Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G09218g37935914350.0
Scas_611.33893093894e-43
YPL193W (RSA1)3811093744e-41
Kwal_56.239673421083235e-34
KLLA0E19437g3421153141e-32
AFL073W3351143024e-31
ADR072C80643730.58
YML020W66477672.4
KLLA0D03256g82337663.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G09218g
         (373 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces c...   557   0.0  
Scas_611.3                                                            154   4e-43
YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic prote...   148   4e-41
Kwal_56.23967                                                         129   5e-34
KLLA0E19437g complement(1721747..1722775) some similarities with...   125   1e-32
AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH] complement(...   120   4e-31
ADR072C [1813] [Homologous to ScYDL148C (NOP14) - SH] (834949..8...    33   0.58 
YML020W (YML020W) [3945] chr13 (231149..233143) Protein of unkno...    30   2.4  
KLLA0D03256g complement(271036..273507) some similarities with s...    30   3.4  

>CAGL0G09218g 880312..881451 similar to sp|Q08932 Saccharomyces
           cerevisiae YPL193w RSA1, start by similarity
          Length = 379

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/359 (79%), Positives = 285/359 (79%)

Query: 15  NALPKPTFSGVIGDDTAHVNKKPRIQENYAPIQNISNTYAYNTGNMMMTXXXXXXXXXXX 74
           NALPKPTFSGVIGDDTAHVNKKPRIQENYAPIQNISNTYAYNTGNMMMT           
Sbjct: 15  NALPKPTFSGVIGDDTAHVNKKPRIQENYAPIQNISNTYAYNTGNMMMTGYPYPPVYQQP 74

Query: 75  XXXXMATNNQWDNRYPMTWQQYMPAQSNSISMHTPDINYTNYHTPQPVAPYISENSRGFL 134
               MATNNQWDNRYPMTWQQYMPAQSNSISMHTPDINYTNYHTPQPVAPYISENSRGFL
Sbjct: 75  QGVYMATNNQWDNRYPMTWQQYMPAQSNSISMHTPDINYTNYHTPQPVAPYISENSRGFL 134

Query: 135 ERQDPDKTSTSNSIVKSEDLVRGKNTSEIPDKHKPVKLAXXXXXXXXXXXXXXXXELSIP 194
           ERQDPDKTSTSNSIVKSEDLVRGKNTSEIPDKHKPVKLA                ELSIP
Sbjct: 135 ERQDPDKTSTSNSIVKSEDLVRGKNTSEIPDKHKPVKLANNKDRDKTGNKDDDDDELSIP 194

Query: 195 KSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKET 254
           KSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKET
Sbjct: 195 KSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKET 254

Query: 255 NVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELGXXXXXXX 314
           NVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELG       
Sbjct: 255 NVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELGECGFLEY 314

Query: 315 XXXXXXXXXXXXXYSNNFSXXXXXXXXXXXXXXXXXXXXXXXASRYNNGKNSTVVQDVS 373
                        YSNNFS                       ASRYNNGKNSTVVQDVS
Sbjct: 315 ELTEEEKEKLFGGYSNNFSNNRKNYHGRRNNNNSNEKREYNGASRYNNGKNSTVVQDVS 373

>Scas_611.3
          Length = 389

 Score =  154 bits (389), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 153/309 (49%), Gaps = 28/309 (9%)

Query: 17  LPKPTFSGVIGDDTA------------------HVNKKPRIQENYAPIQNISNTYAYNTG 58
           LPKPTFSG +G D++                  +    P+    Y P+      Y     
Sbjct: 22  LPKPTFSGTLGQDSSENGQTMSNHNDNLRASQSYPQYPPQQGYPYYPVPKYQAPYQQPGY 81

Query: 59  NMMMTXXXXXXXXXXXXXXXMATNNQWDNRYPMTWQQYMPAQSNSISMHTPDINYTNYHT 118
           +                    + +N W+NR     + Y P     IS   P  +  N  +
Sbjct: 82  HQQQRQYQPYMNSNQWAQPQQSPSNDWNNRGTTPMRTYTPISYEDIST-GPSTSARNVSS 140

Query: 119 PQPVAPYISENSRGFLERQDPDKTSTSNSIVKSEDLVRGKNTSEIPDKHKPVKLAXXXXX 178
            +     ++++    + +  PDK      +V+  +   G +  E P+ H   +       
Sbjct: 141 KRKKQTIVTKDDTTPVSQ--PDKL-----MVEQTNDSEGNSADETPEMHTTKRRKVNNDI 193

Query: 179 XXXXXXXXXXXELSIPKSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKE 238
                      E +I   ++   +++PGTSISL T+EDI KW++ERRKMWLL+ISNNK++
Sbjct: 194 SLPVLDSDSDEETNI--EDDKKPIVVPGTSISLVTDEDIIKWREERRKMWLLKISNNKQK 251

Query: 239 HMEKMGYKDEDLKKETNVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAK 298
           HME+MG K+ED+KK+ +VL ESRK   FI++IQ+Q++R NP  NLN +L+QRGM  +N+K
Sbjct: 252 HMEEMGLKEEDVKKQKSVLVESRKQNQFIQSIQNQVNRFNPKANLNLKLIQRGMVSDNSK 311

Query: 299 LLDFIVELG 307
           LLDFI  LG
Sbjct: 312 LLDFITNLG 320

>YPL193W (RSA1) [5254] chr16 (181402..182547) Nucleoplasmic protein
           involved in assembly of 60S ribosomal subunits [1146 bp,
           381 aa]
          Length = 381

 Score =  148 bits (374), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 93/109 (85%)

Query: 199 GAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKETNVLK 258
           G  VL+PGTSI+L T+ED+KKW++ER+KMWLL+ISNNK++HM++MG K+++LK + ++ K
Sbjct: 224 GKVVLVPGTSIALITDEDVKKWREERKKMWLLKISNNKQKHMQEMGIKEDELKSQPSIFK 283

Query: 259 ESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELG 307
           ESRK+K FI++IQ+Q+ R NP ++LN +L+QR  A EN++LLDFI ELG
Sbjct: 284 ESRKEKQFIQSIQNQVQRGNPKIDLNLKLIQREFANENSQLLDFIRELG 332

>Kwal_56.23967
          Length = 342

 Score =  129 bits (323), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 87/108 (80%), Gaps = 5/108 (4%)

Query: 202 VLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKETN--VLKE 259
           V IPGTSI+LE+EEDIKKW++ERRKMWL++ISN +++H +++G ++   K+ TN    ++
Sbjct: 178 VAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHRQELGVEE---KEPTNAGAFQQ 234

Query: 260 SRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELG 307
            +KDK FI++IQ+QI+R NPN NL+ RL+QR MAEEN  LL+FI ELG
Sbjct: 235 VKKDKQFIQSIQNQINRVNPNPNLSLRLMQRTMAEENINLLNFIQELG 282

>KLLA0E19437g complement(1721747..1722775) some similarities with
           sp|Q08932 Saccharomyces cerevisiae YPL193w RSA1
           nucleoplasmic protein involved in assembly of 60S
           ribosomal subunits singleton, hypothetical start
          Length = 342

 Score =  125 bits (314), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 85/115 (73%), Gaps = 2/115 (1%)

Query: 193 IPKSEEGAKVLIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKK 252
           I ++ +G+ + IPGTSI L+TEEDI KWK+ERRKMWL++ISN K+ + EK   KDEDL +
Sbjct: 172 IIETVKGSDLYIPGTSIVLKTEEDIAKWKEERRKMWLIKISNKKEMYREKFNVKDEDLNR 231

Query: 253 ETNVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELG 307
             N L+ESRK++ FI+NIQ+Q+ R N   NL   L QR + EEN K+LDFI ELG
Sbjct: 232 --NPLQESRKERYFIQNIQNQVKRFNYKPNLTIGLHQRILKEENGKILDFIKELG 284

>AFL073W [3120] [Homologous to ScYPL193W (RSA1) - SH]
           complement(298718..299725) [1008 bp, 335 aa]
          Length = 335

 Score =  120 bits (302), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 4/114 (3%)

Query: 196 SEEGAKV--LIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKE 253
           SE G  V   I GTSI L T EDI+KW+ ERRKMWLL+ISN K++HME++G  +++L+  
Sbjct: 167 SEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGVSEQELR-- 224

Query: 254 TNVLKESRKDKNFIKNIQSQISRANPNVNLNTRLVQRGMAEENAKLLDFIVELG 307
            + L + RKDK FI  IQS + R     NL+  LVQR MA ENAK+L FI ELG
Sbjct: 225 CSPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKELG 278

>ADR072C [1813] [Homologous to ScYDL148C (NOP14) - SH]
           (834949..837369) [2421 bp, 806 aa]
          Length = 806

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 107 HTPDINYTNYHTPQPVAPYISENSRGFLERQDPDKTSTSNSIV 149
           H P++ Y        + P+ +ENS+ F  R D DK S S ++V
Sbjct: 563 HVPELAYFLKRALASLLPFSTENSQAFNIRLDSDKLSLSKTLV 605

>YML020W (YML020W) [3945] chr13 (231149..233143) Protein of unknown
           function [1995 bp, 664 aa]
          Length = 664

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 203 LIPGTSISLETEEDIKKWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKETNVLKESRK 262
           ++P  +I       I KWK E    W  R S+  +E  E++ +    LK+ETN +    K
Sbjct: 204 ILPKQTIWNTVTSTIWKWKTE---YWDRRPSSRVREGEEQVQHSQNQLKEETNTVANEAK 260

Query: 263 DKNFIKNIQSQISRANP 279
           D+  +++ +  + R +P
Sbjct: 261 DEERLEHNRGSLFRVDP 277

>KLLA0D03256g complement(271036..273507) some similarities with
           sp|P22149 Saccharomyces cerevisiae YGL071w RCS1
           iron-regulated transcriptional repressor, hypothetical
           start
          Length = 823

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 224 RRKMWLLRISNNKKEHMEKMGYKDEDLKKETNVLKES 260
           +RK W + + NN   H  K     ED KK  N LKES
Sbjct: 240 KRKKWNIVVVNNVHTHPLKFNPDSEDYKKFKNALKES 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.126    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,556,462
Number of extensions: 432566
Number of successful extensions: 1794
Number of sequences better than 10.0: 67
Number of HSP's gapped: 1757
Number of HSP's successfully gapped: 70
Length of query: 373
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 270
Effective length of database: 13,030,455
Effective search space: 3518222850
Effective search space used: 3518222850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)