   S+ N  D+   +S+   +    N  +  +S+ +   ++ DDH+  
Sbjct: 340 LSYTESIKYPNSATYSKFNHTDEPLPISDDDFKFSTKNRQSILQSSSEEEGEENDDHS-- 397

Query: 404 MDFEEDEVLNSTLTDGDVHVHKSGYFKKLVAE---------ELGDKKLDDGKSLNNVAST 454
                  + NS+  +    V +SGYF+KL+ E         E   ++LD  K  NN   T
Sbjct: 398 -------LQNSSDMES-FKVSESGYFEKLLEEDEMNPSTDQESHHEELD--KEENNSEGT 447

Query: 455 Q------TASTE-DKVASDTEDV----------------QESKADNDDTKNDAHVSSNRS 491
           +       AS E DKV  + E +                + SK+ +D         S+R 
Sbjct: 448 EDDILSIPASIESDKVEENPEGINKEADETSEKEKDRESENSKSGDDQETTITEGDSSRD 507

Query: 492 SVTSEEWRPDTDALRDGFMQKTGDNPPPGFVRDEKGELVDLTPASMKPRVVSTYSEIEST 551
           S+    W+PDTDA+R GF+Q T    PPGFV DE G+LVDLTP+SMKPRVVSTYSE+EST
Sbjct: 508 SINLGSWKPDTDAIRSGFVQDTNKRAPPGFVYDENGKLVDLTPSSMKPRVVSTYSEMEST 567

Query: 552 WNAFPS----EDADDLETIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASLYRDSNQS 607
           W AFPS    E+ +DLETI+DTKTLYDN+T++NVPGIMTNN+ LPPLP++ ++ +     
Sbjct: 568 WAAFPSNGNPENNEDLETIKDTKTLYDNNTIFNVPGIMTNNENLPPLPKNVNIEQ----- 622

Query: 608 DAVGSQDRARAASVTRKVSK--------EGVNIAQPTSQEINKLSEQNTMPTRDLNKIIS 659
              GS   AR  +   +V K        EG ++ +P S E+ KLS+Q+ +P  DLN++IS
Sbjct: 623 ---GSLPVARTLTAGSEVDKKSIKSIHSEGPSVHKPDSYEMAKLSDQDPLPELDLNELIS 679

Query: 660 SNSTHAIKLENLRDYRNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYA 719
           S ++H  K+E L+ Y  +L ++DSG+QTWI YTLKSSSK DRD++F EYK N HVREAYA
Sbjct: 680 SKASHLSKIEQLQAYSQSLADYDSGIQTWINYTLKSSSKADRDYLFDEYKKNEHVREAYA 739

Query: 720 NADDLSRKXXXXXXXXXXXXXXXHLRKKVLQHSLKP 755
           NA+DLSRK               HLRKKV  HS+KP
Sbjct: 740 NAEDLSRKNTVINTVASVNQNVSHLRKKVFSHSMKP 775

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 79/180 (43%), Gaps = 37/180 (20%)

Query: 1   MDESQVERKKSYRWVSASQATYDGAGWDXXXX----XXXXXXXQPKLGKLDESLPSLPKL 56
           M    V RKKS+RW SASQATYDGA W+               QP + KL    PSLPKL
Sbjct: 1   MSSENVGRKKSHRWASASQATYDGADWNSSDSDEDHAISNEEAQPNVTKL----PSLPKL 56

Query: 57  NY-DNTDVSQYKXXXXXXXXXXXXKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMID 115
           NY  N +  + K             + E    TLH  +E + D                 
Sbjct: 57  NYTSNEEEEEGKLTDNAEENGKLPNSEEEERPTLHITTEDETD----------------- 99

Query: 116 KDTLLTSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQEAVF 175
                      + SS + + S    +RR  P R VN  LD+LML+ISKE+TPK E E VF
Sbjct: 100 -----------RSSSNNESKSSLNRTRRNSPMRGVNTDLDNLMLQISKEMTPKLENEPVF 148

>YGR196C (FYV8) [2146] chr7 complement(889736..892189) Protein of
           unknown function [2454 bp, 817 aa]
          Length = 817

 Score =  305 bits (782), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 189/441 (42%), Positives = 270/441 (61%), Gaps = 46/441 (10%)

Query: 345 DALSFTESIQYDQSDGDSEPNQGDDASLVSNRVQQNNVNTDAESADDIAKD----KMDDH 400
           DALS+TESI+Y      S     ++ +  +  ++  + N D ES +D  +D    K  + 
Sbjct: 381 DALSYTESIKY------STNETEEEDNEDNESIE--DKNEDNESIEDENEDTDSYKFSNR 432

Query: 401 ASGMDF------EEDEVLNSTLTDGDVHVHKSGYFKKLVA-EELGDKKLDDGK--SLNNV 451
             G         EE++ ++S   +G +   KSGYF K++  ++ GD  L   +  ++ N 
Sbjct: 433 EKGSILLTSDEEEEEKGMSSDSDEGSLKAPKSGYFSKMIGNDDKGDSALQPNQIDTIENT 492

Query: 452 ASTQTAS-TEDKVASDTED-VQESKADNDDTKNDAHVSSNRSSVTSEEWRPDTDALRDGF 509
             + + S  E+   SD ED + E K            SS + S   + W+PD++ALR GF
Sbjct: 493 NLSNSGSELENSDGSDEEDHINEDKV--------LEESSVKDSTDVDSWKPDSEALRSGF 544

Query: 510 MQKTGDN-PPPGFVRDEKGELVDLTPASMKPRVVSTYSEIESTWNAFPSE-DADDLETIR 567
           +Q T +   PPG+V D  G+LVDLTPASMKPRVVSTYSE+ESTW+AFPS+ + DDLETIR
Sbjct: 545 VQDTANKKAPPGYVIDSNGKLVDLTPASMKPRVVSTYSEMESTWDAFPSKGEDDDLETIR 604

Query: 568 DTKTLYDNSTLYNVPGIMTNNDALPPLPEDA---------SLYRDSNQSDAVGSQDRARA 618
           DTKT+YDN+T+YNVPG++ N   LPPLP DA         +   D++ S+   +   AR+
Sbjct: 605 DTKTIYDNNTIYNVPGLIGNQSNLPPLPMDAQEQLNAGNDNSTTDNDNSNNTANDLAARS 664

Query: 619 ASV---TRKVSK-EGVNIAQPTSQEINKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDY 674
           AS     R VS+ E  ++ +P+++E+ KL +QN +P  D+NK+++S ++HA K+E LR+Y
Sbjct: 665 ASFKSENRTVSQGEMTSVHEPSTEEMAKLGQQNNLPKLDMNKLLNSKTSHAGKIEQLRNY 724

Query: 675 RNTLDNFDSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKXXXXXXX 734
           +  LD +D+G+QTWI YTLKSSS  D+DFI +EYK +SHVREAYANADDLS+K       
Sbjct: 725 KRELDEYDTGIQTWINYTLKSSSNKDKDFIAEEYKQHSHVREAYANADDLSKKHTVINTV 784

Query: 735 XXXXXXXXHLRKKVLQHSLKP 755
                   HLR+KV QHS+KP
Sbjct: 785 ASVNQNVTHLRRKVFQHSMKP 805

>Kwal_33.15455
          Length = 914

 Score =  228 bits (581), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 214/370 (57%), Gaps = 44/370 (11%)

Query: 421 VHVHKSGYFKKLVAEELGDKK--------------------LDDGKSLNNVASTQTASTE 460
           + V KSGY+ ++V E  G  +                        KS+N  ++   +S  
Sbjct: 538 LRVPKSGYYAQMVKETSGPDESDDQQTVTDDDYTSSSGTDVCSITKSINYSSARPRSSIP 597

Query: 461 DKVASDTEDVQESKADN---DDTKNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNP 517
               S TE   E+ A++   DD +N   ++S R SV   +W+PDTDA R  F+ +     
Sbjct: 598 PVSQSSTEKQGEAPAESPSSDDDQNKVGLNS-RQSVNLGKWQPDTDAGRAEFLGQAKPEV 656

Query: 518 PPGFVRDEKGELVDLTPASMK-PRVVSTYSEIESTWNAFPSE--DADDLETIRDTKTLYD 574
           P G+V D+ G+LV++ P+SM+  RVVSTYSE ES WNAFP+   +  DL+TI DTKT+YD
Sbjct: 657 PEGYVVDQDGQLVNVNPSSMRDARVVSTYSEAESAWNAFPASAGNGGDLDTIYDTKTIYD 716

Query: 575 NSTLYNVPGIMTNNDALPPLPE-----DASLYRDSNQSDAV----GSQDRARAASVTRKV 625
           N T++NVPG+ TNND+LPPLP      D+SL  +   SD++        R   +++    
Sbjct: 717 NQTIHNVPGLATNNDSLPPLPRDITAVDSSLSANVTDSDSILNHLNGVKRHHYSNL---- 772

Query: 626 SKEGVNIAQPTSQEINKLSEQNTMPTRDLNKIIS-SNSTHAIKLENLRDYRNTLDNFDSG 684
            KE  ++  P  +EI  L +Q  +PT DL+ +I+  N+THA K+ +L  + N L ++DSG
Sbjct: 773 -KESFSVHTPDQEEI-ALVKQKAVPTADLDALITRKNTTHAAKINDLNKHFNELKDYDSG 830

Query: 685 LQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKXXXXXXXXXXXXXXXHL 744
           L TWI+Y LK+S+ +D+D+IFQ YK ++HV++AY++ADDLS+K               HL
Sbjct: 831 LHTWISYALKTST-SDKDYIFQNYKVSTHVKDAYSHADDLSKKMTVSNTVANVNQNVSHL 889

Query: 745 RKKVLQHSLK 754
           ++KV  H++K
Sbjct: 890 KRKVFSHTMK 899

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 77/196 (39%), Gaps = 46/196 (23%)

Query: 6   VERKKSYRWVSASQATYDGAGWDXXXX---------XXXXXXXQPKLGKLDESLPSLPKL 56
           +ERKKS RWVS S+ TYDG  WD                     P+       LP LP L
Sbjct: 5   MERKKSQRWVSVSKGTYDGKEWDSSEEDEPYGAWENDEGQSRKSPERNGTVSKLPPLPML 64

Query: 57  NYDNTDVSQYKXXXXXXXXXXXXKAGEIGAGTLHSNSEIQNDVIVEDDPVIKQTPDMIDK 116
           +Y                          G  +  SN E++      D+    Q   +   
Sbjct: 65  SY--------------------------GKDSRRSN-EVERTETGADEASGSQ---LDST 94

Query: 117 DTLLTSPTAHKESSPSPNGSRHTFSRRPL--PNRAVNEHLDDLMLEISKELTPKPEQEAV 174
            T   SP  ++ SS +   +  + + R    P++  +E+LD LM ++S+ELTP    E+ 
Sbjct: 95  STGAGSPRLYQSSSGAARVNSQSSTGRITRGPSQYKSENLDHLMTQLSQELTPVSISESR 154

Query: 175 F-----GNHSPRKDID 185
           F     G +SPR   D
Sbjct: 155 FSFNDDGLNSPRGSAD 170

>KLLA0D09603g 811234..813696 weakly similar to sp|P46949
           Saccharomyces cerevisiae YGR196c singleton, start by
           similarity
          Length = 820

 Score =  204 bits (520), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 143/373 (38%), Positives = 203/373 (54%), Gaps = 47/373 (12%)

Query: 419 GDVHVHKSGYFKKLVAEELGDKKLDDG--KSLNNVASTQTASTEDKVASDTE-------- 468
           GD+ V KSGYF  +V E   DK++DD    +LNN   T   + +  V S TE        
Sbjct: 444 GDLEVTKSGYFAAMVDE---DKEIDDSDRHTLNN-NDTDGLTADSDVNSITESVTKRLSQ 499

Query: 469 ------DVQESKADND-----DTKNDAH------VSSNRSSVTSEEWRPDTDALRDGFMQ 511
                 DV +  ++ND     D+  D          S R S+   +W+PDTDA R GF+ 
Sbjct: 500 SSITQSDVPDQNSENDVGGYSDSSEDEEDGPQKLAFSTRESINLGKWKPDTDAFRSGFVT 559

Query: 512 KTGD--NPPPGFVRDEKGELVDLTP--ASMKPRVVSTYSEIESTWNAFP---SEDADDLE 564
           +T D  NPP G+  +E GE+V++     S   R  S  S+ ES +NAFP   + D DDL+
Sbjct: 560 ETIDINNPPEGYTVNEDGEIVEVNKNTTSNIQRNSSVASDGESQFNAFPHDVASDDDDLK 619

Query: 565 TIRDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASLYRDSNQSDAVGSQDRARAASVTRK 624
           TI DTKT+YDN T+YNVP ++ NN + P LP +  +  +S  +D V S D      V  +
Sbjct: 620 TIADTKTIYDNQTIYNVPALIANNASAPALPTNIQITNES--TDYVSSNDTI-FKHVNGE 676

Query: 625 VSKEGVNIAQPTSQE---INKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNF 681
             K    + +  S E   I  +  Q+T+P  DL K++SSN  H+ KL+ L +Y+  L  +
Sbjct: 677 APKGESKLKEAFSSEGDEIPSVVHQSTVPNLDLVKLLSSNELHSQKLKKLNNYKEQLKEY 736

Query: 682 DSGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKXXXXXXXXXXXXXX 741
           DSGLQ+WI Y LKSS+ +D+DFIF++YK N HV++AYA AD LS+K              
Sbjct: 737 DSGLQSWIQYALKSSTTSDKDFIFKDYKVNKHVQDAYAQADILSKK---NSVANTVNQNV 793

Query: 742 XHLRKKVLQHSLK 754
            HL+KK+   S++
Sbjct: 794 THLKKKMFSSSMR 806

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 6  VERKKSYRWVSASQATYDGAGWDXXXXXXXXXXXQPKLGKLDESLPSLPKLN 57
          + R KS RWVSAS+A YDGA WD                 L  ++P LP++N
Sbjct: 19 ITRHKSQRWVSASKANYDGADWDAYSSNSEDEG-------LTNNIPQLPQVN 63

>ACR036C [1084] [Homologous to ScYGR196C (FYV8) - SH]
           (423030..425294) [2265 bp, 754 aa]
          Length = 754

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/304 (29%), Positives = 143/304 (47%), Gaps = 25/304 (8%)

Query: 464 ASDTEDVQESKADNDDTKNDAHVSSNRSSVTSEEWRPDTDALRDGFMQKTGDNPPPGFVR 523
            S T  +   K DN+D +N       + SV    W PDT+  R  F+ +     P    +
Sbjct: 445 GSVTHSIPVIKDDNEDWQNQL----RQQSVHLGAWNPDTEGKRGAFLTQAS---PMSTNK 497

Query: 524 DEKGELVDLTPASMKPRVVSTYSEIESTWNAFPS-EDADDLETIRDTKTLYDNSTLYNVP 582
              G   + T    +        + +S W  FPS  + +DL+++ D KT+YDN TLYNVP
Sbjct: 498 GMCGSQDEETTGDDQQLAEPCNDDSDSVWEGFPSVGEYEDLQSVADIKTIYDNQTLYNVP 557

Query: 583 GIMTNNDALPPLP---------EDASLYRDSNQSDAVGSQDRARAASVTRKVSKEGV--- 630
           GI+T++ ++PPLP         +D S+  +S     + S    R     R   K  +   
Sbjct: 558 GIITSSTSVPPLPSSMSELTSRQDTSILSESTSGSGLDSDSLMRVVEGQRHAPKPSMFKE 617

Query: 631 NIAQPTSQEINKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNFDSGLQTWIA 690
           N  Q    ++  L   + +P+ D+  +I    +H+ K + L  +   L+ + SG QTWI 
Sbjct: 618 NFGQTPEVQVEHLV-NSPVPSLDICALIEGPQSHSFKRDKLNSHIEDLNAYSSGAQTWIK 676

Query: 691 YTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKXXXXXXXXXXXXXXXHLRKKVLQ 750
           Y LK S+++  +  F EY  + HV++AYA A+++S+K                LRKKV  
Sbjct: 677 YALK-STQSSSNITFDEYVISKHVQDAYAQAEEVSKK---HSVTNAVNQNVSQLRKKVFS 732

Query: 751 HSLK 754
           HS+K
Sbjct: 733 HSMK 736

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 27/53 (50%)

Query: 5  QVERKKSYRWVSASQATYDGAGWDXXXXXXXXXXXQPKLGKLDESLPSLPKLN 57
          +V R+KS RWVS S+  YDGA WD             +  +    LP LPKLN
Sbjct: 4  KVNRRKSQRWVSVSKGNYDGADWDSDYSGEELESSPTRQHETICKLPELPKLN 56

>CAGL0H09240g complement(905670..907598) some similarities with
           sp|P40549 Saccharomyces cerevisiae YIL014w MNT3,
           hypothetical start
          Length = 642

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 7/101 (6%)

Query: 113 MIDKDTL-LTSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLEISKELTPKPEQ 171
           M+D DT+   S     ES          +  R L NR + EH  DL L+    L P  E+
Sbjct: 340 MVDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNRHIREHCPDLALK----LEPSLEE 395

Query: 172 EAVFGNHSPRKDIDSDLPNGK--EDQKLNGSRLGLLNESID 210
             + G     K +D DL   K  E++  N  R  L    +D
Sbjct: 396 HRILGTTLRFKLLDPDLKQEKTSEERAFNQMRTNLALHHVD 436

>Scas_681.30
          Length = 441

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 358 SDGDSEPNQGDDASLVSNRVQQNNVNTDAESADDIAKDK 396
           SD  SEPN+ DD SL   +V  NN+N   E      K+K
Sbjct: 384 SDVSSEPNKKDDISLWKIQVYNNNINKWFEVDGSTIKEK 422

>Scas_645.3
          Length = 708

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 71/194 (36%), Gaps = 44/194 (22%)

Query: 380 NNVNTDAESADDIAKDKMDDH---------ASGMDFEEDEVLNSTLTDGDVHVHKSGYFK 430
           N+ N D E  DD+       H         A   DF  +  +  T+  GDVH+   G FK
Sbjct: 451 NDFNGDVELLDDLNDHWCAKHHKKERNYLIAKLQDFAAENGIRVTILSGDVHLASLGRFK 510

Query: 431 ------KLVAEELGDKK--------LDDGKSLNNVASTQTASTEDKVA------------ 464
                  ++ EE  +K+         +D + + NV S+   +T    A            
Sbjct: 511 SKIHKRHVIHEEEHEKENLATINNPENDVRLMFNVISSAVVNTPPPTAMAKLLQHRAPVH 570

Query: 465 -----SDTEDVQESKADNDDT--KNDAHVSSNR--SSVTSEEWRPDTDALRDGFMQKTGD 515
                +D + V   K D D T  + +A   + R  S V   +     D L   F  K G+
Sbjct: 571 HFDFSTDEDSVPIFKFDTDGTTKRYEAGFMNKRNWSDVIPVQNILQNDYLNGVFRLKMGE 630

Query: 516 NPPPGFVRDEKGEL 529
              PG VR  +G L
Sbjct: 631 MVIPGIVRPNEGIL 644

>CAGL0A01045g complement(104865..106316) highly similar to sp|P08417
           Saccharomyces cerevisiae YPL262w FUM1 fumarate
           hydratase, hypothetical start
          Length = 483

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 387 ESADDIAKDKMDDHASGMDFEEDEVLNSTLTDGDVHVHKSGYFKKLVAEELGDKKLDDGK 446
           ++AD++AK K++DH   + F+      S +   +V  +++    +L+  ELG KK+    
Sbjct: 95  QAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRA---IELIGGELGSKKIHPNN 151

Query: 447 SLNNVASTQ-TASTEDKVASDTE 468
             N   S+  T  +   +A+ TE
Sbjct: 152 HCNQAQSSNDTFPSVMHIAAVTE 174

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.304    0.124    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,774,511
Number of extensions: 1157754
Number of successful extensions: 5257
Number of sequences better than 10.0: 316
Number of HSP's gapped: 4958
Number of HSP's successfully gapped: 413
Length of query: 755
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 646
Effective length of database: 12,822,747
Effective search space: 8283494562
Effective search space used: 8283494562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 65 (29.6 bits)