Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09273g54553726070.0
YGR197C (SNG1)54744412781e-171
Scas_617.354142411221e-148
Sklu_2316.348742310861e-143
Scas_647.944942610521e-139
Kwal_55.2210649543310531e-138
CAGL0B03949g63243310191e-131
YJR015W51043710051e-131
KLLA0E02134g5394259581e-123
CAGL0B03971g5434339141e-117
ADL193C4654286701e-81
Scas_434.13572594911e-56
Scas_617.0d46441457e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09273g
         (537 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...  1008   0.0  
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   496   e-171
Scas_617.3                                                            436   e-148
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             422   e-143
Scas_647.9                                                            409   e-139
Kwal_55.22106                                                         410   e-138
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   397   e-131
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   391   e-131
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   373   e-123
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   356   e-117
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   262   1e-81
Scas_434.1                                                            193   1e-56
Scas_617.0d                                                            60   7e-12

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score = 1008 bits (2607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/537 (91%), Positives = 492/537 (91%)

Query: 1   MVSEADTEAQYNGSDRLRPAAFEASASDALSRVMTETYSMEVRXXXXXXXXXXXXHNSEK 60
           MVSEADTEAQYNGSDRLRPAAFEASASDALSRVMTETYSMEVR            HNSEK
Sbjct: 1   MVSEADTEAQYNGSDRLRPAAFEASASDALSRVMTETYSMEVRQGQEEAENQAAAHNSEK 60

Query: 61  QEVVFXXXXXXXXXXXXXXXXXXXDTQGSHTAGFFHKCVHLLKNILNPKLESHKSVLAFQ 120
           QEVVF                   DTQGSHTAGFFHKCVHLLKNILNPKLESHKSVLAFQ
Sbjct: 61  QEVVFSSRDSNSSNSSSHQKGSYSDTQGSHTAGFFHKCVHLLKNILNPKLESHKSVLAFQ 120

Query: 121 FCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNNIQSMASTLPALIDQ 180
           FCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNNIQSMASTLPALIDQ
Sbjct: 121 FCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNNIQSMASTLPALIDQ 180

Query: 181 TPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVKTGATEALYNSLTDN 240
           TPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVKTGATEALYNSLTDN
Sbjct: 181 TPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVKTGATEALYNSLTDN 240

Query: 241 TAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTSTYLPSMLRNVSATIN 300
           TAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTSTYLPSMLRNVSATIN
Sbjct: 241 TAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTSTYLPSMLRNVSATIN 300

Query: 301 SIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILTVVQLSLYGPMHAKM 360
           SIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILTVVQLSLYGPMHAKM
Sbjct: 301 SIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILTVVQLSLYGPMHAKM 360

Query: 361 VRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRGGFVIYWITTFYVML 420
           VRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRGGFVIYWITTFYVML
Sbjct: 361 VRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRGGFVIYWITTFYVML 420

Query: 421 AIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFYPMVLNNQFYRYGYAMPLHNAVD 480
           AIGATNENVISLIVAYCPQYM              SFYPMVLNNQFYRYGYAMPLHNAVD
Sbjct: 421 AIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFYPMVLNNQFYRYGYAMPLHNAVD 480

Query: 481 IYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSNAMKQAQATIAA 537
           IYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSNAMKQAQATIAA
Sbjct: 481 IYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSNAMKQAQATIAA 537

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  496 bits (1278), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/444 (51%), Positives = 321/444 (72%), Gaps = 7/444 (1%)

Query: 85  DTQGSHTAGFFHKCVHLLKNILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAY 144
           + +G +  G       +   + +P+L +H+  +  +F   N  +A VC+S+I IYWGA Y
Sbjct: 76  EEKGGNDGG---PLARIQTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACY 132

Query: 145 RTEHYLFKVNILSVIQDQDYN-NIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTS 203
            T+ Y FKV  + V+QD   N ++QS+++ +P+L+   PGTWH+YN +SF  K+G  N++
Sbjct: 133 GTDRYFFKVKNIVVLQDAPSNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNST 192

Query: 204 EAVDKKITDLIFEEKYWMSLNVKTGATEALYNSLTDNTAPA-FNSSAYFECMFESGRDPT 262
           E +D+KI DLI++E+YW++LNVK  AT+ LYNSL    A + FNSS +FE +FESGRDP+
Sbjct: 193 E-IDRKIVDLIYDERYWLALNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGRDPS 251

Query: 263 NLKSAILPIMQQLQAAYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYID 322
           ++KS ILP+MQQL+    +YY   YLPS++ N+++    + ++N  + A +G   F Y D
Sbjct: 252 SVKSTILPLMQQLEVRLQKYYVKEYLPSLMSNITSNDRDL-NINMENWAIAGQLLFTYND 310

Query: 323 YRPFFDRVLLAPLQVGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYF 382
           YRPF DR+L+APLQVGLI+ ++LTV+QLSLYG +H +M RV KPKH L+YR  +SW+TYF
Sbjct: 311 YRPFADRILMAPLQVGLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYF 370

Query: 383 ILSLFFCTVSAIYQIDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMX 442
           +LS+ FCTVSAI++IDFT AFGRGGFV+YW++T+ VM+A+G  NENV+SL++AYCP Y+ 
Sbjct: 371 LLSIGFCTVSAIFRIDFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLS 430

Query: 443 XXXXXXXXXXXXXSFYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILT 502
                        SFYPMVLNN+FYRYGY MP+HNAVDIY+VIFL+L++ K+GRNYGIL 
Sbjct: 431 IWLMTWIILNISASFYPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILV 490

Query: 503 AWVAVTHIIFPFVMKIAGTKMKSN 526
           AWVA+   + PF MK AG KM+ N
Sbjct: 491 AWVALNTSLMPFCMKFAGKKMQKN 514

>Scas_617.3
          Length = 541

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 301/424 (70%), Gaps = 8/424 (1%)

Query: 107 NPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYN- 165
           +PKL S +  +  +F  +N+LLA VCLSI+ +YWG+ Y+T  +L +++I+++IQD DY  
Sbjct: 112 SPKLASQRKKITVKFIISNLLLAGVCLSILSLYWGSLYQTTKHLERISIIAIIQD-DYIP 170

Query: 166 ----NIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWM 221
               N+ S+ + +P+ I+Q+ G WH+YN+S F EK+ +++ +  +++++  LI +EKYW+
Sbjct: 171 PNDLNLTSVVAPVPSFIEQSTGKWHVYNQSYFQEKFNVQDPT-MINERLNALIHDEKYWI 229

Query: 222 SLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQ 281
           +LN+    T  + NSLT    P FNS+ +   ++E+ R+PT L++ +LPI+Q+++ AY  
Sbjct: 230 ALNIGANLTMRIVNSLTTPNEPFFNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQD 289

Query: 282 YYTSTYLPSMLRNV-SATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLI 340
           +Y + YLP +L  + ++T   + +    +LAN G F+F+Y D   F DR+L+APLQVGLI
Sbjct: 290 FYHTEYLPELLSKLQNSTTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLI 349

Query: 341 FTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFT 400
           + LILTV QLSL+GP+HA+M +  KPKH ++YR  +SW+TYF LSLFFCTVSAI+QIDFT
Sbjct: 350 YCLILTVFQLSLFGPLHAEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFT 409

Query: 401 LAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFYPM 460
           + FG+GGFVIYW+TT+ VMLA+G  NENV+SLI+ + P+Y+              +F PM
Sbjct: 410 VTFGKGGFVIYWMTTYLVMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPM 469

Query: 461 VLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAG 520
           VL+N FYRYGY MPLH A+DI++V+FL++S+  +GRNYGIL AW+ V   +FP VMKI G
Sbjct: 470 VLDNVFYRYGYMMPLHQALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVG 529

Query: 521 TKMK 524
             ++
Sbjct: 530 KTVQ 533

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  422 bits (1086), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 282/423 (66%), Gaps = 12/423 (2%)

Query: 107 NPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNN 166
           +P+L++ +  + FQF F  + LA + +S+  +YWGA Y    +L KV IL+VIQD     
Sbjct: 67  SPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDG--- 123

Query: 167 IQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVK 226
             S+   LPA+ID  PG WH+Y    F  KY I  T   +D KI  L+  +K+WMSLNVK
Sbjct: 124 --SLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQ--IDSKIEHLVHTQKFWMSLNVK 179

Query: 227 TGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTST 286
             AT AL+ SL + +A  F +S YFE ++ESGRDPTN +S+ILP++Q+++ ++ + YTS+
Sbjct: 180 PNATNALHESLQNPSADPFVASNYFEAIYESGRDPTNFRSSILPLLQEVELSFQKNYTSS 239

Query: 287 YLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILT 346
           YLP +L + +     + + +P +LA +GN EF   D RPF + VLL PLQVGLIF ++LT
Sbjct: 240 YLPELLSHTN-----LSNASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFCVLLT 294

Query: 347 VVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRG 406
             QL+++GP+H  +    KP H L+YRY +S + YF LSLFFCTVSAI+Q+DFT  FGR 
Sbjct: 295 FFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPTFGRA 354

Query: 407 GFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFYPMVLNNQF 466
           GF++YW++T+ +M A+G  NENV+SLI+ Y  QY+              SF+P+ L N F
Sbjct: 355 GFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLALMNNF 414

Query: 467 YRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSN 526
           YRYGY MP+HNA+DIY+VIFL+  +  LGRNYGIL AWV +  I+F  V+KI G KMK N
Sbjct: 415 YRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNKMKQN 474

Query: 527 AMK 529
           A K
Sbjct: 475 AQK 477

>Scas_647.9
          Length = 449

 Score =  409 bits (1052), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 191/426 (44%), Positives = 278/426 (65%), Gaps = 4/426 (0%)

Query: 110 LESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNN--I 167
           ++  +  +   F FTN +LA  C +I  ++WG  YR      +V IL+VIQD+  NN  +
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGINNSTV 60

Query: 168 QSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYWMSLNVKT 227
             MAS LP L+ + P TWHLYN +SF EK+G  N++EA+DK++   +F E YWM+LNVK 
Sbjct: 61  LPMASILPTLMQENPATWHLYNTTSFNEKFG-TNSTEAIDKEVIHEVFSEHYWMALNVKP 119

Query: 228 GATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQYYTSTY 287
            AT+AL+ +  +   P FNS+ YF+ +F S RDP+N +  +LP+++ L+ AY  YY +TY
Sbjct: 120 NATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYINTY 179

Query: 288 LPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILTV 347
            P  + NVS   N++  VN  ++A +G   F+Y DYRPF +R L+AP+ +G+ + L+LT 
Sbjct: 180 FPQFMSNVSIA-NNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLTF 238

Query: 348 VQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRGG 407
            Q  +Y  +HA+  R+ KP   + YR  + W T FI SLFFCT SAI+Q+DFT AFG+GG
Sbjct: 239 FQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKGG 298

Query: 408 FVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFYPMVLNNQFY 467
           FV+YW+TT+  M+A G TNEN +SL+    P+++              +FYP++L N  Y
Sbjct: 299 FVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPVY 358

Query: 468 RYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSNA 527
           RYGY MP+HNA+DIYRVIFLDLS++K+GRN+G+L AW+A+     PFV K     + +  
Sbjct: 359 RYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTNRV 418

Query: 528 MKQAQA 533
           +++AQA
Sbjct: 419 VEEAQA 424

>Kwal_55.22106
          Length = 495

 Score =  410 bits (1053), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 284/433 (65%), Gaps = 7/433 (1%)

Query: 97  KCVHLLKNILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNIL 156
           K   ++    + +++  +  L  +F   + LLA + +S+  +YWGA Y+   ++ KV IL
Sbjct: 62  KLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSKHMHKVKIL 121

Query: 157 SVIQDQDYNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFE 216
           +V+QD+       +AS++P L +Q PGTWH+YN SSF +KYG+    + VD KI  L+ +
Sbjct: 122 AVVQDEPGTGT-GIASSIPTLAEQAPGTWHVYNTSSFQQKYGV--AQDEVDAKIQQLVHD 178

Query: 217 EKYWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQ 276
           +KYW+SLNVK  AT  L  SL ++ A  FNSSA+FE  +ESGRDPTNLKS+ILPI   L+
Sbjct: 179 QKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRDPTNLKSSILPIALSLE 238

Query: 277 AAYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQ 336
           + Y   Y ST LP +L N++     +GDV+  ++A +GN  F  +D RPF D VLL PLQ
Sbjct: 239 SRYQNIYASTILPGILSNIT---QRVGDVSR-NVAMAGNMVFAQVDNRPFNDYVLLGPLQ 294

Query: 337 VGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQ 396
           VGLI+ ++LT  QL+L+GP+HA + +  KP H LLYRY +++  YF LSLFFC VS  +Q
Sbjct: 295 VGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFFLSLFFCLVSLAFQ 354

Query: 397 IDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXS 456
           +DFT AFGR GF++ W++++ +M A+G  NEN++++I+A+ PQY+              +
Sbjct: 355 VDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLIFWVVLNISPA 414

Query: 457 FYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVM 516
           FYPM L + FYRYGY  P++N V I+RV FLDL R  LGRNYGIL AW+ +   IFPFVM
Sbjct: 415 FYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIVLNMAIFPFVM 474

Query: 517 KIAGTKMKSNAMK 529
           K+     K  AMK
Sbjct: 475 KLFVYVKKREAMK 487

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  397 bits (1019), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/433 (43%), Positives = 280/433 (64%), Gaps = 9/433 (2%)

Query: 104 NILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQD 163
           ++ + +++ H+  +  +F  T++LLA   +  + +YWGA Y     L++V+ ++VIQD+ 
Sbjct: 170 SLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEP 229

Query: 164 YNN-----IQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEK 218
           Y       I ++   +  +I+  PG W + N + F   Y + N  E +D+K+ +LIF+EK
Sbjct: 230 YTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQE-IDEKVAELIFDEK 288

Query: 219 YWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAA 278
           +W+++NV+ GATEA Y S+T+  AP FNS+ YF+ ++ESGRDPTNLKS+I PI+ + ++ 
Sbjct: 289 FWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESV 348

Query: 279 YVQYYTSTYLPSMLRNV-SATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQV 337
           +   Y   Y+P  ++N+ S   N    VN  +L   GNF  N  D RPF DRVLL PL +
Sbjct: 349 FRSQYLKIYVPEFIKNITSPDFNET--VNTANLYGLGNFATNSYDLRPFTDRVLLGPLSM 406

Query: 338 GLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQI 397
           GL + ++ +V  +S++GP++ +M +  KP+    YR  +SWS +F LSLF CTVSAI+QI
Sbjct: 407 GLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQI 466

Query: 398 DFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSF 457
           DFT  FG+ GFVIYW+T++ VM A+G  NEN++S+I+ +CPQYM              S 
Sbjct: 467 DFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSL 526

Query: 458 YPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMK 517
           YP+VL ++FYR+GYAMP+HN V IYRVIFLD+SR+++ RNYGIL AWVAV   I PFV K
Sbjct: 527 YPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNK 586

Query: 518 IAGTKMKSNAMKQ 530
                +K    ++
Sbjct: 587 FISKVVKKREERK 599

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  391 bits (1005), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/437 (43%), Positives = 284/437 (64%), Gaps = 9/437 (2%)

Query: 106 LNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQ--- 162
            +P L+  +  +  +F FTN LLA +C ++  ++WGA Y T  YL KV +L VIQ+    
Sbjct: 75  FSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVV 134

Query: 163 --DYNN---IQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEE 217
             D N+   + S++  LP  I++ P  W +YN  +F  K+ + NT + V+ K+ DL+++E
Sbjct: 135 ILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDV-NTPQQVNDKVVDLVYDE 193

Query: 218 KYWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQA 277
           KYW ++N+K  ATE L+ SL ++TAP FNS+ + + ++E+GRDPTNLKS ILP+ Q ++ 
Sbjct: 194 KYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEE 253

Query: 278 AYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQV 337
            Y  +YT  YLP +L N++         N   +A +G + + Y D+RPF DR+LLAP Q+
Sbjct: 254 YYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQI 313

Query: 338 GLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQI 397
           G+++ L+LT  Q  LYGP+H +M +V +P + L+YR  +SW T+F  SLFFCT +AI+Q+
Sbjct: 314 GVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIFQV 373

Query: 398 DFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSF 457
           DFT +FGRGGFV+YW++T+  MLA G  NEN + L++   PQY+              SF
Sbjct: 374 DFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPSF 433

Query: 458 YPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMK 517
           +P+ LNN  YRYGY MP+HN +DIYRVIF D++R K+GRNYGIL A +A+   + PFV K
Sbjct: 434 FPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGK 493

Query: 518 IAGTKMKSNAMKQAQAT 534
            A  K+K  A+  A+ +
Sbjct: 494 YASRKLKQKALVAAKQS 510

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  373 bits (958), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/425 (42%), Positives = 277/425 (65%), Gaps = 18/425 (4%)

Query: 109 KLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDYNNIQ 168
           KL +H+++ A +F     LL ++ +++  +YWGA Y        V  ++V++D       
Sbjct: 128 KLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDD-----G 182

Query: 169 SMASTLPALIDQTPGTWHLYNRSSFVEKYGIE-NTSEAVDKKITDLIFEEKYWMSLNVKT 227
            M + +  ++D     + +YN SSF +KYG + N SE    K+  L+  +K+W SL V  
Sbjct: 183 DMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQDVNISE----KVHHLVHTKKFWGSLIVYP 238

Query: 228 GATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAAYVQ-YYTST 286
           G T+A  +SLT + APAFNS+ YFE  +++ RD +N++++I+P++  ++  Y + ++ + 
Sbjct: 239 GTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSIETTYKKTFFYND 298

Query: 287 YLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVGLIFTLILT 346
           Y PS++ N++       +++  +L+ +G+  +  ID RPF D  LL P+QVGLI+ ++LT
Sbjct: 299 YFPSVIANIT-------NISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLIYCILLT 351

Query: 347 VVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQIDFTLAFGRG 406
             QL+L+GP HA +  + KPKH +LYR   SW+TYF LSLFFCTVSAI+ +DFTLAFGRG
Sbjct: 352 FFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFTLAFGRG 411

Query: 407 GFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFYPMVLNNQF 466
           GFV+YW+TT+ +M A+G  NENV+S+++AYCPQY+              SF P+VL N+F
Sbjct: 412 GFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPLVLANRF 471

Query: 467 YRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMKSN 526
           YRYGY  P++NA++IYRVIF D  +  +GRNYGIL AW  +  ++FPFVMKI G K  ++
Sbjct: 472 YRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVGQKFMND 531

Query: 527 AMKQA 531
           A K+A
Sbjct: 532 AKKRA 536

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  356 bits (914), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 181/433 (41%), Positives = 270/433 (62%), Gaps = 12/433 (2%)

Query: 106 LNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQ-DQDY 164
            +P  +  +  +A+++     LL   C +I+ + WG  YRT HY+ +  +L+VIQ DQ Y
Sbjct: 111 FSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVY 170

Query: 165 ---NNIQ--SMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKY 219
              + +Q  S++S L  +I + P +W +YN +SF  KY +E   EA+++K+ DL+++E++
Sbjct: 171 RFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGI-EAMNQKVIDLVYKEEF 229

Query: 220 WMSLNVKTGATEALYNSL-TDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAA 278
           W++LNV+   T+ L  SL + ++   FNS++ FE ++ESGRD TNL S +LP+ Q ++  
Sbjct: 230 WLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGV 289

Query: 279 YVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVG 338
           + + YT  YLP +L N++   N     NP  +A +G  +FNY DYRP  DRV L   Q+G
Sbjct: 290 FQKVYTYQYLPQLLGNITNGDN----FNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIG 345

Query: 339 LIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQID 398
            ++ L+LTV Q  ++GP+H +M R+ K  +  +YR  + WS  F +S+F+CTVSA+YQ+D
Sbjct: 346 AVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVD 405

Query: 399 FTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXXXSFY 458
           FT AFGR GFV+YW++T+  MLA+G  NENVI LI+   P Y+              +F+
Sbjct: 406 FTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFF 465

Query: 459 PMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKI 518
            +   N FYRYGYAMPLH  V I RVIF D+S+++LGRNYGIL AWV +  I  PFV K 
Sbjct: 466 AIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKF 525

Query: 519 AGTKMKSNAMKQA 531
               +   A K A
Sbjct: 526 VLKTLHKRARKAA 538

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  262 bits (670), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 145/428 (33%), Positives = 239/428 (55%), Gaps = 12/428 (2%)

Query: 97  KCVHLLKNILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNIL 156
           K   L    ++P++   +  L   F    + LA + L +  ++ G     + YL ++ +L
Sbjct: 43  KLARLKTRFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPML 102

Query: 157 SVIQDQDYNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFE 216
            V+QD+D      M++ L    +   G W   + ++    +G+E  ++ +D+ +  LI +
Sbjct: 103 MVVQDED----AGMSAELLRAAEHAAGRWTTVHGAAAWSHFGLEEDAD-LDEYLQSLIRK 157

Query: 217 EKYWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQ 276
            +YWM+L+V+ GATEAL  SL D  AP FNSS +F+  +E+ RD  N   ++  +M+ L+
Sbjct: 158 HRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETLE 216

Query: 277 AAYVQYYTSTYLPSMLRNVSATIN--SIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAP 334
           A +  YY  T+LP  LR  + TI+  S G     ++  +G+  ++Y+D  PF+D  L   
Sbjct: 217 ANFRAYYLDTWLPGELRERANTIDLSSTGS----NIVAAGSMRWSYVDLGPFYDPSLYGI 272

Query: 335 LQVGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAI 394
           LQVG+I  L+LT  QL++   +H ++  + +  H LLYRY +S+++Y +LSLF+  V  I
Sbjct: 273 LQVGMIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPII 332

Query: 395 YQIDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMXXXXXXXXXXXXX 454
           Y +D   A+GR GF+++W+TT+  M A+G  NENVIS+I  YCP+++             
Sbjct: 333 YHLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNIT 392

Query: 455 XSFYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPF 514
            +FY + L N FY+YGY  P++NA + Y+V+  D  R  L   Y +L AW  +   +FP 
Sbjct: 393 PTFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPL 452

Query: 515 VMKIAGTK 522
            +KI   K
Sbjct: 453 ALKIVNIK 460

>Scas_434.1
          Length = 357

 Score =  193 bits (491), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 163/259 (62%), Gaps = 10/259 (3%)

Query: 105 ILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQDY 164
           + +P L  H+  + ++F   N ++   C +++ I+WG  Y T  Y  KV+ L V+QD+  
Sbjct: 101 LFSPHLTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPL 160

Query: 165 N----NIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKYW 220
                ++ SMAS LP ++   PGTWH+YN S+F++ Y + N S+ ++ K+ DLIF+E++W
Sbjct: 161 QLGGLSVPSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASD-INNKVVDLIFQERFW 219

Query: 221 MSLNVKTGATEALYNSLTD--NTAPA--FNSSAYFECMFESGRDPTNLKSAILPIMQQLQ 276
           +++NVK  AT +L  SL    +T P   FN++ +F+ ++E+ RD T++++A++ ++Q+++
Sbjct: 220 VAVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEME 279

Query: 277 AAYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQ 336
           +AY + Y   YLP++L  +  T N I  + P SL+ + N  F Y DYR F++R L+ PL 
Sbjct: 280 SAYREIYMEQYLPTILAQMDPT-NQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLL 338

Query: 337 VGLIFTLILTVVQLSLYGP 355
            G I++L +TV Q  ++ P
Sbjct: 339 AGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 60.5 bits (145), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 33/44 (75%)

Query: 481 IYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKIAGTKMK 524
           +Y+VIF DL R+K+GRNYGIL AW+ +   +FPF+MK  G  ++
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQ 45

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,099,447
Number of extensions: 593798
Number of successful extensions: 1987
Number of sequences better than 10.0: 17
Number of HSP's gapped: 1994
Number of HSP's successfully gapped: 17
Length of query: 537
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 431
Effective length of database: 12,926,601
Effective search space: 5571365031
Effective search space used: 5571365031
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)