Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09251g36333015010.0
KLLA0E19371g3482695251e-63
Kwal_56.239543772675243e-63
Scas_611.4*2992595089e-62
YPL191C3602785033e-60
AFL071C3512704851e-57
YGL082W3812734355e-50
Scas_720.144032784349e-50
CAGL0H03289g3852653595e-39
Kwal_26.824437380637.0
Scas_644.1051268629.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09251g
         (358 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09251g complement(882028..883119) similar to sp|Q08930 Sac...   582   0.0  
KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces...   206   1e-63
Kwal_56.23954                                                         206   3e-63
Scas_611.4*                                                           200   9e-62
YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member...   198   3e-60
AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH] (3...   191   1e-57
YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF...   172   5e-50
Scas_720.14                                                           171   9e-50
CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces c...   142   5e-39
Kwal_26.8244                                                           29   7.0  
Scas_644.10                                                            28   9.1  

>CAGL0G09251g complement(882028..883119) similar to sp|Q08930
           Saccharomyces cerevisiae YPL191c, hypothetical start
          Length = 363

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/330 (86%), Positives = 286/330 (86%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXXXXXXXXXXXXXVQPKKVDLDQL 60
           MNFATKRIRVDGNDRSILMQNENGPCALVALTNV               VQPKKVDLDQL
Sbjct: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHHEHSELLELVQPKKVDLDQL 60

Query: 61  LTVLADIAIATNPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFDIDIIH 120
           LTVLADIAIATNPKDEE           HTGLNINPRFDGTFEDTKELSVFKLFDIDIIH
Sbjct: 61  LTVLADIAIATNPKDEELSVLLSLLPQLHTGLNINPRFDGTFEDTKELSVFKLFDIDIIH 120

Query: 121 GWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIEQFLNDSSTQ 180
           GWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIEQFLNDSSTQ
Sbjct: 121 GWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIEQFLNDSSTQ 180

Query: 181 LTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNNIVWEYMGSI 240
           LTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNNIVWEYMGSI
Sbjct: 181 LTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNNIVWEYMGSI 240

Query: 241 DGSNDIFFDGIFEETELNDTAYTTMEATERKERVEQVDKDXXXXXXXXXXXXXXXXXXDK 300
           DGSNDIFFDGIFEETELNDTAYTTMEATERKERVEQVDKD                  DK
Sbjct: 241 DGSNDIFFDGIFEETELNDTAYTTMEATERKERVEQVDKDAQLAQQLQLEENEAIQEADK 300

Query: 301 KQLPKKSTIPKTKTDKRGTNHHQTPSNATY 330
           KQLPKKSTIPKTKTDKRGTNHHQTPSNATY
Sbjct: 301 KQLPKKSTIPKTKTDKRGTNHHQTPSNATY 330

>KLLA0E19371g 1718449..1719495 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 348

 Score =  206 bits (525), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/269 (41%), Positives = 160/269 (59%), Gaps = 16/269 (5%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXXXXXXXXXXXXXVQP----KKVD 56
           M F TK I+VDG  R+IL+QNENGPCALVALTNV               +Q     +KV 
Sbjct: 1   MEFETKTIKVDGLTRNILLQNENGPCALVALTNVLVLSPQHKLDANEL-IQLINSNRKVT 59

Query: 57  LDQLLTVLADIAIAT-NPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFD 115
           L+ L+T LA+I +   N + E+           HTGLN+NP F+GTF+D + L++F+LF 
Sbjct: 60  LEDLITTLANIGVMMDNGQSEDVNELLQLLPQLHTGLNVNPAFNGTFQDDQALALFRLFQ 119

Query: 116 IDIIHGWISSDDK-------VQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEAN 168
           + ++HGWI    +       V  Y+Y+++Q LL  A DI++    G      + IL +A 
Sbjct: 120 VSLVHGWIVDPTRNEQQYHSVSHYSYDDAQNLLVHAYDIQNN---GLQVENSEQILQDAQ 176

Query: 169 LIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRS 228
            ++ FL  S+TQLT  G+ ++   ++E +Y+V FRNDHF+TI K+NG  Y LVTDLGF+ 
Sbjct: 177 YLKSFLARSATQLTEYGIQHLQQLLQEHSYSVFFRNDHFSTIHKNNGGLYVLVTDLGFKK 236

Query: 229 CNNIVWEYMGSIDGSNDIFFDGIFEETEL 257
            +NIVW+ + S+ G+ D FF   F  T L
Sbjct: 237 ASNIVWQSLKSVKGNQDSFFTSEFLLTTL 265

>Kwal_56.23954
          Length = 377

 Score =  206 bits (524), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 160/267 (59%), Gaps = 16/267 (5%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXXXXXXXXX---XXXXVQPKKVDL 57
           + F  K + ++G    IL+QNENGPCAL+AL NV                      +V L
Sbjct: 3   LMFVVKGVDINGCSHRILLQNENGPCALIALCNVLLLSPQCARYAGPLTQLVANKSEVAL 62

Query: 58  DQLLTVLADIAIATNPKDEEXXX--XXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFD 115
            +L+T+LA+I +   P+  +             HTGL+INP F+G+FED  E+++F+LF+
Sbjct: 63  RELITILANIGVQI-PQGAQMDVDRLLQSLPQLHTGLSINPIFNGSFEDGDEMALFRLFN 121

Query: 116 IDIIHGWIS--SDDKVQ-----KYTYEESQQLLTQAVDIRDRE-TPGSGNP--QDDNILA 165
           + I+HGWI+  +DD  Q     KY+YEE+Q++L +A DI+    +P S NP    + +L 
Sbjct: 122 VSIVHGWIADYADDPAQYEHVSKYSYEEAQKVLIEAYDIQHGSGSPASPNPGHSAEQVLE 181

Query: 166 EANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLG 225
           +A  I+ FL  S+TQLT  GL+ +   + E ++AVLFRNDHF+TI KH    YALVTDLG
Sbjct: 182 DAGYIKSFLARSATQLTEYGLHQLRELLIENSFAVLFRNDHFSTIVKHKNELYALVTDLG 241

Query: 226 FRSCNNIVWEYMGSIDGSNDIFFDGIF 252
           ++   NIVWE + S++GS D F+ G F
Sbjct: 242 YKDDENIVWESLKSVNGSQDTFYTGRF 268

>Scas_611.4*
          Length = 299

 Score =  200 bits (508), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 152/259 (58%), Gaps = 23/259 (8%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXXXXXXXXXXXXXVQPKK----VD 56
           + F  K I + G    IL+QNENGPCAL+A+ N+                  +K    V 
Sbjct: 5   LQFTIKNIEIKGTPFKILLQNENGPCALLAIVNLLLISPQHKRINYSLTELLEKKTSTVS 64

Query: 57  LDQLLTVLADIAIATNPK-----DEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVF 111
           LD++  VLA+IA+ +N +       +           HTGLNINP+FDGTFED+ E+++F
Sbjct: 65  LDEVNQVLANIALQSNTEMKGSNGADMDQLLELLPHLHTGLNINPKFDGTFEDSNEMALF 124

Query: 112 KLFDIDIIHGWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIE 171
           ++F I I+HGW+   + + KY+YE +QQ+L +A +             D+  + EA LI+
Sbjct: 125 RMFKIPIVHGWVI--ETLSKYSYESAQQVLLKAAE------------GDEEAVGEATLIQ 170

Query: 172 QFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNN 231
            F +++ TQLT NGL  +NT ++E  + VLFRNDHF+TI K N   Y+LVTDLG+R   +
Sbjct: 171 LFFDETGTQLTQNGLAYLNTILEEKGFVVLFRNDHFSTIYKENNQLYSLVTDLGYRRRKD 230

Query: 232 IVWEYMGSIDGSNDIFFDG 250
           IVWE + SIDGS D F DG
Sbjct: 231 IVWENIKSIDGSEDTFCDG 249

>YPL191C (YPL191C) [5256] chr16 complement(183596..184678) Member of
           the DUF544 protein of unknown function family, has
           moderate similarity to uncharacterized S. cerevisiae
           Ygl082p [1083 bp, 360 aa]
          Length = 360

 Score =  198 bits (503), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 166/278 (59%), Gaps = 20/278 (7%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXX---XXXXXXXXXXXVQPKKVDL 57
           ++F TK ++++G +  IL+QNENGPCAL+AL N+                   +  ++ L
Sbjct: 3   LSFTTKSVKINGQNHRILLQNENGPCALLALANILILSPDHTRFSNELIRLVNKGSQISL 62

Query: 58  DQLLTVLADIAI-ATNPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFDI 116
            +L+ VLADIA+  T+    +           H GLNINP F+G+FE+TKE+S+F+LF++
Sbjct: 63  KELIEVLADIALQVTDKPSTDISELLSLLPRLHEGLNINPEFNGSFENTKEMSIFRLFNV 122

Query: 117 DIIHGWISS-------DDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDN---ILAE 166
           D++HGW+ +       D+K+  Y+YE +Q++LTQA DI        G  QD+N   +L +
Sbjct: 123 DVVHGWVINSFINENIDEKLSHYSYESAQRILTQAADI------NCGISQDENSDEVLRD 176

Query: 167 ANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGF 226
           A  +  FLN+S TQLT  GL  +   +    +++LFRNDHF+T+ K+    Y LVTD G+
Sbjct: 177 AMHLGLFLNESPTQLTAFGLLRLREKLLHNKFSILFRNDHFSTLFKYEDRLYTLVTDFGY 236

Query: 227 RSCNNIVWEYMGSIDGSNDIFFDGIFEETELNDTAYTT 264
           ++C +IVW+ + S+DGS D FF G F   E+N    +T
Sbjct: 237 KNCKDIVWQSLDSVDGSCDAFFAGNFSAAEVNGQQLST 274

>AFL071C [3122] [Homologous to ScYGL082W - SH; ScYPL191C - SH]
           (301720..302775) [1056 bp, 351 aa]
          Length = 351

 Score =  191 bits (485), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 153/270 (56%), Gaps = 15/270 (5%)

Query: 1   MNFATKRIRVDGNDRSILMQNENGPCALVALTNVXXXX--XXXXXXXXXXXVQPKKVDLD 58
           + FATK I V+G    IL+QNENGPCAL+AL+NV                  Q   V L 
Sbjct: 3   LTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYAETTSQLRNLAQAPTVTLR 62

Query: 59  QLLTVLADIAIATNP-KDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFDID 117
            L+ VLADIA+        +            TGL I+P F+GTF +  E+++F++F + 
Sbjct: 63  DLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPAFNGTFREGDEMALFRMFQVG 122

Query: 118 IIHGWI-------SSDDKVQKYTYEESQQLLTQAVDIRDRETPGS-GNPQDDNILAEANL 169
           ++H W+           ++ + +YEE+Q+LL +A DI+     GS  + + D +L +A++
Sbjct: 123 LVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQQ----GSVASEKADQLLQDAHI 178

Query: 170 IEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSC 229
           +  FL+ S+TQ+T  GL ++   + EG YAVLFRNDHFATI K  G  + LVTDLG++  
Sbjct: 179 LRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFATICKQEGELFILVTDLGYQYR 238

Query: 230 NNIVWEYMGSIDGSNDIFFDGIFEETELND 259
           ++IVW+ +   DGS D F+ G F  T L D
Sbjct: 239 HDIVWQSLSYPDGSEDTFYTGDFVPTRLED 268

>YGL082W (YGL082W) [1900] chr7 (355828..356973) Member of the DUF544
           protein of unknown function family, has moderate
           similarity to uncharacterized S. cerevisiae Ypl191p
           [1146 bp, 381 aa]
          Length = 381

 Score =  172 bits (435), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 155/273 (56%), Gaps = 14/273 (5%)

Query: 3   FATKRIRVDGNDRSILMQNENGPCALVALTNVX--XXXXXXXXXXXXXXVQPKK-VDLDQ 59
           F TK ++++G    IL+QN  G CAL+AL NV                 V+ K+ V L++
Sbjct: 5   FLTKNVQINGTQFKILLQNGQGECALIALANVLLISPAHARYAQEISRLVRGKETVTLNE 64

Query: 60  LLTVLADIAIAT-NPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFDIDI 118
           L+  LAD+ +   N  D +           ++GLNINP F+G+FED  E+S+F+L+++ I
Sbjct: 65  LVQTLADMGVQNPNGTDVDKQQLLQILPQLYSGLNINPEFNGSFEDGVEMSIFRLYNVGI 124

Query: 119 IHGWI-------SSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANLIE 171
           +HGWI       +S + V KY+Y  +Q++L Q+ +I+        + Q   I ++A  ++
Sbjct: 125 VHGWIIDGDNDPNSYEHVSKYSYMGAQKVLVQSYEIQKNNAQFENSEQ---IQSDAPYLK 181

Query: 172 QFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSCNN 231
            FL  S+TQLT  GL ++   + E +YAVLFRNDHF T+ K+NG  + LVTD  +R+  +
Sbjct: 182 SFLARSATQLTEYGLTHLREILVERSYAVLFRNDHFCTLYKNNGELFTLVTDPTYRNRKD 241

Query: 232 IVWEYMGSIDGSNDIFFDGIFEETELNDTAYTT 264
           I W+ + S++GS D ++ G F  T L  T  T 
Sbjct: 242 INWQSLKSVNGSQDSYYTGNFIPTSLERTETTA 274

>Scas_720.14
          Length = 403

 Score =  171 bits (434), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 153/278 (55%), Gaps = 29/278 (10%)

Query: 3   FATKRIRVDGNDRSILMQNENGPCALVALTNVXX-----XXXXXXXXXXXXXVQPKKVDL 57
           F TK + ++G    IL++NE GP ALVALTNV                         V  
Sbjct: 5   FQTKTVDINGTQHKILLENEQGPTALVALTNVLLLSPGLQQTAYELIQLVNNASNNFVSW 64

Query: 58  DQLLTVLADIAI-----ATNPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFK 112
           ++LL VL+ + +      +N  +E+            +GLN+NP F+G+FED  E+S+F+
Sbjct: 65  NELLQVLSRVGLQNHNYVSNLNNEQLVQYLPQL---QSGLNVNPGFNGSFEDGIEMSLFR 121

Query: 113 LFDIDIIHGWI-------SSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDN--- 162
           LF++ I+HGWI        + D V +YTYE +Q+LL Q+ DI+        N Q DN   
Sbjct: 122 LFNVGIVHGWIIDGDNDPVAYDHVARYTYESAQRLLVQSYDIK------KNNLQVDNKDL 175

Query: 163 ILAEANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVT 222
           IL +AN I+ FL  S+TQLT  GL ++   + E  +AVLFRN+ + T+ K+NG  Y LVT
Sbjct: 176 ILEDANYIKSFLARSATQLTEYGLKHLKEILVERGFAVLFRNEVYVTLYKNNGQLYTLVT 235

Query: 223 DLGFRSCNNIVWEYMGSIDGSNDIFFDGIFEETELNDT 260
           DL  R+  +I+W+ + S++G+ D ++ G F  T L  T
Sbjct: 236 DLQHRNDTDIIWQSLKSVNGTQDSYYTGNFISTSLERT 273

>CAGL0H03289g 309091..310248 similar to sp|P53155 Saccharomyces
           cerevisiae YGL082w, start by similarity
          Length = 385

 Score =  142 bits (359), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 140/265 (52%), Gaps = 13/265 (4%)

Query: 3   FATKRIRVDGNDRSILMQNENGPCALVALTNVXXXXXXXXXXXXXXXV---QPKKVDLDQ 59
           ++ K I   G    IL+  +    ALVALTN                       ++ ++ 
Sbjct: 5   YSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHNRVTSQLKSIFDNCNEIAVED 64

Query: 60  LLTVLADIAI---ATNPKDEEXXXXXXXXXXXHTGLNINPRFDGTFEDTKELSVFKLFDI 116
           LL  LA+I +     +   ++             GL+INP+F+G+F D+ E SVF  F++
Sbjct: 65  LLDELANIGLQLGVMSNYGQDKEQLIATLKEFRKGLHINPKFNGSFTDSLETSVFSGFNV 124

Query: 117 DIIHGWISSDDK-------VQKYTYEESQQLLTQAVDIRDRETPGSGNPQDDNILAEANL 169
            ++HGW+   D+       + KY+YEE+Q++L QA +IR  +   + N     +L ++  
Sbjct: 125 ALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAYEIRKDQNGVALNTNAQQVLDDSAY 184

Query: 170 IEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLGFRSC 229
           I+ FL  S+TQLT  GL ++   + E ++AVLFRND + T+ K+ G  + LVT+      
Sbjct: 185 IKSFLARSATQLTEYGLQHLKEILVEKSFAVLFRNDRYFTLYKNAGELFILVTNPSQSRN 244

Query: 230 NNIVWEYMGSIDGSNDIFFDGIFEE 254
           NNIVW+ + S++G+ D++++G+F E
Sbjct: 245 NNIVWQSLHSVNGARDLYYNGVFVE 269

>Kwal_26.8244
          Length = 373

 Score = 28.9 bits (63), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 9/80 (11%)

Query: 164 LAEANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTD 223
           L  ++++++FL +   Q+T   L   N T+K+ +   L  N +F+       + YAL   
Sbjct: 190 LEHSSVLDRFLKEEPVQITLGKLRFFNNTLKKEDGVELILNQNFS-----EDSAYALAV- 243

Query: 224 LGFRSCNNIVWEYMGSIDGS 243
              RS    +W Y   ++ S
Sbjct: 244 ---RSIIGALWAYTHEVNPS 260

>Scas_644.10
          Length = 512

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 166 EANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTYALVTDLG 225
           E ++    +ND S  LTPN L  I     E +  VL  N+HF+ I KH   T  +  D  
Sbjct: 317 EQSIFGSLVNDLSN-LTPN-LYPI-----EQSDTVLDINNHFSIIKKHLNKTQDIAQDNA 369

Query: 226 FRSCNNIV 233
            ++CN+++
Sbjct: 370 TKTCNSLL 377

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,145,348
Number of extensions: 410175
Number of successful extensions: 883
Number of sequences better than 10.0: 19
Number of HSP's gapped: 857
Number of HSP's successfully gapped: 19
Length of query: 358
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 255
Effective length of database: 13,030,455
Effective search space: 3322766025
Effective search space used: 3322766025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)