Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08129g1216119857730.0
YDR097C (MSH6)124297237040.0
Scas_636.17118498136880.0
Kwal_56.23445132997434570.0
KLLA0C17732g119497932640.0
AGR116W116796032510.0
KLLA0C18590g10293514835e-49
CAGL0E00473g10253644603e-46
Kwal_56.226139563524566e-46
ADR168C10323574541e-45
Sklu_2128.210603514523e-45
YOL090W (MSH2)9643374503e-45
AFR603C9563294503e-45
CAGL0I07733g9572824485e-45
Scas_628.39593334325e-43
YCR092C (MSH3)10473524141e-40
KLLA0F02706g9563374076e-40
Kwal_23.646610373724023e-39
Scas_720.10210383633834e-37
ABR137W9552433433e-32
KLLA0F24156g9402113164e-29
Scas_544.28742783139e-29
YHR120W (MSH1)9592453139e-29
KLLA0C16423g9342833112e-28
Kwal_33.147389632433032e-27
CAGL0L13002g9492173022e-27
Scas_697.279481772977e-27
CAGL0I03586g8672632904e-26
Sklu_1903.38992422791e-24
YDL154W (MSH5)9012232753e-24
CAGL0F02167g8951582691e-23
YFL003C (MSH4)8781672422e-20
Scas_707.288811672413e-20
KLLA0F11022g8881732387e-20
CAGL0F01155g110572751.3
YOL034W (SMC5)109339741.5
KLLA0F08613g51179722.7
Scas_557.244653703.8
Scas_718.321001140697.3
Sklu_2438.10676101687.4
Scas_665.1251575688.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08129g
         (1198 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08129g complement(770779..774429) similar to sp|Q03834 Sac...  2228   0.0  
YDR097C (MSH6) [947] chr4 complement(640103..643831) Component w...  1431   0.0  
Scas_636.17                                                          1425   0.0  
Kwal_56.23445                                                        1336   0.0  
KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834 S...  1261   0.0  
AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH] complement(...  1256   0.0  
KLLA0C18590g complement(1642291..1645380) similar to sp|P25336 S...   190   5e-49
CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces cer...   181   3e-46
Kwal_56.22613                                                         180   6e-46
ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH] (997371..10...   179   1e-45
Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement         178   3e-45
YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3...   177   3e-45
AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH] (1524851..1...   177   3e-45
CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharo...   177   5e-45
Scas_628.3                                                            171   5e-43
YCR092C (MSH3) [615] chr3 complement(276760..279903) Component o...   164   1e-40
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...   161   6e-40
Kwal_23.6466                                                          159   3e-39
Scas_720.102                                                          152   4e-37
ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH] complement(6...   136   3e-32
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...   126   4e-29
Scas_544.2                                                            125   9e-29
YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in ...   125   9e-29
KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175 S...   124   2e-28
Kwal_33.14738                                                         121   2e-27
CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces...   120   2e-27
Scas_697.27                                                           119   7e-27
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...   116   4e-26
Sklu_1903.3 YFL003C, Contig c1903 4902-7601                           112   1e-24
YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific prot...   110   3e-24
CAGL0F02167g complement(216080..218767) similar to sp|P40965 Sac...   108   1e-23
YFL003C (MSH4) [1678] chr6 complement(134516..137152) Meiosis-sp...    98   2e-20
Scas_707.28                                                            97   3e-20
KLLA0F11022g complement(1016214..1018880) similar to sp|P40965 S...    96   7e-20
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    33   1.3  
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    33   1.5  
KLLA0F08613g complement(801623..803158) similar to sp|Q12499 Sac...    32   2.7  
Scas_557.2                                                             32   3.8  
Scas_718.32                                                            31   7.3  
Sklu_2438.10 YDL176W, Contig c2438 22731-24761 reverse complement      31   7.4  
Scas_665.12                                                            31   8.1  

>CAGL0G08129g complement(770779..774429) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1216

 Score = 2228 bits (5773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1088/1198 (90%), Positives = 1088/1198 (90%)

Query: 1    MTMPTTPKANKKKVGNTGSSQKKLKQSTLLSFXXXXXXXXXXXXXXXXXXXXXXRESEKE 60
            MTMPTTPKANKKKVGNTGSSQKKLKQSTLLSF                      RESEKE
Sbjct: 1    MTMPTTPKANKKKVGNTGSSQKKLKQSTLLSFFSKQTSPSVSKSKTKVFPSPKSRESEKE 60

Query: 61   DQKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKTPIKDDNIKVKEESTEQND 120
            DQKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKTPIKDDNIKVKEESTEQND
Sbjct: 61   DQKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKTPIKDDNIKVKEESTEQND 120

Query: 121  DDTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVSDDEDSDFXXXXXXXXXXXXX 180
            DDTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVSDDEDSDF             
Sbjct: 121  DDTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVSDDEDSDFKADAVSDADNDDD 180

Query: 181  XXXXXXXVSSIGGFXXXXXXXILALTTNXXXXXXXXXXXXVVQRITPPAAKPKFTMATTG 240
                   VSSIGGF       ILALTTN            VVQRITPPAAKPKFTMATTG
Sbjct: 181  YKSDKSAVSSIGGFDDSDDDDILALTTNKYKKPKAAAPKKVVQRITPPAAKPKFTMATTG 240

Query: 241  PKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS 300
            PKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS
Sbjct: 241  PKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS 300

Query: 301  KMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSFEHWASQFIQ 360
            KMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSFEHWASQFIQ
Sbjct: 301  KMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSFEHWASQFIQ 360

Query: 361  LGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREE 420
            LGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREE
Sbjct: 361  LGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREE 420

Query: 421  PSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIE 480
            PSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIE
Sbjct: 421  PSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIE 480

Query: 481  KHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLK 540
            KHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLK
Sbjct: 481  KHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLK 540

Query: 541  NYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQNLEI 600
            NYYDSNKKVGFSAF            DESLISMKNFTEYNFVKSQNTMVLDGISLQNLEI
Sbjct: 541  NYYDSNKKVGFSAFGGLLYYLKWLKLDESLISMKNFTEYNFVKSQNTMVLDGISLQNLEI 600

Query: 601  FSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELR 660
            FSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELR
Sbjct: 601  FSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELR 660

Query: 661  TKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNELHGALKSYF 720
            TKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNELHGALKSYF
Sbjct: 661  TKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNELHGALKSYF 720

Query: 721  IQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXXDFDKSXXXXXXXXXXXXXXXXXX 780
            IQIPKQLENEVQHWESAFDRRKA              DFDKS                  
Sbjct: 721  IQIPKQLENEVQHWESAFDRRKAVEEGVIIPEVGVEPDFDKSLEKLEGLENELNLLLKSY 780

Query: 781  XXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVA 840
                 TSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVA
Sbjct: 781  MKLLKTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVA 840

Query: 841  EARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPV 900
            EARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPV
Sbjct: 841  EARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPV 900

Query: 901  ICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAA 960
            ICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAA
Sbjct: 901  ICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAA 960

Query: 961  GKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETK 1020
            GKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETK
Sbjct: 961  GKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETK 1020

Query: 1021 RILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRS 1080
            RILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRS
Sbjct: 1021 RILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRS 1080

Query: 1081 HPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNL 1140
            HPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNL
Sbjct: 1081 HPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNL 1140

Query: 1141 EHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVYDNN 1198
            EHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVYDNN
Sbjct: 1141 EHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVYDNN 1198

>YDR097C (MSH6) [947] chr4 complement(640103..643831) Component with
            Msh2p of DNA mismatch binding factor, involved in repair
            of single base mismatches [3729 bp, 1242 aa]
          Length = 1242

 Score = 1431 bits (3704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/972 (69%), Positives = 786/972 (80%), Gaps = 7/972 (0%)

Query: 232  PKFTMATTGPKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPF 291
            P  +  +   K++ FNKQNEERYQWLVDERDAQ+RPK DPEYDPRTLYIPSSAWNKFTPF
Sbjct: 255  PSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPF 314

Query: 292  EKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSF 351
            EKQYWEIKSKMWDCIVFFKKGKFFELYEKDA LANALFD K+AGGGRANMQLAGIPEMSF
Sbjct: 315  EKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSF 374

Query: 352  EHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLA 411
            E+WA+QFIQ+GYKVAKVDQRESMLAKEMREGSKGIVKRELQC+LTSGTL DGDM+HSDLA
Sbjct: 375  EYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLA 434

Query: 412  TYCLAVREEPSNFYDITQPSSATY-----TKIFGVAFIDTSTGEVQMTEFLDDEECSRLD 466
            T+CLA+REEP NFY+ TQ  S+T      TKIFG AFIDT+TGE+QM EF DD EC++LD
Sbjct: 435  TFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLD 494

Query: 467  TLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEE 526
            TLMSQVRP EV++E++NL  LANKIVKF +APNA+FN +K  EEFYD +KT+ E++++E 
Sbjct: 495  TLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSE- 553

Query: 527  AYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQN 586
             YF T + WP VLK+YYD+ KKVGFSAF            D++LISMKN  EY+FVKSQ+
Sbjct: 554  -YFSTEEDWPEVLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMKNIKEYDFVKSQH 612

Query: 587  TMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKR 646
            +MVLDGI+LQNLEIFSNSFDGSDKGTLFKLFN +ITPMGKRMM+KWLM+PLL K DIE R
Sbjct: 613  SMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESR 672

Query: 647  QDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKE 706
             DSV+ L+ +  LR ++E  F+ LPDLER+L+RIH+ ++KVKDF+KVITAFE I+++   
Sbjct: 673  LDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDS 732

Query: 707  IESNELHGALKSYFIQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXXDFDKSXXXX 766
            +++N+L G +  Y    P+ L   V+ W +AF+R+KA              +FDKS    
Sbjct: 733  LKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRI 792

Query: 767  XXXXXXXXXXXXXXXXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKR 826
                                SN+QYKDSGKEIYTIE+P+SATK VP+NWVQM ANK  KR
Sbjct: 793  QELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKR 852

Query: 827  YYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLV 886
            YYSDEVR LARS+AEA+E+HKTLE DL  RLC+KFD  Y+T+WMPT+  ++NIDCLL + 
Sbjct: 853  YYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAIT 912

Query: 887  RTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGN 946
            RTSE LG PSCRP I DEVD  T  +  GF+ FKSLRHPCFNL +   KDFIPND+ LG 
Sbjct: 913  RTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGK 972

Query: 947  KSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIM 1006
            + P +GLLTGANAAGKST+LRM CIAVIMAQ+GCYVP ESA LTPIDRIMTRLGANDNIM
Sbjct: 973  EQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIM 1032

Query: 1007 QGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGF 1066
            QGKSTFFVEL+ETK+ILD+ATNRSLLV+DELGRGGSS+DGF+IAESVLHHVATHIQSLGF
Sbjct: 1033 QGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGF 1092

Query: 1067 FATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIA 1126
            FATHYG+L  SF+ HPQ++P+KMSILVDEATRNVTFLYK+++GQSEGSFGMHVASMCGI+
Sbjct: 1093 FATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGIS 1152

Query: 1127 KSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSV 1186
            K I+DNAQ AADNLEHTSRL+KER  A          VP GLQSDF R+A+GDGL N  +
Sbjct: 1153 KEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKL 1212

Query: 1187 GTGEGVLVYDNN 1198
            G+GEGVL YD N
Sbjct: 1213 GSGEGVLNYDWN 1224

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 4  PTTPKANKKKVGNTGS--SQKKLKQSTLLSF 32
          P TPK +K      GS  SQKK+KQS+LLSF
Sbjct: 3  PATPKTSKTAHFENGSTSSQKKMKQSSLLSF 33

>Scas_636.17
          Length = 1184

 Score = 1425 bits (3688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/981 (70%), Positives = 781/981 (79%), Gaps = 13/981 (1%)

Query: 228  PAAKPKFT-MATTGPKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWN 286
            P  KPK T    T PK   FNKQNEERY WLV+E+DAQ R   DPEYDPRTL+IPSSAW 
Sbjct: 191  PVPKPKRTSQPATQPKAQKFNKQNEERYHWLVNEKDAQGRAPTDPEYDPRTLHIPSSAWG 250

Query: 287  KFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGI 346
            KFT FEKQYWEIKSKMWDC+VFFKKGKF+ELYEKDAFLAN+LFDWKLAGGGRANMQLAG+
Sbjct: 251  KFTAFEKQYWEIKSKMWDCVVFFKKGKFYELYEKDAFLANSLFDWKLAGGGRANMQLAGV 310

Query: 347  PEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMI 406
            PEMSFE+WASQFIQ GYKVAKVDQ+ESMLAKEMREGSKGIVKREL+CVLTSGTL DGDM+
Sbjct: 311  PEMSFEYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVKRELECVLTSGTLTDGDML 370

Query: 407  HSDLATYCLAVREEPSNFY---------DITQPSSATYTKIFGVAFIDTSTGEVQMTEFL 457
            HSDLAT+CLAVREEP +FY         D T PSS    K+FG+AFIDTSTGE+Q+ EF 
Sbjct: 371  HSDLATFCLAVREEPRDFYIDEQTTFTTDSTGPSSIG-KKLFGIAFIDTSTGELQLLEFE 429

Query: 458  DDEECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKT 517
            DD EC++LDT+MSQV+PKE+I+EK+NL +LANKIVKF AAPNA+FN IKP +EFY+FEKT
Sbjct: 430  DDSECTKLDTIMSQVKPKEIIMEKNNLSSLANKIVKFNAAPNAIFNNIKPDQEFYNFEKT 489

Query: 518  HNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFT 577
            ++EL+     YF     WP  LKNYY   KK+GFS F            D++LIS+ N  
Sbjct: 490  YDELITGN--YFEDESKWPETLKNYYKEGKKIGFSTFGGLLYYLKWLKLDQNLISLGNIK 547

Query: 578  EYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPL 637
            EYN ++SQN+++LDG++LQNLEIFSNSFDG+DKGTLFKLFN +ITPMGKRMM+KWLM+PL
Sbjct: 548  EYNPIESQNSLILDGVTLQNLEIFSNSFDGTDKGTLFKLFNRAITPMGKRMMKKWLMHPL 607

Query: 638  LLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAF 697
            L K+DIEKR DS+E LMNN ELR  IES FT LPD+ER+L+RIH+G+LKVKDFD+VI AF
Sbjct: 608  LHKKDIEKRLDSIETLMNNVELRDTIESTFTKLPDVERMLARIHSGTLKVKDFDRVIQAF 667

Query: 698  ENILQMTKEIESNELHGALKSYFIQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXX 757
            E+I+ +   I+  +L GAL  YF QIPK L ++V++W +AFDR KA              
Sbjct: 668  EDIVTLQNSIKDFDLKGALSVYFSQIPKSLIDDVENWTNAFDRIKAVEENIIIPHRGIEP 727

Query: 758  DFDKSXXXXXXXXXXXXXXXXXXXXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQ 817
            +FDKS                        SN+QYKDSGKEIYTIEVPVS TK +P++W Q
Sbjct: 728  EFDKSLDDIQELEDQLQDQLNLYKKRFKNSNIQYKDSGKEIYTIEVPVSITKQIPSDWTQ 787

Query: 818  MGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLA 877
            M ANK+TKRYYS+EVRVLARS+AEARELHK LEN+L  RLC+KFD  Y+T WMPTV  ++
Sbjct: 788  MAANKSTKRYYSEEVRVLARSMAEARELHKALENELKIRLCKKFDAHYNTTWMPTVHVIS 847

Query: 878  NIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDF 937
            NIDCLL L RTSESLG P+CRPV+ DEV+  T  K  G++ F SLRHPCFNL S   KDF
Sbjct: 848  NIDCLLALTRTSESLGYPACRPVLRDEVNLETGTKLNGYLKFTSLRHPCFNLGSSSTKDF 907

Query: 938  IPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMT 997
            IPNDV LG  SP +GLLTGANAAGKSTVLRMTCIAVIMAQ+GCYVP ESA LT  DRIMT
Sbjct: 908  IPNDVELGKDSPQLGLLTGANAAGKSTVLRMTCIAVIMAQMGCYVPCESAELTSFDRIMT 967

Query: 998  RLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHV 1057
            RLGANDNIMQGKSTFFVELSETK+ILDLATNRSLLVLDELGRGGSSNDGF+IAESVLHHV
Sbjct: 968  RLGANDNIMQGKSTFFVELSETKKILDLATNRSLLVLDELGRGGSSNDGFAIAESVLHHV 1027

Query: 1058 ATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGM 1117
            ATHIQSLGFFATHY SLGLSF+ HPQ+KPMKMSILVD+ TRNVTFLYKLV GQSEGSFGM
Sbjct: 1028 ATHIQSLGFFATHYASLGLSFKGHPQVKPMKMSILVDDETRNVTFLYKLVPGQSEGSFGM 1087

Query: 1118 HVASMCGIAKSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAF 1177
            HVASMCGI   IVDNAQ AAD LEHTSRL+KERK    G  +    VP+GLQSDF RL +
Sbjct: 1088 HVASMCGIPSEIVDNAQVAADTLEHTSRLMKERKMLNGGLNEDIITVPMGLQSDFVRLVY 1147

Query: 1178 GDGLNNKSVGTGEGVLVYDNN 1198
            GDGL N S G GEGVL YD N
Sbjct: 1148 GDGLRNTSKGAGEGVLNYDWN 1168

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 17/97 (17%)

Query: 80  AQPEPATEISKASPVASVAVEKTPIKDDNIKVKEE----STEQNDDDTKDTQ-------- 127
           ++ +P+T         +  VE TP  +    VK E    S+E   D T DT         
Sbjct: 35  SKKDPSTATPIKKKPPTPKVEPTPTLEIPSSVKSEGQVPSSESALDQTLDTSFDDESLSN 94

Query: 128 --TVGRVRKRVVSYAEESDSEDD---ITVKKRKRTPV 159
                R  KR V+YAE+SD +DD   ++  +RKRT +
Sbjct: 95  IVKKERSNKRSVNYAEDSDEDDDNIALSSTQRKRTKI 131

>Kwal_56.23445
          Length = 1329

 Score = 1336 bits (3457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/974 (64%), Positives = 761/974 (78%), Gaps = 4/974 (0%)

Query: 228  PAAKPKFTMATTGPKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNK 287
            P+   K + +    K++ F K+NE+RYQWLV+ERDAQ R  DD +YDPRTLYIP SAW K
Sbjct: 340  PSPTHKASSSAGKGKHSNFAKENEDRYQWLVNERDAQGRATDDSDYDPRTLYIPPSAWTK 399

Query: 288  FTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIP 347
            FTPFEKQYWEIKS+MWDCIVFFKKGKFFELYEKDA L N LFD K+AGGGRANMQLAGIP
Sbjct: 400  FTPFEKQYWEIKSRMWDCIVFFKKGKFFELYEKDALLGNHLFDLKIAGGGRANMQLAGIP 459

Query: 348  EMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIH 407
            EMSF++WA QFIQ GYKVAKVDQRESMLAKEMREG+KGIVKRELQ VLTSGTL D  M+ 
Sbjct: 460  EMSFDYWAMQFIQHGYKVAKVDQRESMLAKEMREGNKGIVKRELQHVLTSGTLTDSGMLQ 519

Query: 408  SDLATYCLAVREEPSNFYDITQPSSATY---TKIFGVAFIDTSTGEVQMTEFLDDEECSR 464
            SD AT+CLAVREE  ++YD  + S+ T     K++GVAFIDT+TGE+++ EF DD+ECS+
Sbjct: 520  SDHATFCLAVREEDGSYYDAGEESNGTSQKSAKVYGVAFIDTATGEIELLEFEDDDECSK 579

Query: 465  LDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLAN 524
            LDTLMSQVRPKE+I+EK NLCNLA+KIVK+ A   A+FNY+KP EEFYDF +T +EL ++
Sbjct: 580  LDTLMSQVRPKEIIMEKGNLCNLAHKIVKYNAQSQAIFNYLKPQEEFYDFNRTFDELTSS 639

Query: 525  EEAYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKS 584
            +  YF   D WP +L  YY+  +KVGFSAF            DE++ISM N  EYN V+S
Sbjct: 640  DAKYFSGMDQWPEILTKYYEKGRKVGFSAFGGLLYYLKWLKLDEAMISMGNIKEYNPVRS 699

Query: 585  QNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIE 644
            Q ++VLDG++LQNLEIF NS+D +DKGTLFKL N +ITPMGKRM++KW++ PLL K+DIE
Sbjct: 700  QTSLVLDGVTLQNLEIFGNSYDNTDKGTLFKLVNRAITPMGKRMLKKWVIQPLLQKKDIE 759

Query: 645  KRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMT 704
            +R DSV+LL+ + +LR  +E  F+GLPDLER L+RIH+G+LK+KDF++VI  FE ILQ+ 
Sbjct: 760  QRLDSVDLLLTDCDLRETLEETFSGLPDLERFLARIHSGNLKIKDFNRVIEGFEAILQLL 819

Query: 705  KEIESNELHGALKSYFIQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXXDFDKSXX 764
            ++++  +L G+LK +  Q+P++L   V+ W  AFDR+KA              +FD+S  
Sbjct: 820  EKLQKYQLTGSLKYFLEQVPQKLAECVKSWSGAFDRKKAVNEGVIVPEPGVEPEFDQSLQ 879

Query: 765  XXXXXXXXXXXXXXXXXXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNT 824
                                  S++QYKDSGKEIYTIEVP+SAT+ +P++W+QMGANK+ 
Sbjct: 880  GIKELKDELEEYLSSYKKRFKCSSIQYKDSGKEIYTIEVPMSATRQIPSDWIQMGANKSN 939

Query: 825  KRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLG 884
            KRYYS EV  LARS+AE +E+HK LE  L  RL  KFDT Y  VWMPT+T ++ IDC+L 
Sbjct: 940  KRYYSPEVAKLARSMAEGKEMHKILEEGLKSRLYNKFDTHYKDVWMPTLTAISQIDCILS 999

Query: 885  LVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTL 944
            L RTSESLG P CRP   D+VDP T  K  GF++F+ LRHPCFNL +  ++DFIPND++L
Sbjct: 1000 LARTSESLGFPCCRPKFVDDVDPVTGHKLNGFINFQELRHPCFNLGTTTSRDFIPNDISL 1059

Query: 945  GNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDN 1004
            G  S  IGLLTGANAAGKSTVLRMTCIAVIMAQ+GCY+PAESA+L+PIDRIMTRLGANDN
Sbjct: 1060 GGDSHQIGLLTGANAAGKSTVLRMTCIAVIMAQIGCYIPAESATLSPIDRIMTRLGANDN 1119

Query: 1005 IMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSL 1064
            IMQGKSTFFVELSETK+ILD ATNRSLLVLDELGRGGSS+DGF+IAE VLHHVATHIQSL
Sbjct: 1120 IMQGKSTFFVELSETKKILDTATNRSLLVLDELGRGGSSSDGFAIAEGVLHHVATHIQSL 1179

Query: 1065 GFFATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCG 1124
            GFFATHYG LGL F+ HP+++P+KM+ILVDE +R +TFLYKLV GQSEGSFGMHVASMCG
Sbjct: 1180 GFFATHYGGLGLGFKHHPKVQPLKMNILVDEESREITFLYKLVKGQSEGSFGMHVASMCG 1239

Query: 1125 IAKSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNK 1184
            I K IV+NAQ AA+N EHTS LIKER+ A +G ++   M+PLGLQSD  RL  GDGL+ +
Sbjct: 1240 IGKEIVNNAQQAAENREHTSLLIKERQAADKGVSEE-KMIPLGLQSDLVRLRHGDGLSTQ 1298

Query: 1185 SVGTGEGVLVYDNN 1198
             +G GEGV  YDNN
Sbjct: 1299 KLGCGEGVSFYDNN 1312

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 87/221 (39%), Gaps = 70/221 (31%)

Query: 1   MTMPTTPKANKKK--VGNTGSSQKK-LKQSTLLSFXXXXXXXXXXXXXXXXXXXXXXRES 57
           M  P+TPK N K+   G+  SS KK  KQ+++LSF                         
Sbjct: 57  MVAPSTPKHNSKRRFAGSPQSSGKKNFKQASVLSFFSKHKASASTPL------------- 103

Query: 58  EKEDQKSLFVTDEDTKENVSEVAQPEPATEISKASPV-----ASVAVEKTPIKD------ 106
           ++++ +SLFV +ED  EN S        T  +  +PV     AS  +EKT   +      
Sbjct: 104 KEKNSRSLFVENEDNTENESGFVTAMDETMDTSTAPVTGSATASDDLEKTKTPNSQSASN 163

Query: 107 -----------------DNIKVKEESTEQNDDDTKDTQTV-------------------- 129
                            D+  V  + T ++  +  D  TV                    
Sbjct: 164 NAKSVLAGLDNAENDEGDSADVIAQRTSKDASELSDGTTVHGKEPGKQKEISENDASSQI 223

Query: 130 --GRVRKRVVSYAEESDSEDD----ITVKKRKRTPVSDDED 164
             GR+ KR +SYAE SD +D+    +  KKR++ P  D+E+
Sbjct: 224 SDGRLPKRNISYAELSDDDDEEVLSVGKKKRRQLPSDDEEE 264

>KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1194

 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/979 (61%), Positives = 742/979 (75%), Gaps = 17/979 (1%)

Query: 227  PPAAKPKFTMATTGP---KNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSS 283
            P A  P  ++  T     K+  FNK N ERYQWLV ERDA+ R K DP+YDPRTLYIP  
Sbjct: 208  PLAYNPNRSLPATPKSQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYIPGD 267

Query: 284  AWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQL 343
            AW+KFTPFEKQYWEIKSKMWDCI+FFKKGKFFELYEKDA L + LFD K+AGGGRANMQL
Sbjct: 268  AWSKFTPFEKQYWEIKSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRANMQL 327

Query: 344  AGIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDG 403
            AG+PEMSF++WASQFIQ GYKVAKVDQ+ESMLAKEMREGSKGIV+RELQCVLTSGTL D 
Sbjct: 328  AGVPEMSFDYWASQFIQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDS 387

Query: 404  DMIHSDLATYCLAVREEPSNFYD---ITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDE 460
            +M+ SDLATYC+AVREEP  +YD   +  P +  Y   FG A IDT+TG + + EF DDE
Sbjct: 388  EMLKSDLATYCVAVREEPITYYDEEILALPKTGKY---FGFAAIDTATGHIDLLEFEDDE 444

Query: 461  ECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNE 520
            ECS+LDT+MSQ +P EVI+EK N+C+LA KI+KF A P A+ N  +  +EFYDFEKT +E
Sbjct: 445  ECSQLDTIMSQFKPTEVIMEKSNVCSLAQKIIKFNAQPEAIINQ-RTSKEFYDFEKTFDE 503

Query: 521  LLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYN 580
            L+ +E  YF + D WP+VLK+YY++ KKVGF AF            D SL++M    EYN
Sbjct: 504  LITHE--YFKSMDRWPTVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYN 561

Query: 581  FVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLK 640
             V+SQ  + LDGI+LQNLEIF+N++DG+D+G+LFKL N +ITPMGKR +RKW+M+PLL  
Sbjct: 562  PVRSQTCLALDGITLQNLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKI 621

Query: 641  EDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENI 700
            EDI  R DSV+LL+++  LR  +E+    LPDLER+LSR+H+ SLK++ F+KV+  FE+I
Sbjct: 622  EDINSRLDSVDLLLSDMNLRDLLENELLKLPDLERMLSRVHSCSLKIQYFNKVLCGFEDI 681

Query: 701  LQMTKEIES-NELHGALKSYFIQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXXDF 759
            L + +++    +L G+LKSY  +IP  L   ++ W +AFDR  A              +F
Sbjct: 682  LALVEKLSIFADLKGSLKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVEPEF 741

Query: 760  DKSXXXXXXXXXXXXXXXXXXXXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMG 819
            D+S                       +SN+Q+KDSGKEIYTIEVP++AT+ VP  W QM 
Sbjct: 742  DESMDRIQGIEDQLQECLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMA 801

Query: 820  ANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANI 879
            ANK+ KRYYS +V+ LAR +AEARE+HK LE+DL  RL +KF   Y+ VW+PT+  ++NI
Sbjct: 802  ANKSFKRYYSADVQRLARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNI 861

Query: 880  DCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIP 939
            DC++ L RTSESLG P+CRP + + + P T  K  G++ FK LRHPCFN+ S   K+FIP
Sbjct: 862  DCIISLARTSESLGFPACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIP 921

Query: 940  NDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRL 999
            NDV LG  +P +GLLTGANAAGKSTVLRMTC+AVI+AQLGCY+P E A  TP+DRIMTRL
Sbjct: 922  NDVVLGKDAPQLGLLTGANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRL 981

Query: 1000 GANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVAT 1059
            GA+DNIMQGKSTFFVELSETK+ILDL TNRSLLV+DELGRGGSS+DGF+IAE+VLHHVAT
Sbjct: 982  GASDNIMQGKSTFFVELSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVAT 1041

Query: 1060 HIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHV 1119
            HIQSLGFFATHY +LG SF +HP ++P+KM+ILVDE +RNVTFLYKLVDG+S+GSFGMHV
Sbjct: 1042 HIQSLGFFATHYAALGSSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHV 1101

Query: 1120 ASMCGIAKSIVDNAQSAADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGD 1179
            ASMCGI +S+VDNA  AA+NLEHTS+LIKERK  L    +P   VPLGLQSD  RL +GD
Sbjct: 1102 ASMCGIPRSVVDNASIAAENLEHTSKLIKERKN-LHQSINP---VPLGLQSDVVRLVYGD 1157

Query: 1180 GLNNKSVGTGEGVLVYDNN 1198
            GL N   GTGEGV VYDNN
Sbjct: 1158 GLTNSKGGTGEGVRVYDNN 1176

>AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH]
            complement(960587..964090) [3504 bp, 1167 aa]
          Length = 1167

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/960 (61%), Positives = 727/960 (75%), Gaps = 12/960 (1%)

Query: 242  KNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSK 301
            K++ F+K NEERYQWLVDERDA  RP  DPEYDPRTL+IP+ AW +FTPFEKQYW+IKSK
Sbjct: 194  KHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKSK 253

Query: 302  MWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSFEHWASQFIQL 361
            MWDCIVFFKKGKFFELYEKDA LAN LFD K+AGGGRANMQLAGIPEMSF++WASQFIQ 
Sbjct: 254  MWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQH 313

Query: 362  GYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREEP 421
            GYKVAKVDQ+ESMLAKEMREG+KGIV+RELQCVL+ GTL D  M+HSD +TYCL++ E P
Sbjct: 314  GYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEAP 373

Query: 422  SNFYDITQ-----PSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKE 476
               Y + +     P +    ++FG AFIDT+TG + + EF DD EC++LDTLM+QVRPKE
Sbjct: 374  LALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKE 433

Query: 477  VIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWP 536
            V++EK NL  +A+KIVKF + P+ +FNY +   EFYD+ +T +E+  +   YF   D WP
Sbjct: 434  VVMEKRNLSVIAHKIVKFNSQPDCIFNY-RTSAEFYDYARTFDEV--SNGGYFAGMDSWP 490

Query: 537  SVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQ 596
            ++LK YYD  KKVGFSAF            D+SL+SM    EYN +K+Q ++VLDGI+LQ
Sbjct: 491  AILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQ 550

Query: 597  NLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNN 656
            NLEIF+NSFDG+DKGTLFKL N +ITPMGKR MR W+M+PLL KE IE+R DSV+ L+N 
Sbjct: 551  NLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNE 610

Query: 657  HELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNELHGAL 716
              +R   ES  TGLPDLERLL+R+H+G+L +KDFDKVI  FENI+++   +   EL G+L
Sbjct: 611  MPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSGSL 670

Query: 717  KSYFIQIPKQLENEVQHWESAFDRRKAXXXXXXXXXXXXXXDFDKSXXXXXXXXXXXXXX 776
              +   IP  L+++V+ W + +DR  A              DFD S              
Sbjct: 671  SRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAV 730

Query: 777  XXXXXXXXXTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLA 836
                      S +QYKDSGKE+YTIE+P+S  K VP+NW Q+GANK+TKRYYS +V+ LA
Sbjct: 731  LSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLA 790

Query: 837  RSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPS 896
            RS+AEARELHK LE  L  RL +KFD  +ST W PT+  ++NIDC+L L RTSESLG P+
Sbjct: 791  RSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFPA 850

Query: 897  CRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTG 956
            CRP   DE+DP+T  K  G++ FK LRHPC+N       +FIPNDV LG  +  I LLTG
Sbjct: 851  CRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTG 910

Query: 957  ANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVEL 1016
            ANAAGKST+LRMTCIAVIMAQLGCYVP E A L+P+DRIMTRLGANDNIMQGKSTFFVEL
Sbjct: 911  ANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVEL 970

Query: 1017 SETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGL 1076
            SET++ILD+ATNR+L+VLDELGRGGSS+DGF+IAE VLHH++TH+QSLGFFATHYG+LG 
Sbjct: 971  SETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQ 1030

Query: 1077 SFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSA 1136
            SF  HP +KP++M+ILVDE ++ VTFLYKL++GQSEGSFGMHVA+MCGI +S+V+NA+ A
Sbjct: 1031 SFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERA 1090

Query: 1137 ADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVYD 1196
            A++ EHTSR++KERK  +        +VPLGLQSDF RL FGDGL   ++G+GEGV  YD
Sbjct: 1091 AESFEHTSRILKERKRYINDE----HVVPLGLQSDFVRLVFGDGLKKTALGSGEGVKYYD 1146

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 71/166 (42%), Gaps = 33/166 (19%)

Query: 4   PTTPKANKKKVGNTGSSQKKLKQSTLLSFXXXXXXXXXXXXXXXXXXXXXXRESE--KED 61
           P+TP+ +KK +  T   +K+LKQ+TL+SF                        S   K +
Sbjct: 3   PSTPQQSKKVMQMT-PGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETSTPCKAE 61

Query: 62  QKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKTPIKDDNIKVKEESTEQNDD 121
           Q  LFV D          A  E  T    A               D+  VKEE   Q   
Sbjct: 62  QLQLFVED----------ASDEGETTFVTAH--------------DDGAVKEEGATQ--- 94

Query: 122 DTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVSDDEDSDF 167
              D+Q   R R+R VSYAEESD ED + V+++ R    DDED++F
Sbjct: 95  --VDSQGSAR-RRRSVSYAEESDDEDVVAVRRKTRRMAGDDEDAEF 137

>KLLA0C18590g complement(1642291..1645380) similar to sp|P25336
            Saccharomyces cerevisiae YCR092c MSH3 DNA mismatch repair
            protein, hypothetical start
          Length = 1029

 Score =  190 bits (483), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 188/351 (53%), Gaps = 25/351 (7%)

Query: 789  LQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKT 848
            L YKD+    Y IEV  +  K VP+NWV++ + K   R+ + +   L   +    +L   
Sbjct: 652  LSYKDTKD--YLIEVRNTQAKTVPSNWVKVNSTKAVSRFRTPKTEELVGKLLYHNDLLNL 709

Query: 849  LENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPS 908
            L  D   R  ++   +Y+ +    +  LA  DC+L L  TS ++          + V P 
Sbjct: 710  LAEDEFKRFLQRIVDRYAEI-KTCINNLATYDCILSLAATSSNV----------NYVKPK 758

Query: 909  TKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRM 968
                 Q  V  K+ R+P       ++ +++PNDV + + S  I ++TG N  GKS+ +R 
Sbjct: 759  LTELHQK-VKVKNGRNPII---ESLDVNYVPNDVLMSSNSGKINIITGPNMGGKSSYIRQ 814

Query: 969  TCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATN 1028
              + VIM Q+GCY+PA+SA ++  DRI TR+G++D+++  KSTF VE+SE   IL+ +T 
Sbjct: 815  VALLVIMTQIGCYIPADSAEMSICDRIFTRIGSHDDLLNAKSTFQVEMSEVLHILNSSTP 874

Query: 1029 RSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQS--LGFFATHYGSLGLSFRSHPQIKP 1086
            RSLL+LDE+GRG  ++DG SI+ ++L++      +  L  F THY +L         I  
Sbjct: 875  RSLLLLDEVGRGTGTHDGLSISFAILNYFVYLADNCPLVLFITHYSALCQI--DSKLIAN 932

Query: 1087 MKMSILVD----EATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNA 1133
              MS +      E   NV FLYKLV GQ+  S+G +VA +  I   I++ A
Sbjct: 933  YHMSYIEKHQPGEKWTNVIFLYKLVLGQAHNSYGFNVAKLSNIPTEIINRA 983

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 190/466 (40%), Gaps = 95/466 (20%)

Query: 287 KFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRA------- 339
           K T  ++Q+ E+K K  D I+  + G  ++ + KDA + + +   KL  G +        
Sbjct: 148 KLTELDQQFKELKLKHMDTILCVRVGYKYKFFAKDAEIVSNILQIKLVPGKKTLDESDPN 207

Query: 340 -----NMQLAGIPEMSFEHWASQFIQLGYKVAKVDQRE-SMLAKEMREGSKGIVKRELQC 393
                  Q   IP+        + +   YKVA V+Q E S L K    GS  +  RE++ 
Sbjct: 208 DRNYRKFQYCSIPDTRLHVHLQRLVFFNYKVAVVEQTETSALKKNNNSGS--LFTREIKN 265

Query: 394 VLTSGTL-------VDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDT 446
           + T  +           D I  DL +       E S    +   S            +  
Sbjct: 266 IFTKVSYGINETFDKSEDRILGDLTSVWAISINETSKMRKVNLIS------------VQL 313

Query: 447 STGEVQMTEFLDDEECS-RLDTLMSQVRPKEVIIEK------HNLCNLANKIVKFC---- 495
           ++GE+   +F DD   +  L+  +  + P E+I E+        +    N+ ++F     
Sbjct: 314 NSGEIVHDQFSDDILLNVNLEARIRYLNPTEIITEEELPPSIRTIFTKLNQDIQFYQSHK 373

Query: 496 -AAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAF 554
            A PN LF+ ++ +    D       LL+   +Y  T +    +   Y+ SN    +S+F
Sbjct: 374 EACPN-LFDALQGL----DLNNELKRLLSVLHSYLSTFENTKVL---YFASN----YSSF 421

Query: 555 XXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLF 614
                            + KNF           MVL   ++++LEIF NS      G+L 
Sbjct: 422 -----------------TAKNF-----------MVLPRNTIESLEIFENSTTNKTNGSLL 453

Query: 615 KLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGL---- 670
            + +++ T  G R++RKW+  PL+  + I  RQD++  +M   E+ +     F  L    
Sbjct: 454 WVMDHTRTQFGYRLLRKWISKPLIDLKSILDRQDAITCIMK--EVHSIFFESFNELLRKS 511

Query: 671 PDLERLLSRIHAGSLKVKD---FDKVITAFENILQMTKEIESNELH 713
            DLER L+RI  GS   K+   F K I  F ++ +       ++LH
Sbjct: 512 IDLERALNRIAYGSTSRKEVYFFLKQIATFASLFKSHHTFIHDQLH 557

>CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces
            cerevisiae YCR092c DNA mismatch repair protein,
            hypothetical start
          Length = 1025

 Score =  181 bits (460), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 193/364 (53%), Gaps = 41/364 (11%)

Query: 788  NLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHK 847
            +L YKD     + IEV  +  K +P++WV++   K   R+ +             +EL +
Sbjct: 648  HLAYKDEVD--FLIEVRNTQVKGIPSDWVKVNNTKMISRFLT----------PRTKELVE 695

Query: 848  TLE--NDLNF-RLCRKFD------TQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCR 898
             LE  NDL +  + +++D        Y       +  LA  DCLL L   S ++G    R
Sbjct: 696  LLEYQNDLLYNEISKEYDQFLNRIASYYNEVKTFIMNLAEYDCLLSLAAVSCNVGY--TR 753

Query: 899  PVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGAN 958
            PV  D          +  +  K  R+P       +  D++PND+ +   S  + ++TG N
Sbjct: 754  PVFTDS--------NEQLIIAKQARNPII---ESLGVDYVPNDIEMEKDSGRVLVITGPN 802

Query: 959  AAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSE 1018
              GKS+ +R   + VIMAQ+G YVPAES  L+  D ++TR+G+ DNI+QG+STF VELSE
Sbjct: 803  MGGKSSYIRQIALMVIMAQIGSYVPAESLKLSVFDNVLTRIGSQDNILQGQSTFKVELSE 862

Query: 1019 TKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQS-LGFFATHYGSLGLS 1077
            T  I++  T+++LL+LDE+GRG S+ DG +IA +++ +     Q     F TH+ ++  +
Sbjct: 863  TVEIINSCTSKTLLLLDEVGRGTSTRDGNAIAWALIKYFVEEEQCPFILFTTHF-TIVTT 921

Query: 1078 FRSHPQIKPMKMSILV----DEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNA 1133
             +S P +K   M+ +     +E    V FLY+L  G ++ S+G++VA + GI   I++ A
Sbjct: 922  VKS-PLLKSYHMNYVQHKNENENWTTVVFLYQLKAGVTDSSYGLNVAKLAGIDTHIINRA 980

Query: 1134 QSAA 1137
               A
Sbjct: 981  HDVA 984

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 79/151 (52%), Gaps = 13/151 (8%)

Query: 577 TEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNP 636
           + Y     + ++ L   ++ NL++ SN  D S KGTLF + +++ TP GKR++++WL+ P
Sbjct: 416 SNYRHFSQKISIQLQAQTINNLDLISN--DDS-KGTLFWILDHTRTPFGKRLLKEWLLRP 472

Query: 637 LLLKEDIEKRQDSVELLMN--NHELRTKIESVFTGLPDLERLLSRIHAGS-------LKV 687
           LL K+ I  R ++++ ++   N      +  +  G+PDL R ++R+  G          +
Sbjct: 473 LLSKDAIVDRLNAIDCILESANSIFFESLNQMMKGIPDLLRTINRVSFGKTSQREVYFLL 532

Query: 688 KDFDKVITAFENILQMTKEIESNELHGALKS 718
           K    VI  FE       E+E N   GA+K+
Sbjct: 533 KQLTGVIKHFEAHKDYI-EVEINSNSGAIKT 562

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/134 (19%), Positives = 56/134 (41%), Gaps = 15/134 (11%)

Query: 257 LVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFE 316
           L+DE D      +  E D   +       ++ TP ++Q  ++K    D ++  + G  ++
Sbjct: 120 LIDESD---EIAEQSEADEHNIKKKRKKSDQLTPLDRQVKDLKLGNMDKVLVIRVGYKYK 176

Query: 317 LYEKDAFLANALFDWKLAGG------------GRANMQLAGIPEMSFEHWASQFIQLGYK 364
           ++ +DA +A+ +   +L  G                      P++  +    + ++ G K
Sbjct: 177 IFAQDAIIASTILHLQLIPGKVTIDDSNPNDSKYKQFAYCSFPDVRLKVHLERLVRSGLK 236

Query: 365 VAKVDQRESMLAKE 378
           VA V+Q E+   K+
Sbjct: 237 VAVVEQSETATTKK 250

>Kwal_56.22613
          Length = 956

 Score =  180 bits (456), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 181/352 (51%), Gaps = 24/352 (6%)

Query: 809  KYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTV 868
            KY+  + V+ G   +TK     E++ +A   A  ++ +  L++DL  +   +    Y+ V
Sbjct: 551  KYLELSTVKAGIYFSTK-----ELKQIAEQTAALQKEYDRLQSDL-VKEIVQITLTYTPV 604

Query: 869  WMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFN 928
                   LAN+D L      S     P  RP++            Q   +    RHP   
Sbjct: 605  LEKLSIVLANLDVLSSFAHVSSYAPIPYVRPLM-------HGLGTQRKTELIGSRHPVLE 657

Query: 929  LDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESAS 988
            +   V   FI NDV L        ++TG N  GKST +R   +  +MAQ+GC+VP ++A 
Sbjct: 658  VLDDVT--FISNDVKLEKGKNEFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCDTAE 715

Query: 989  LTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFS 1048
            +  +D ++ R+GA D+ ++G STF VE+ ET  IL  AT  SL+++DELGRG S+ DGF 
Sbjct: 716  IAVVDAVLCRVGAGDSQLKGVSTFMVEMLETASILKNATENSLIIVDELGRGTSTYDGFG 775

Query: 1049 IAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEA------TRNVTF 1102
            +A S+  H+A+ I+    FATH+  L       P +K M +   +++A      + ++T 
Sbjct: 776  LAWSISEHIASKIKCFALFATHFHELTSLADQIPTVKNMHVIAHIEDAEKSNHNSEDITL 835

Query: 1103 LYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLE---HTSRLIKERK 1151
            LYK+  G S+ SFG+HVA +    + IV  A+  A  LE   H S+ +K++K
Sbjct: 836  LYKVEPGISDQSFGIHVAEVVQFPRKIVSMAKRKAAELEELKHDSQTLKKQK 887

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 132/307 (42%), Gaps = 58/307 (18%)

Query: 429 QPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEK----HNL 484
           QP++     + GV+FID+S+ ++ M + +D+E  S L++ + Q+  +E ++ +     N+
Sbjct: 147 QPNAQEGNCVLGVSFIDSSSYKIGMLDIVDNEVYSNLESFLIQMGVRECLLPELRSNENV 206

Query: 485 CNLANKIVKFCAAPNALFNYIKPVEEFY--DFEKTHNELLANEEA-----YFGTADGWPS 537
            +   K+V        +  ++K   EF   D E+   +L+ +E +     +   A G  +
Sbjct: 207 ASELKKMVSVLDRCGCVSTFVKN-SEFAPKDVEQDLIKLVGDELSMSLMKFSNLALGSCN 265

Query: 538 VLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNT--MVLDGISL 595
            L NY                         + + S      Y  V+   T  M LD  +L
Sbjct: 266 ALLNYL------------------------QLMNSESQLGRYELVQHSLTEFMKLDASAL 301

Query: 596 QNLEIF--------------SNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKE 641
           + L IF               N+       ++F+L N   T  G R++ +WL  PL   E
Sbjct: 302 KALNIFPVGPATTSGPPVAHGNTSSTGKISSIFQLLNKCKTNAGIRLLNEWLKQPLTDLE 361

Query: 642 DIEKRQDSVELLMNNHELRTKIESVFT-GLPDLERLLSRIHAGS-----LKVKDFDKVIT 695
            I+KR D VE L++  ELR  +++ +   +PD+ RL  +++        LK+  F + + 
Sbjct: 362 AIQKRHDLVEFLIDQLELRQVLQTDYLPAVPDVRRLTKKLNKNGNLEDVLKIYQFAQKVP 421

Query: 696 AFENILQ 702
               +L+
Sbjct: 422 EVSKVLE 428

>ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH]
            (997371..1000469) [3099 bp, 1032 aa]
          Length = 1032

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/357 (34%), Positives = 195/357 (54%), Gaps = 37/357 (10%)

Query: 789  LQYKDSGKEI-YTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHK 847
            L YKD   EI + +E+  +    VP +WV++ + K   R+ +      A+ VA+  + HK
Sbjct: 646  LNYKD---EIDFLVEIRNTQVSSVPVDWVKVASTKAVSRFQTPGT---AKLVAKL-QYHK 698

Query: 848  TLENDLNFR----LCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICD 903
             L  DL  +      ++   +Y+++    +  L+  DC+L       SL   SC     D
Sbjct: 699  ELLQDLALQEYESFIKRITGEYTSL-RKAILHLSTYDCIL-------SLAATSCN---VD 747

Query: 904  EVDPSTKCKKQGFVDFKSLRHPCF-NLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGK 962
             V P      Q  ++  + R+P   +LD R    ++PNDV L  +   I ++TG N  GK
Sbjct: 748  YVRPKFNTAPQC-INVINGRNPIIESLDVR----YMPNDVNLNREGKKIMIITGPNMGGK 802

Query: 963  STVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRI 1022
            S+ +R   + VIMAQ+GCYVPA+ A  +  D+I TR+GA DN+++  STF +E++E  +I
Sbjct: 803  SSYIRQVALLVIMAQIGCYVPAQEAEFSIFDQIFTRIGAYDNLLRNDSTFKIEMTEMVQI 862

Query: 1023 LDLATNRSLLVLDELGRGGSSNDGFSIAESVLHH-VATH-IQSLGFFATHYGSLGLSFRS 1080
            L  +T  SLL+LDE+GRG  ++DG SI+ ++L + +  H    L  F THY SLG S RS
Sbjct: 863  LRSSTENSLLLLDEVGRGTGTHDGISISYALLRYFIELHNACPLILFITHYASLG-SIRS 921

Query: 1081 HPQIKPMKMSILVD----EATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNA 1133
             P +    MS + +    E   +V FLYKL +G++  S+G++VA +  I   I++ A
Sbjct: 922  -PILGNYHMSYIEEKRPGENWPSVVFLYKLKEGRAHNSYGLNVAKLADIQTGIINRA 977

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 106/475 (22%), Positives = 201/475 (42%), Gaps = 62/475 (13%)

Query: 237 ATTGPKNNTFNKQNE-----------ERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAW 285
           AT G ++  FN++ E           ER Q +++ R+     +D+ E D        +  
Sbjct: 78  ATRGFEDFRFNRRREACGKEQEVGFAERLQRIMERREGGCVEEDETELDNEAPRSKRAKP 137

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGG-------- 337
           N+ T  ++Q+ ++K +  D ++  + G  ++ + +DA + + +   KL  G         
Sbjct: 138 NRLTELDQQFKDLKLQHMDKVLAVRVGYKYKFFAEDAVMVSRVLQIKLVPGKLTVHETDP 197

Query: 338 ----RANMQLAGIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQC 393
                       IP+   E    + +    KV  V+Q E+   K+    S  +  RE+  
Sbjct: 198 ADHKHKKFAYCTIPDTRLEVHLQRLMHHNLKVGVVEQTETSAVKKNSGTSSSVFSREVTN 257

Query: 394 VLTSGTLVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQM 453
           + T  T      I+    T    V  + ++ + +      +YT+ F V+ ++ ++GEV  
Sbjct: 258 IFTRATY----GINETFGTKDRRVLGDSASVWGLVCKRQPSYTRYFLVS-VNLNSGEVIF 312

Query: 454 TEFLDDEECSR-LDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFY 512
            +F ++   +  L+T +    P EV++       L ++I K     ++            
Sbjct: 313 DDFKEERFLTEALETRIKYTNPSEVVVGD----GLGSEIEKVFHTSDS------------ 356

Query: 513 DFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLIS 572
           D      EL+   E  F  ++  P+   N       V                 +ESL+ 
Sbjct: 357 DITLNRIELVGLYEEIF--SEPHPAFKGN-------VPLQTALMLVHGYLTNFKNESLLF 407

Query: 573 MK-NFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRK 631
            K NF  +    S+  M+L   ++++L+IF NS D S KG+L  + +++ T  G R ++ 
Sbjct: 408 FKENFKPFC---SKTHMILPSSAIESLDIFENSTDRSSKGSLLWVLDHTRTNYGLRNLKN 464

Query: 632 WLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGL---PDLERLLSRIHAG 683
           W+  PL+  + I++R D+V+ + +       IES+   L    DLER+L+RI  G
Sbjct: 465 WIAKPLINIDQIQQRLDAVQCI-STEVGNIFIESLNNMLRDGQDLERILNRIAYG 518

>Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement
          Length = 1060

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 184/351 (52%), Gaps = 25/351 (7%)

Query: 789  LQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKT 848
            L YKD     + IEV  +  K VP +WV++ + K   R+ + E   L   +   +EL   
Sbjct: 685  LNYKDDID--FLIEVRNTQVKNVPVSWVKINSTKMVSRFRTPETTKLVEKLQYHKELLIK 742

Query: 849  LENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPS 908
            +  +      ++    Y  +    +  LA  DC+L L  TS ++            V P+
Sbjct: 743  VAEEEYLDFLKRIGENYMDL-KKAIQNLATYDCILSLAATSSNVNY----------VRPT 791

Query: 909  TKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRM 968
             K +KQ  +  K+ R+P       ++ +++PND+ +  K   + ++TG N  GKS+ +R 
Sbjct: 792  FKAEKQH-LKIKNGRNPII---ESLDVNYVPNDIEMTQKMNKVMVITGPNMGGKSSYIRQ 847

Query: 969  TCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATN 1028
              I VIM+Q+G +VPAESA L+  D I TR+GA DNI++G+STF+VE+ E  +IL   T 
Sbjct: 848  VAIIVIMSQVGAFVPAESAELSLCDAIYTRIGATDNILRGESTFYVEMLEMLQILKSCTE 907

Query: 1029 RSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQS--LGFFATHYGSLGLSFRSHPQIKP 1086
             SLL+LDE+GRG  + DG +I  S+L       +   L  F THY  LG + +S   +  
Sbjct: 908  NSLLLLDEVGRGTGTTDGIAITYSILKFFLELQEKCPLILFTTHYPVLG-TIKS-KLLGN 965

Query: 1087 MKMSILVD----EATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNA 1133
              MS + +    E   +V FLYKL  G +  S+G++VA +  +  SI++ A
Sbjct: 966  YHMSYIEEKRPNENWPSVVFLYKLRKGLAHNSYGLNVARLANVPTSIINRA 1016

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 115/485 (23%), Positives = 191/485 (39%), Gaps = 82/485 (16%)

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGG--------- 336
           N  TP ++QY ++K K  D I+  + G  ++ + +DA +   +    L  G         
Sbjct: 178 NNLTPLDQQYKDLKLKNMDKILAVRVGYKYKFFAQDAVIVTQILHNMLIPGKLTIDDSDP 237

Query: 337 -GRANMQLA--GIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQC 393
             +   Q A   IP+        + I    K+  V+Q E+   K+   G   + +RE+  
Sbjct: 238 QDKLYKQFAYCSIPDNRLNIHLQKLIHYNLKIGVVEQVETSAVKKNNGGGSSVFEREVTN 297

Query: 394 VLTSGTLVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQM 453
           V T  T      I+ +  +    V  E +  + +   S + Y K + +  +  ++GEV  
Sbjct: 298 VFTRATY----GINENFGSSEKHVIGESNTIWGLHFESESKY-KNYWLISVKVNSGEVTY 352

Query: 454 TEFLDDEECS-RLDTLMSQVRPKEVIIEK---HNLCNLANKIVKFCAAPNALFNYIKPVE 509
            EF ++   + +L+T +  + P EV+ +    H++C +  +       P+  F    P E
Sbjct: 353 DEFKEEVALNEQLETRLKYLEPIEVVSKNELPHDVCKIFRR-----ENPDIKFYQSDP-E 406

Query: 510 EFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSN--KKVG-FSAFXXXXXXXXXXXX 566
                EK   + L   E            LK Y   N  K  G F AF            
Sbjct: 407 NDSCLEKVLVDKLGLSERLRQVTQILYRYLKTYSIENVLKITGNFKAFS----------- 455

Query: 567 DESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGK 626
                            S+  M L   +L++LEIF+N  D   KG+L  + +++ T  G 
Sbjct: 456 -----------------SKTHMTLSAGTLESLEIFNNHTDKGVKGSLIWVLDHTRTAFGF 498

Query: 627 RMMRKWLMNPLLLKEDIEKRQDSVELLMN--NHELRTKIESVFTGLPDLERLLSRIHAGS 684
           + ++ W+  PL+  +DIE R D++E +    N      + ++    PDL R+L+RI  G 
Sbjct: 499 QQLKDWIAKPLIHLKDIEDRLDAIECITTEVNMIFVESLNNMLKDTPDLLRILNRITYGK 558

Query: 685 LKVKD---FDKVITAFENILQ-----------------MTKEIESNELHGALKSYF--IQ 722
              K+   F K I  F  +                    TK I   EL   L +Y    Q
Sbjct: 559 TSRKEVYFFLKHINLFVKLFADHYKYLEEHIYSKIGRVATKSILLTELFKELDTYLKECQ 618

Query: 723 IPKQL 727
           IPK L
Sbjct: 619 IPKLL 623

>YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3p and
            Msh6p of DNA mismatch binding factor, involved in repair
            of single base mismatches and short insertions/deletions
            [2895 bp, 964 aa]
          Length = 964

 Score =  177 bits (450), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/337 (32%), Positives = 179/337 (53%), Gaps = 20/337 (5%)

Query: 865  YSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRH 924
            Y+ V+      LA++D +     TS     P  RP    ++ P    ++   +   S RH
Sbjct: 606  YTPVFEKLSLVLAHLDVIASFAHTSSYAPIPYIRP----KLHPMDSERRTHLI---SSRH 658

Query: 925  PCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPA 984
            P   +   ++  FI NDVTL +   +  ++TG N  GKST +R   +  +MAQ+GC+VP 
Sbjct: 659  PVLEMQDDIS--FISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPC 716

Query: 985  ESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSN 1044
            E A +  +D I+ R+GA D+ ++G STF VE+ ET  IL  A+  SL+++DELGRG S+ 
Sbjct: 717  EEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTY 776

Query: 1045 DGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATR------ 1098
            DGF +A ++  H+A+ I     FATH+  L       P +K M +   +++  +      
Sbjct: 777  DGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKEQKHDD 836

Query: 1099 -NVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAA---DNLEHTSRLIKERKEAL 1154
             ++T LYK+  G S+ SFG+HVA +    + IV  A+  A   D+L+  +  +K+ K +L
Sbjct: 837  EDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELDDLKTNNEDLKKAKLSL 896

Query: 1155 QGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEG 1191
            Q   + G++    L  ++ R    +GL++ S  T E 
Sbjct: 897  Q-EVNEGNIRLKALLKEWIRKVKEEGLHDPSKITEEA 932

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 601 FSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELR 660
           F+++ +     +LF+L N+  T  G R++ +WL  PL   ++I KR D V+ L++  ELR
Sbjct: 326 FTSAGNSGKVTSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYLIDQIELR 385

Query: 661 TKIESVFTGL-PDLERLLSRIHAGS-----LKVKDFDKVI 694
             + S +  + PD+ RL  +++        LK+  F K I
Sbjct: 386 QMLTSEYLPMIPDIRRLTKKLNKRGNLEDVLKIYQFSKRI 425

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 29/43 (67%)

Query: 438 IFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIE 480
           I GVAFIDT+  +V M + +D+E  S L++ + Q+  KE +++
Sbjct: 156 IIGVAFIDTTAYKVGMLDIVDNEVYSNLESFLIQLGVKECLVQ 198

>AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH]
            (1524851..1527721) [2871 bp, 956 aa]
          Length = 956

 Score =  177 bits (450), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/329 (34%), Positives = 164/329 (49%), Gaps = 21/329 (6%)

Query: 865  YSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRH 924
            YS V       LAN+D L      S     P  RPV+ D      K      ++  + RH
Sbjct: 600  YSPVLEKLSLVLANLDVLCSFAHVSSYAPIPYVRPVMYDMHAGQRK------MELLASRH 653

Query: 925  PCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPA 984
            P       V   FI NDV L   S    ++TG N  GKST +R   +  ++AQ+GC+VP 
Sbjct: 654  PLVEAQDEVT--FISNDVVLEADSSGFAIITGPNMGGKSTYIRQVGVICLLAQIGCFVPC 711

Query: 985  ESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSN 1044
            ++A +T +D I+ R+GA D+ ++G STF  E+ ET  IL  AT  SL+++DELGRG S+ 
Sbjct: 712  DAAEITIVDAILCRVGAGDSQLKGVSTFMAEMLETASILRNATKNSLIIIDELGRGTSTY 771

Query: 1045 DGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATR---NVT 1101
            DGF +A S+  H+A +I     FATH+  L       P +  + +   V+E +    ++T
Sbjct: 772  DGFGLAWSISEHIAKNIGCFALFATHFHELTALADDCPNVTNLHVVAHVEEKSHKSDDIT 831

Query: 1102 FLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLEHTSRLIKERKEALQG----- 1156
             LYK+  G S+ SFG+HVA +      IV  A+  A  L+     IKE  E L+      
Sbjct: 832  LLYKVEPGISDQSFGIHVAEVVQFPSKIVKMAKRKATELDD----IKEETECLKKLKCSP 887

Query: 1157 -HADPGSMVPLGLQSDFTRLAFGDGLNNK 1184
             H   GS V   L  ++  +   + L+ +
Sbjct: 888  EHIAKGSEVLKNLLQEWASILRAENLDQQ 916

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 123/292 (42%), Gaps = 47/292 (16%)

Query: 438 IFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVII----EKHNLCNLANKIVK 493
           + GV+++D+++ ++ M + +D+E  S  ++ + Q+  KE ++       +      K+  
Sbjct: 156 VLGVSYVDSNSYKIGMLDIVDNEVYSNFESFLIQLGVKECLLPDLRNNESFSAELKKVTG 215

Query: 494 FCAAPNALFNYIKPVE-EFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDS-NKKVGF 551
                  +  ++K  E    D E    +L  +E      A   P   K    S N  +G+
Sbjct: 216 VIERCGCVVTFVKNSEFNNKDVEADLAKLCGDE-----LATSLPRFSKLALASCNALIGY 270

Query: 552 SAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNT--MVLDGISLQNLEIF-------- 601
                             L +  N   Y  V+   +  M LD  +++ L IF        
Sbjct: 271 QQL---------------LNNAGNEGSYQIVEYSLSEFMKLDASAVKALSIFPQGPSTQS 315

Query: 602 ----SNSFDGSDKGT-LFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNN 656
               S  F G+ K T L +L N   T  G R++ +WL  PL  K  IEKR + V+ L++ 
Sbjct: 316 GMATSGKFGGNGKITSLLQLLNKCKTNAGVRLLNEWLKQPLSDKGSIEKRHNLVDYLVDQ 375

Query: 657 HELRTKIESVFTGL-PDLERLLSRIHA-GS----LKVKDFDKVITAFENILQ 702
            ELR+ +   +  L PD+ RL  +++  GS    LKV  F + I     +L+
Sbjct: 376 LELRSILRDDYLPLVPDVRRLTKKLNRNGSLEDVLKVYQFAQRIPEINGVLK 427

>CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharomyces
            cerevisiae YOL090w MSH2 DNA mismatch repair protein,
            start by similarity
          Length = 957

 Score =  177 bits (448), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 153/282 (54%), Gaps = 14/282 (4%)

Query: 865  YSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRH 924
            Y+ ++      +A++D L      S     P  RP +     P +  ++   ++    RH
Sbjct: 603  YTPIFEKLSLVIAHLDVLCSFAHASSYAPIPYVRPTM----HPLSSDRRTKLMNS---RH 655

Query: 925  PCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPA 984
            P   +   V   FI NDV +        ++TG N  GKST +R   +  +MAQ+GC+VP 
Sbjct: 656  PVLEVQDDVT--FIANDVDMAKDVSEFQIITGPNMGGKSTYIRQVGVITLMAQIGCFVPC 713

Query: 985  ESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSN 1044
            ++A ++ +D I+ R+GA D+ ++G STF VE+ ET  IL  AT+ SL+++DELGRG S+ 
Sbjct: 714  DNAEISIVDAILCRVGAGDSQLKGVSTFMVEMLETASILKNATSNSLIIVDELGRGTSTY 773

Query: 1045 DGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATR-----N 1099
            DGF +A ++  H+A  I+    FATH+  L       P +K M +   +DE+ +     +
Sbjct: 774  DGFGLAWAIAEHIAKEIRCFALFATHFHELTNLSEQLPNVKNMHVIAHIDESEKALNSND 833

Query: 1100 VTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLE 1141
            +T LYK+  G S+ SFG+HVA +    K IV  A+  A+ LE
Sbjct: 834  ITLLYKVEPGISDRSFGIHVAEVVQFPKKIVSMAKRKANELE 875

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 127/305 (41%), Gaps = 73/305 (23%)

Query: 438 IFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNLCNLAN-------K 490
           I G+ FIDTS  ++ M + +D+E  S L++ + Q+  +E ++   +     N        
Sbjct: 156 ILGLTFIDTSNYKIGMMDIIDNEAYSNLESFLIQLGIRECLVPDLSQNGSTNPELKKITN 215

Query: 491 IVKFCAAPNALFNYIKPVEEFY--DFEKTHNELLANE------EAYFGTADGWPSVLKNY 542
           ++  C +       I P  EF   D E    +LL N+      +     A G  + L NY
Sbjct: 216 VIDRCGSVVT----IVPNSEFSNKDVEVDLAKLLGNDLTLTLPQNVSQLALGACNALLNY 271

Query: 543 YDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKS--QNTMVLDGISLQNLEI 600
                                    + L   +   +Y  ++   ++ M LD  +++ L +
Sbjct: 272 L------------------------QLLSEQEMLGKYELIQHSLESIMKLDSSAIKALNL 307

Query: 601 F-----------SNSFDGSDKGT----LFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEK 645
           F            +   GS+ GT    LF+L NN  T  G R++ +WL  PL     I+ 
Sbjct: 308 FPQNNATFFTPMQSGTVGSNGGTKVASLFQLLNNCKTNSGVRLLNEWLKQPLTDFSGIQV 367

Query: 646 RQDSVELLMNNHELRTKIESVFT-GLPDLERLLS------------RIHAGSLKVKDFDK 692
           R + VE L++  ELR  +++ +  G+PD+ RL+             +++  SLKV D   
Sbjct: 368 RHNLVEFLIDQLELRQILQTEYLPGVPDIRRLVKKLNKNGTLEDVLKVYQFSLKVPDIIN 427

Query: 693 VITAF 697
           +I +F
Sbjct: 428 IIESF 432

>Scas_628.3
          Length = 959

 Score =  171 bits (432), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 169/333 (50%), Gaps = 15/333 (4%)

Query: 814  NWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTV 873
            N++++   K    + + E++ +A+   + ++ +  L++ L  +        Y+ V     
Sbjct: 553  NYLELSTVKAGIFFSTKELKEIAQETIKLQKDYDRLQSAL-VKEIVGITVTYTPVLEKLS 611

Query: 874  TCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRV 933
              LA++D L      S     P  RP    ++ P    ++   V     RHP   +   +
Sbjct: 612  QVLAHLDVLCSFAHVSSYAPIPYVRP----KMHPFDSTRRTHLV---GSRHPVLEMQDDL 664

Query: 934  NKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPID 993
               FI NDV L +   +  ++TG N  GKST +R   +  +MAQ+GC+VP E A +  +D
Sbjct: 665  T--FISNDVDLVDGEGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVD 722

Query: 994  RIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESV 1053
             I+ R+GA D+ ++G STF VE+ ET  IL  AT  SL+++DELGRG S+ DGF +A ++
Sbjct: 723  AILCRVGAGDSQLKGVSTFMVEMLETASILKNATKNSLIIVDELGRGTSTYDGFGLAWAI 782

Query: 1054 LHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEAT-----RNVTFLYKLVD 1108
              H+A+ I     FATH+  L         +K M +   +++ T      ++T LYK+  
Sbjct: 783  AEHIASKIGCFALFATHFHELTSLSDKFSNVKNMHVVAYIEKGTDQLESDDITLLYKVEP 842

Query: 1109 GQSEGSFGMHVASMCGIAKSIVDNAQSAADNLE 1141
            G S+ SFG+HVA +      IV  A+  A  LE
Sbjct: 843  GISDQSFGIHVAEVVQFPDKIVKMAKRKASELE 875

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 135/311 (43%), Gaps = 56/311 (18%)

Query: 429 QPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNLCNLA 488
           Q +S     + GVAFIDTS  ++ M + +D+E  S L++ + Q+  +E I++  +L N  
Sbjct: 147 QVNSKEGNSVLGVAFIDTSNYKIGMLDIVDNEVYSNLESFLIQLGVRECIVQ--DLTNNE 204

Query: 489 N------KIVKFCAAPNALFNYIKPVE-EFYDFEKTHNELLANE------EAYFGTADGW 535
           N      KI+       ++   +K  E    D E    +L+ NE      + Y   A G 
Sbjct: 205 NTSREFKKIIGVIDRCGSVVTLVKNSEFSEKDVEMDLTKLINNELSLSLPKKYSNLAMGA 264

Query: 536 PSVLKNYYDS-NKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGIS 594
            + L  Y +  N++     F                       E++    Q  M LD  +
Sbjct: 265 CNALLGYLELLNEQDQLGKF--------------------ELIEHSL---QEFMKLDASA 301

Query: 595 LQNLEIF------------SNSF---DGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLL 639
           ++ L +F            + SF    G    +LF+L NN  T  G R++ +WL  PL  
Sbjct: 302 IKALNLFPQGPVQPFGPTPTASFGTASGGKIASLFQLLNNCKTNAGIRLLNEWLKQPLTD 361

Query: 640 KEDIEKRQDSVELLMNNHELRTKIES-VFTGLPDLERLLSRIHAGSLKVKDFDKVITAFE 698
              IE+R D V+ L++  ELR  +++     +PDL RL  +++     ++D  K+    +
Sbjct: 362 LARIEQRHDLVDYLIDQLELRQMLQTDTLPMIPDLRRLTKKLNKNG-NLEDVLKIFQFSQ 420

Query: 699 NILQMTKEIES 709
            I ++ + +ES
Sbjct: 421 KIPEVAQLLES 431

>YCR092C (MSH3) [615] chr3 complement(276760..279903) Component of DNA
            mismatch binding factor along with Msh2p, involved in
            mismatch repair involving microsatellite (short repeat)
            sequences [3144 bp, 1047 aa]
          Length = 1047

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 109/352 (30%), Positives = 188/352 (53%), Gaps = 24/352 (6%)

Query: 799  YTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFR-L 857
            Y IEV  S  K +P +W+++   K   R+ +   + L + +   ++L    E++L ++  
Sbjct: 678  YLIEVKNSQIKDLPDDWIKVNNTKMVSRFTTPRTQKLTQKLEYYKDL-LIRESELQYKEF 736

Query: 858  CRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFV 917
              K   +Y+ +   T+  LA  DC+L       SL   SC     + V P+    +Q  +
Sbjct: 737  LNKITAEYTELRKITLN-LAQYDCIL-------SLAATSCN---VNYVRPTFVNGQQAII 785

Query: 918  DFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQ 977
              K+ R+P       ++  ++PND+ +  ++  I ++TG N  GKS+ +R   +  IMAQ
Sbjct: 786  A-KNARNPII---ESLDVHYVPNDIMMSPENGKINIITGPNMGGKSSYIRQVALLTIMAQ 841

Query: 978  LGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDEL 1037
            +G +VPAE   L+  + ++TR+GA+D+I+ G STF VE+ +   IL     RSLL+LDE+
Sbjct: 842  IGSFVPAEEIRLSIFENVLTRIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEV 901

Query: 1038 GRGGSSNDGFSIAESVLHHVATHIQS-LGFFATHYGSLGLSFRSHPQIKPMKMSILVDEA 1096
            GRG  ++DG +I+ +++ + +      L  F TH+  LG   +S P I+   M  + ++ 
Sbjct: 902  GRGTGTHDGIAISYALIKYFSELSDCPLILFTTHFPMLG-EIKS-PLIRNYHMDYVEEQK 959

Query: 1097 T----RNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLEHTS 1144
            T     +V FLYKL  G +  S+GM+VA +  + K I++ A S ++ L   S
Sbjct: 960  TGEDWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIINRAFSISEELRKES 1011

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 106/452 (23%), Positives = 188/452 (41%), Gaps = 81/452 (17%)

Query: 287 KFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGG---------- 336
           K TP +KQ  ++K    D ++  + G  ++ + +DA   + +   KL  G          
Sbjct: 160 KLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNPQ 219

Query: 337 --GRANMQLAGIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSK--GIVKRELQ 392
                       P++       + +    KVA V+Q E+   K+   G+    + +R++ 
Sbjct: 220 DCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGASKSSVFERKIS 279

Query: 393 CVLTSGT-------LVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFID 445
            V T  T       ++ G  I  D  +     R       D+ Q   A Y+ I     ++
Sbjct: 280 NVFTKATFGVNSTFVLRGKRILGDTNSIWALSR-------DVHQGKVAKYSLIS----VN 328

Query: 446 TSTGEVQMTEF----LDDEECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNAL 501
            + GEV   EF    L DE   +L   +  ++P EV++   +L     K  K  + P   
Sbjct: 329 LNNGEVVYDEFEEPNLADE---KLQIRIKYLQPIEVLVNTDDLPLHVAKFFKDISCP--- 382

Query: 502 FNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSA----FXXX 557
                               L +++ Y    D    V++     N+K+  S         
Sbjct: 383 --------------------LIHKQEY----DLEDHVVQAIKVMNEKIQLSPSLIRLVSK 418

Query: 558 XXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLF 617
                    +E ++ + +   Y+   S+  M+LD  SLQ+L+IF++  DG  KG+LF L 
Sbjct: 419 LYSHMVEYNNEQVMLIPSI--YSPFASKIHMLLDPNSLQSLDIFTH--DGG-KGSLFWLL 473

Query: 618 NNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELL---MNNHELRTKIESVFTGLPDLE 674
           +++ T  G RM+R+W++ PL+    IE+R D++E +   +NN      +  +    PDL 
Sbjct: 474 DHTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFESLNQMLNHTPDLL 533

Query: 675 RLLSRIHAGSLKVKD---FDKVITAFENILQM 703
           R L+RI  G+   K+   + K IT+F +  +M
Sbjct: 534 RTLNRIMYGTTSRKEVYFYLKQITSFVDHFKM 565

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
            Kluyveromyces lactis mismatch repair protein Msh2p, start
            by similarity
          Length = 956

 Score =  161 bits (407), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 107/337 (31%), Positives = 167/337 (49%), Gaps = 18/337 (5%)

Query: 809  KYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFRLCRKFDTQYSTV 868
            KY+  + V+ G   +TK     E++ +A   +E ++ ++  +  L  +        Y+ V
Sbjct: 549  KYIELSTVKAGIFFSTK-----ELKNIAEETSELQKKYEQQQASL-VKEIVSITLSYTPV 602

Query: 869  WMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFN 928
                    A +D L    + S     P  RP +    D +         +  + RHP   
Sbjct: 603  LEKLSVVTAQLDILCSFAQVSSYAPIPYVRPKMYPLNDQNRT------TELIASRHPIVE 656

Query: 929  LDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESAS 988
            +   V   FI NDV L        ++TG N  GKST +R   +  +MAQ+GC+VP + A 
Sbjct: 657  MQDDVT--FISNDVKLVQGDSEFIVITGPNMGGKSTYIRQIGVICLMAQIGCFVPCDEAK 714

Query: 989  LTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFS 1048
            +  +D I+ R+GA D+ ++G STF +E+ ET  IL  AT+ SL+++DELGRG S+ DGF 
Sbjct: 715  IAAVDAILCRVGAGDSQLKGVSTFMMEMLETASILKNATHNSLVIVDELGRGTSTYDGFG 774

Query: 1049 IAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILV-DEATRN---VTFLY 1104
            +A S+  H+AT+I     FATH+  L         +  M +   + D  + N   +T LY
Sbjct: 775  LAWSISEHIATNINCFTLFATHFHELTTLADKLDNVSNMHVVAHIEDNGSHNSDDITLLY 834

Query: 1105 KLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLE 1141
            K+  G S+ SFG+HVA +      IV+ A+  A  LE
Sbjct: 835  KVEAGSSDQSFGIHVAEVVQFPSKIVNMAKRKAAELE 871

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 140/319 (43%), Gaps = 52/319 (16%)

Query: 431 SSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVII----EKHNLCN 486
           +++ Y  I GV+F+D +   + + + LD+E  S L++ + Q+  KE +I    +  ++ N
Sbjct: 153 AASNYCTI-GVSFVDNTNYRIGLFDLLDNEVFSNLESCLIQLGIKECLIPDLRDNPSMAN 211

Query: 487 LANKIVKFCAAPNALFNYIKPVE-EFYDFEKTHNELLANE-----EAYFGTADGWPSVLK 540
              KI+      + + +++KP +    D E    +L  +E       +     G  SVL 
Sbjct: 212 DLKKILSVIDRCSCVASFVKPSDFNGKDVEADLAKLCGDELSLSVSKFSANCLGACSVLL 271

Query: 541 NYYD-SNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQNLE 599
           NY +  N +     F            D SL          FVK      LD  +++ L 
Sbjct: 272 NYLNIMNNEANVGNFEVV---------DHSL--------SQFVK------LDASAIKALN 308

Query: 600 IFSNSFDGSDK----------GTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDS 649
           +F     G+             +LF+L N   T  G R++ +WL  PL   + I KR D 
Sbjct: 309 VFPTGSQGNTALLSVGSPQKCSSLFQLLNRCKTNSGVRLLNEWLKQPLTDIDQITKRHDL 368

Query: 650 VELLMNNHELRTKI-ESVFTGLPDLERLLSRIHAGS-----LKVKDFDKVITAFENIL-Q 702
           VE  M+  ELR+ + E     +PD+ RL  ++         LK+  F +++    ++L Q
Sbjct: 369 VEFFMDQLELRSSLQEECLPSVPDIRRLTKKLQKNGNLEDVLKIYQFAQMVPVISDLLKQ 428

Query: 703 MTKEIESNELHGALKSYFI 721
            T+E++SN+L   +K   +
Sbjct: 429 KTEEVDSNDLMILVKEVLL 447

>Kwal_23.6466
          Length = 1037

 Score =  159 bits (402), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 113/372 (30%), Positives = 185/372 (49%), Gaps = 35/372 (9%)

Query: 791  YKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLE 850
            YKD  +  + IEV  +    +P +W+++G+ K   R+ + +   L   +   + L   + 
Sbjct: 660  YKDEIE--FLIEVRNTQLTGLPTDWIKVGSTKMVSRFKTPKTTKLIDQLDYHKNLLVIIC 717

Query: 851  NDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTK 910
            ++   R      +QY  +    +  LA  DC+L L  TS        RP  C+       
Sbjct: 718  DEQFKRFLANISSQY-LLLKEVIENLATFDCMLSLAATS--FNRQYVRPQFCE------- 767

Query: 911  CKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTC 970
               +  +  ++ R+P       ++ +++ NDV +      + ++TG N  GKS+ +R   
Sbjct: 768  --GRREMKIRNGRNPII---ESLDVNYVANDVYMKEDQSKLLIITGPNMGGKSSFIRQVA 822

Query: 971  IAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRS 1030
            +  I+AQ+G +VPAESA+L     I TR+GA+DN+++G STF VE+ E   IL  +   S
Sbjct: 823  LISILAQVGSFVPAESANLPIFSNIFTRIGAHDNLIKGDSTFKVEMLEMLDILKNSDENS 882

Query: 1031 LLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGF--FATHYGSLGLSFRSHPQIKPMK 1088
            LL+LDE+GRG  + DG SI+++ +++     +   F  F THY  LG S +S P I+   
Sbjct: 883  LLLLDEVGRGTGTTDGISISDATINYFIDMDKKCPFILFITHYPILG-SIKS-PLIENYH 940

Query: 1089 MSIL----VDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNA----------Q 1134
            M  +      E      FLYKL  G +  S+G++VA +  +  SI++NA           
Sbjct: 941  MGFMEERRAGEKWPTAVFLYKLTQGIATDSYGLNVARLANLPMSIINNAYVVSEGVKAEM 1000

Query: 1135 SAADNLEHTSRL 1146
             AA NL  TS+L
Sbjct: 1001 EAAKNLRFTSKL 1012

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 96/439 (21%), Positives = 188/439 (42%), Gaps = 64/439 (14%)

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGG--------- 336
           +K TP ++Q  ++K +  D ++  + G  ++ +  DA + + +    L GG         
Sbjct: 150 DKLTPLDQQVKDLKLQHMDKVLAVRVGYKYKFFAMDAVIVSKILQIMLIGGKLTLDNSHP 209

Query: 337 -GRANMQLA--GIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQC 393
             RA  QLA   IP+   +    + +    KV  V+Q E+   K+    S G+ +R++  
Sbjct: 210 GDRAYKQLAYCSIPDNRLQVHIQRLLHHNLKVGVVEQTETQAIKKANGSSSGVFRRQVDK 269

Query: 394 VLTSGTLVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQM 453
           V T  T      I+ + +   +   EE +  + +       +   F +  +  S+GEV  
Sbjct: 270 VFTKATF----SINENFSRTQINPSEEINTIWALRVDEDDQFYH-FWLFSVQLSSGEVIY 324

Query: 454 TEFLDDEECSRLDT--LMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEF 511
            +F D+++  +L+    +S ++P E I+ K  L  L +  ++            +P  +F
Sbjct: 325 DQFSDNKKLVKLELEKRISYLQPIE-IVSKGTLSPLISTFIR----------KRQPDVQF 373

Query: 512 YDFEKTHNELLANEEA----YFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXD 567
           +D++    ++  +++              + L+ Y ++                      
Sbjct: 374 HDYDSLLPDVCEDDQVGGLNLEKELLELRNTLRRYLEN-------------------YNT 414

Query: 568 ESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKR 627
           E ++ + +   Y    S+  M+L   +L++LEIF N  DG+ +G+L  L +++ T  G R
Sbjct: 415 EKVMDIPH--NYKPFHSKTNMILSSNTLESLEIFENQTDGNSRGSLMWLLDHTRTSFGYR 472

Query: 628 MMRKWLMNPLLLKEDIEKRQDSVELLMN--NHELRTKIESVFTGLPDLERLLSRIHAGSL 685
           ++R+W+  PL  K+ I +R D+VE       +     + +V    PD  R L+RI+ G  
Sbjct: 473 LLREWISRPLTDKDSINERLDAVECTKQEVTNIFMEALGNVLKDTPDFLRNLNRIYYGQT 532

Query: 686 K-------VKDFDKVITAF 697
                   +K  DKV   F
Sbjct: 533 SRSEVYNFLKHLDKVAKHF 551

>Scas_720.102
          Length = 1038

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 191/363 (52%), Gaps = 32/363 (8%)

Query: 789  LQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKT 848
            L YKD  +  Y IEV  +    +P++W+++       R+ +     L     E  + HK 
Sbjct: 662  LNYKDEIE--YLIEVKNTQVTNLPSDWIKINNTLKISRFATPTTTKLV----EKLQFHKD 715

Query: 849  L---ENDLNF-RLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDE 904
            L   E +  + R   K + +Y  +    +  +A  DCLL L  ++ S      RP+  +E
Sbjct: 716  LLVQEVEKEYQRFLSKINDEYIRL-RNIIENIATYDCLLSL--SAVSCNIKYTRPIFSNE 772

Query: 905  VDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKST 964
                     +  +  K  R+P       ++ +++PND  +  K   I +++G N  GKS+
Sbjct: 773  ---------KQVIKLKGARNPII---ESLDINYVPNDTDMNRKDGLINIISGPNMGGKSS 820

Query: 965  VLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILD 1024
             +R   + +I+AQ+G +VPA+   ++  D I+TR+GA+D++++G+STF  E+ +  ++L+
Sbjct: 821  YIRQVALLIILAQIGSFVPADYMEVSIFDNILTRIGAHDDLLRGESTFKKEMLDVLQVLE 880

Query: 1025 LATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQS-LGFFATHYGSLGLSFRSHPQ 1083
              T  SL++LDE+GRG  + DG +I+ S++++        L  F +H+  LG + +S P 
Sbjct: 881  NCTKDSLVLLDEVGRGTGTLDGKAISYSLINYFMEETDCPLILFTSHFPILG-TIKS-PL 938

Query: 1084 IKPMKMSILVD----EATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADN 1139
            +K   M  + +    E   +VTFLYKL  G +  S+G++VA +  I K I++ A   +++
Sbjct: 939  VKCYHMDYVEEKRPGENWSSVTFLYKLKSGFTTNSYGLNVAKLASIDKDIINEAYEISES 998

Query: 1140 LEH 1142
            +++
Sbjct: 999  MKN 1001

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 99/453 (21%), Positives = 188/453 (41%), Gaps = 81/453 (17%)

Query: 264 QKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAF 323
           Q+ P++D +  P        + +K TP ++Q  E+KS   + ++  + G  ++ + +DA 
Sbjct: 130 QRVPEND-DVRPSRKKKAKISKSKLTPLDQQIQELKSIHKNKLLVVRVGYKYKCFAEDAI 188

Query: 324 LANALFDWKLAGG----------GRANMQLA--GIPEMSFEHWASQFIQLGYKVAKVDQR 371
           +A+ +   KL  G           + + Q A    P+        + I    KV  V+Q 
Sbjct: 189 IASKILKIKLVPGKLTIDESNPADKDHKQFAYCSFPDTRLNVHLERLIYNNCKVGVVEQA 248

Query: 372 ESMLAKEMREGSKG--IVKRELQCVLTSGT--------LVDGD-MIHSDLATYCLAVREE 420
           E+   K+  + S    + +R++  + +  T        L  G+ ++ +  + + L + E 
Sbjct: 249 ETSAIKKNSQTSNKSQVFERKITGIFSKATYGVNSPHDLKGGNNLLGNTKSIWALNIDE- 307

Query: 421 PSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVR---PKEV 477
                     S A   + + +  ++ ++GEV   EF   E    L +L  +++   P E+
Sbjct: 308 ----------SLAQQKRFYSLLSVNLNSGEVIYDEFF--EPLHTLYSLKERIKYLEPVEI 355

Query: 478 IIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYD--FEKTHNELLANEEAYFGTADGW 535
           +                          +KP+  + D  F +++ ++  NE     T +  
Sbjct: 356 VT-------------------------LKPLPRYVDILFNESNCKVTINEIE--NTNEAI 388

Query: 536 PSVLKNYYDSNK-KVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVK--SQNTMVLDG 592
            S LK   +  K  +  S              +E ++    F   NF K  +   M L  
Sbjct: 389 QSSLKIVANKLKFSLELSKLLETLYIYLQEYNNERIL----FISTNFAKFLANQHMTLSD 444

Query: 593 ISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVEL 652
            +L+ L+I  N  DG +KG+L  L +++ T  G R +R W+++PL   + IE+R D++E 
Sbjct: 445 STLEGLDILRN--DG-EKGSLLWLLDHTRTSFGLRKLRDWVLHPLRTIDKIEERLDAIEC 501

Query: 653 LMN--NHELRTKIESVFTGLPDLERLLSRIHAG 683
           ++   N         +  GLPDL R L+RI  G
Sbjct: 502 ILKEINCIFLESFNQLLKGLPDLLRTLNRIAYG 534

>ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH]
            complement(653115..655982) [2868 bp, 955 aa]
          Length = 955

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 87/243 (35%), Positives = 128/243 (52%), Gaps = 17/243 (6%)

Query: 900  VICDEVDPSTKCKKQGFVDFKSLRHPCF--NLDSRVNKDFIPNDVTLGNKSPNIGLLTGA 957
            ++C +VD S+  +  G       RH      L SR   +F  ND +L N   +I ++TG 
Sbjct: 715  LVCPQVDESSALEIVGG------RHLVVEDGLQSRAPGNFTANDCSLQNG--DIWIVTGP 766

Query: 958  NAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELS 1017
            N  GKST LR T I VI+AQ+GCYVP  SA +  +D+I +R+G+ D++    STF VE+ 
Sbjct: 767  NMGGKSTFLRQTAIIVILAQIGCYVPCASAHIGLVDKIFSRVGSADDLYNDMSTFMVEML 826

Query: 1018 ETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLS 1077
            E+  +L  AT RSL +LDE+GRG ++ DG  IA + LHH+ T  +    FA+H+G   LS
Sbjct: 827  ESSFMLKGATKRSLAILDEIGRGTNAEDGVGIAYTTLHHMLTKNRCRALFASHFGR-ELS 885

Query: 1078 FRSHPQIKPMKMSIL------VDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVD 1131
                  + P     +      V E      + +K+  G    S  + VA M G  +  +D
Sbjct: 886  ELVEQHLPPGARKRVHFYRTNVREHNGRSFYDHKITPGICLSSDAIRVAQMAGFPQEALD 945

Query: 1132 NAQ 1134
             A+
Sbjct: 946  VAR 948

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 83/400 (20%), Positives = 165/400 (41%), Gaps = 28/400 (7%)

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELY----EKDAFLANALFDWKLAGGGRANM 341
           N   P  +   ++  K  D ++  + G F+ELY    EK A   N     +    G+  +
Sbjct: 71  NSLPPSLQFVRDMMDKYPDYVLLTQMGSFYELYYEHAEKYAPKLNITLTRREYSHGK--V 128

Query: 342 QLAGIP-EMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTL 400
             AG P E    H      + GY VA V+Q       ++ +  +    R +  V+T GT 
Sbjct: 129 PFAGFPLEQLSRHLKVLVKEYGYSVAVVEQ---FRKDDIADNERYKFNRRVTRVVTPGTF 185

Query: 401 VDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDE 460
           +D    +     + L+V         ++ PS        G+++ D STGE+    F+   
Sbjct: 186 IDEAFENLQENQFLLSVEFPDRCMEKLSDPSIKV-----GLSWCDISTGEL----FVQQV 236

Query: 461 ECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNE 520
           +   L + +++++P+E+++ +  L   A +I      P  L  + K   ++Y     H  
Sbjct: 237 QLKGLISAITKIKPREILLSEDLL---AYQIQNGNWYPE-LVEFKKYFIKYYKTPSRHRT 292

Query: 521 LLANEEAY-FGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEY 579
           +      + FG  +     L     S  +   +A             +  +++   F + 
Sbjct: 293 METFSHLFAFGANNASKRNLDIVLHSLSQKETAALRANLTYIEQHLPE--MLANLAFPKR 350

Query: 580 NFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLL 639
           +   + ++M +D  +   LE+ +   D   +G+L      ++TP G R++ +WL  P + 
Sbjct: 351 SL--TTDSMQIDSRTSAALELHNTFRDNLKRGSLLSAIRRTVTPSGTRLLTQWLSAPSMH 408

Query: 640 KEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSR 679
            ++I++RQ+ V L M N  +   + +      D+ R+L +
Sbjct: 409 LDEIKQRQNLVRLFMQNPFVTDNLIAQLKATADMTRILQK 448

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1 DNA mismatch repair protein,
            mitochondrial, hypothetical start
          Length = 940

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 117/211 (55%), Gaps = 11/211 (5%)

Query: 937  FIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIM 996
            F PND  +   S  + ++TG N  GKST LR   I VI+AQ+G +VP ESA +  +D+I 
Sbjct: 734  FTPNDCQIN--SGELWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCESAVIGLVDKIF 791

Query: 997  TRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHH 1056
            +R+G+ D++    STF VE+ ET  IL  ATNRS+ +LDE+GRG S ++G +IA + L +
Sbjct: 792  SRVGSADDLYNEMSTFMVEMIETSYILKGATNRSMAILDEIGRGTSRSEGVAIAYATLKY 851

Query: 1057 VATHIQSLGFFATHYGS-LGLSFRSHP------QIKPMKMSILVDEATRNVTFLYKLVDG 1109
            + T+      FATH+G+ L  +  S         I   K  I+ D +  N  + +KL  G
Sbjct: 852  LTTNNACRALFATHFGTELASTINSTSNEEFINNISFFKTGIIGDNS--NFYYDHKLKPG 909

Query: 1110 QSEGSFGMHVASMCGIAKSIVDNAQSAADNL 1140
                S  + VA + G  +  ++ A +  + +
Sbjct: 910  ICSKSDAIKVAKLAGFPEEALEIASTLLEEI 940

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/417 (20%), Positives = 155/417 (37%), Gaps = 59/417 (14%)

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGG--RANMQL 343
           N   P  +   ++  K    +V  + G F+ELY + A +   + +  L         +  
Sbjct: 67  NSLPPSLQYVRDVMDKYTGHVVLTQIGSFYELYFEHATIYAPILNITLTSKSIVSGKVPF 126

Query: 344 AGIPEMSF-EHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVD 402
           AG P      H      Q GY VA  DQ +    + + +  K    R +  ++T GT +D
Sbjct: 127 AGFPLNQLNRHLKVLVKQYGYSVAVCDQFKH---ETLVDNDKNKFMRRVTRIVTPGTFID 183

Query: 403 GDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEEC 462
               +     Y L V     +F +     +A      G+++ D STGE+    F+     
Sbjct: 184 EAFENFQENQYLLTV-----HFSENCMKRAADLNIPVGLSWCDISTGEI----FVQQVYL 234

Query: 463 SRLDTLMSQVRPKEVIIEKH-------------NLCNLANKIVKFCAAPNALFNYIKPVE 509
             L + ++++RP EV++++               L  L    +K+   P+      +P++
Sbjct: 235 KDLVSSITRIRPMEVLLDEEIMPVEITNGEWYKELTELKKYFIKYQKMPSKH----RPIQ 290

Query: 510 EFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDES 569
            F+       +L +N E   G + G                F+              +E 
Sbjct: 291 SFF-------KLFSNAEGDIGRSLG---------------NFTQKEIAALRNLLLYIEEH 328

Query: 570 LISMKNFTEYNFVKSQ---NTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGK 626
           L  +   T     + Q   + M +D  +   LE+ S       KG+L      ++T  G 
Sbjct: 329 LPDIN--TNLELPQKQLITDIMQIDSRTSTALELHSTMRKHHKKGSLLSTIRRTVTTSGT 386

Query: 627 RMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAG 683
           R++ +WL  P +   +I+ RQ  V L  +N +    +        D+ R++ R   G
Sbjct: 387 RLLTQWLSAPSMDINEIKNRQSLVLLFKDNFDYTESLIRYLKETADMSRIIQRFSFG 443

>Scas_544.2
          Length = 874

 Score =  125 bits (313), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 141/278 (50%), Gaps = 40/278 (14%)

Query: 917  VDFKSLRHPCFNLDSRVNKDFIPNDVTL-------------GNKSPNIGLLTGANAAGKS 963
            +D KS RHP +     +   +IPND+ L             GNK   IG++TGANA+GKS
Sbjct: 560  LDIKSGRHPLY---ENIVDTYIPNDLELLGGSFDDTSWSREGNK--RIGIITGANASGKS 614

Query: 964  TVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRIL 1023
              L  T + V +A +GC+VP +SA +  +DRI+TR    D +   KS+F ++  +  R L
Sbjct: 615  VFLIQTGLIVYLAHIGCFVPCDSARIGLVDRILTRTRTQDTVSLLKSSFELDSLQMARCL 674

Query: 1024 DLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFA-THYGSL---GLSFR 1079
               + +SL+++DE G+G    DG S+  +++  +A         A TH+  L    +   
Sbjct: 675  SQMSKKSLILIDEFGKGTDIIDGPSLFGAIIQQLAESKDCPRVLACTHFHELFNTDVLDE 734

Query: 1080 SHPQIKPMKMSILVDEA---------TRNV--TFLYKLVDGQSEGSFGMHVASMCGIAKS 1128
            + P +      +L+++A          +NV  TFLY++ +G S  SFG++ A +CGI +S
Sbjct: 735  AFPGVNYYMTQVLLNQAHISSSRDTLCKNVGITFLYRIKEGISRQSFGVYCAKICGIKES 794

Query: 1129 IVDNAQSAA-------DNLEHTSRLIKERKEALQGHAD 1159
            IV  A+          D +++  RL K+     Q + +
Sbjct: 795  IVKRAEELTSIRNDGYDVIDYCRRLSKDELTIFQNNQE 832

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (52%), Gaps = 10/119 (8%)

Query: 594 SLQNLEIFSNSFDGSDKG------TLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQ 647
           SLQ L IF  +  G+DK       ++ +L N+      K +++ WL+ PL  K++IE R 
Sbjct: 220 SLQILPIFKKT--GTDKTIGKRDMSILELLNHVSNGYSKNILKSWLLAPLRKKKEIETRY 277

Query: 648 DSVELLM--NNHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMT 704
           D V++ +  NN     +I+ +F G PDL  +L ++  G+  V  +  ++   E  +++T
Sbjct: 278 DVVDIFLGKNNSLFFEEIQEIFKGFPDLFNILKQLQHGNESVTIWTNLVQFLERAIRLT 336

>YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in
            mitochondrial DNA repair, homolog of E. coli MutS [2880
            bp, 959 aa]
          Length = 959

 Score =  125 bits (313), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 123/245 (50%), Gaps = 16/245 (6%)

Query: 898  RPVICDEVDPSTKCKKQGFVDFKSLRHPCF--NLDSRVNKDFIPNDVTLGNKSPNIGLLT 955
            R ++C +VD S K      ++  + RH      L +R  + F  N+  L     N+ ++T
Sbjct: 719  RNLVCPKVDESNK------LEVVNGRHLMVEEGLSARSLETFTANNCELAK--DNLWVIT 770

Query: 956  GANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVE 1015
            G N  GKST LR   I VI+AQ+GC+VP   A +  +D++ +R+G+ D++    STF VE
Sbjct: 771  GPNMGGKSTFLRQNAIIVILAQIGCFVPCSKARVGIVDKLFSRVGSADDLYNEMSTFMVE 830

Query: 1016 LSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLG 1075
            + ET  IL  AT RSL +LDE+GRG S  +G SIA + L ++  + Q    FATH+G   
Sbjct: 831  MIETSFILQGATERSLAILDEIGRGTSGKEGISIAYATLKYLLENNQCRTLFATHFGQEL 890

Query: 1076 LSFRSHPQIKPMKMSI------LVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSI 1129
                 +   K M   +      + D    N  + +KL  G    S  + VA + G     
Sbjct: 891  KQIIDNKCSKGMSEKVKFYQSGITDLGGNNFCYNHKLKPGICTKSDAIRVAELAGFPMEA 950

Query: 1130 VDNAQ 1134
            +  A+
Sbjct: 951  LKEAR 955

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/437 (20%), Positives = 181/437 (41%), Gaps = 34/437 (7%)

Query: 304 DCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRAN--MQLAGIPEMSFEHWASQFIQ- 360
           D +V  + G F+ELY + A       +  L     ++  +  AG P           +  
Sbjct: 95  DHVVLTQMGSFYELYFEQAIRYAPELNISLTNRAYSHGKVPFAGFPVHQLSRHLKMLVNN 154

Query: 361 LGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREE 420
            GY V   +Q +    K++ +       R +  ++T GT +D    +    TY L + E 
Sbjct: 155 CGYSVTIAEQFKK---KDVADNEANKFYRRVTRIVTPGTFIDEAFENLRENTYLLNI-EF 210

Query: 421 PSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIE 480
           P N       +S       G+ + D STGE+    F+       L + +++++PKE++++
Sbjct: 211 PENCMSQVADTSLK----VGICWCDVSTGEI----FVQQVYLRDLVSAITRIQPKEILLD 262

Query: 481 KHNLCNLANKIVKFCAAPNALFNYIKPVEEFY-DFEKTHNELLANEEAY----FGTADGW 535
           +        ++++F       +  +  +++F+  ++K  ++    E  Y     G  +  
Sbjct: 263 E--------RLLEFHIESGTWYPELVELKKFFIKYQKMPSQHRTIESFYGLFNLGGKEAT 314

Query: 536 PSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISL 595
              LK  + +  +   +A             D S+    NF       +   M +D  + 
Sbjct: 315 ERQLKIQFQTFTQKELAALRNTLIYVSNHLPDFSI----NFQIPQRQLATAIMQIDSRTS 370

Query: 596 QNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMN 655
             LE+ S   D + KG+L      ++TP G R++ +WL  P L  ++I+KRQ  V    +
Sbjct: 371 TALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKEIKKRQKIVAFFKD 430

Query: 656 NHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNE--LH 713
           N ++   + ++   + DL R+L +   G  +  +  ++  + E   ++ K + +N   + 
Sbjct: 431 NRDITETLRTMLKKVNDLSRILQKFSFGRGEALELIQMARSLEVSREIRKYLLNNTSLMK 490

Query: 714 GALKSYFIQIPKQLENE 730
             LKS   Q+ + L  E
Sbjct: 491 ATLKSQITQLTESLNFE 507

>KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175
            Saccharomyces cerevisiae YDL154w MSH5 meiosis-specific
            protein, start by similarity
          Length = 934

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 147/283 (51%), Gaps = 37/283 (13%)

Query: 875  CLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVN 934
            C A ++ L+   +T+  +     +PVI +         K+  ++ ++ RHP +  ++ V+
Sbjct: 596  CFAELEVLVSFAKTA--ISQNYVQPVIEE---------KECVIEIENGRHPLY--ETLVD 642

Query: 935  KDFIPNDV----------TLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPA 984
              +IPND+          T  N    I ++TGANA+GKS  L    + V +A +GC+VPA
Sbjct: 643  T-YIPNDLRMLGGTFDNDTWNNNFKRISVITGANASGKSVFLTQNGLIVFLAHIGCFVPA 701

Query: 985  ESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSN 1044
            ++A +  +D+I+TR+   +++ + +STF ++ ++  + L LAT RSLL++DE G+G    
Sbjct: 702  DNARIGLVDKILTRVVTRESVAKTQSTFEIDANQMSKCLSLATPRSLLLIDEFGKGTDVI 761

Query: 1045 DGFSIAESVLHHVATHIQSLGFFA-THYGSL-----------GLSF-RSHPQIKPMKMSI 1091
            DG S+  +++   +         A THY  +           G+ F ++   ++ M+   
Sbjct: 762  DGLSMFGAIIKDFSRSSSCPRVIASTHYNEVFSPNILTSEINGVVFYKTEILLQVMEKEN 821

Query: 1092 LVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQ 1134
              +     +TFLYKL  G +  SFG+  A  CG+ +SIV  AQ
Sbjct: 822  KGNARDEMITFLYKLSTGIATNSFGIFCAKNCGLRQSIVQRAQ 864

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 611 GTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMN--NHELRTKIESVFT 668
            ++F L N++ + +GKR+++ WL +PL  K  IE+RQ  +  L++  N  L   + +   
Sbjct: 306 SSVFDLLNHTTSELGKRLLKSWLASPLSNKILIEERQKVIRSLIDGKNAILFDDLSNSLK 365

Query: 669 GLPDLERLLSRIHAGSLKVKDFDKVIT 695
            +P++  +++ +  G++K+  + K I+
Sbjct: 366 YMPNIFSIVNEMSKGAVKLSVWRKYIS 392

>Kwal_33.14738
          Length = 963

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 124/243 (51%), Gaps = 16/243 (6%)

Query: 900  VICDEVDPSTKCKKQGFVDFKSLRHPCF--NLDSRVNKDFIPNDVTLGNKSPNIGLLTGA 957
            ++C  VD S        +D +  RH      L S+    F  ND +L  +   + +++G 
Sbjct: 721  LVCPVVDTSVS------LDIRGGRHIVVEDGLMSKSLDKFTSNDCSL--QGGTLWVVSGP 772

Query: 958  NAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELS 1017
            N  GKST LR   I VIMAQ+G +VP  SA +  +D+I +R+G+ D++    STF VE+ 
Sbjct: 773  NMGGKSTFLRQNAIIVIMAQVGSFVPCASARIGLVDKIFSRIGSADDLYNEMSTFMVEMI 832

Query: 1018 ETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYG---SL 1074
            ET  IL  AT RSL +LDE+GRG S  +G SIA + L H+ +  +    FATH+      
Sbjct: 833  ETSYILKGATERSLAILDEIGRGTSGKEGISIAYATLKHLVSRNRCRSLFATHFAKELEQ 892

Query: 1075 GLSFRSHPQIK---PMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVD 1131
             L+ +S+   +       S + D    + T+ ++L  G    S  + VAS  G     + 
Sbjct: 893  LLNLQSNCTFQRNVSYYKSGVYDIGKGDYTYNHRLTPGICTKSDAIRVASKAGFPDEALS 952

Query: 1132 NAQ 1134
            +AQ
Sbjct: 953  DAQ 955

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/413 (21%), Positives = 171/413 (41%), Gaps = 46/413 (11%)

Query: 286 NKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAG----GGRANM 341
           N   P  +   +   K  D +V  + G F+ELY + A +     +  L       G+ + 
Sbjct: 81  NSLPPSLQYVRDTMDKYQDYVVLTQMGSFYELYFEHAEIYAPKLNLTLTSREYVHGKVSF 140

Query: 342 QLAGIPEMSFEHWASQFIQLGYKVAKVDQ--RESMLAKEMREGSKGIVKRELQCVLTSGT 399
               +P++S  H        G+ VA  DQ  ++++++ +     + + +     ++T GT
Sbjct: 141 AGFPVPQIS-RHLKVLVKDYGHSVAIADQFKKDNIISNDTSRFLRRVTR-----IVTPGT 194

Query: 400 LVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDD 459
            +D    +    T+ L++ E P N     +  +   TK+ G+ + D STGE+ + + L  
Sbjct: 195 FIDEAFENLQENTFLLSL-EFPEN---CMRKVADIDTKV-GLCWCDISTGEIFVQQVLLK 249

Query: 460 EECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEK--T 517
           +  S +    +++ P E+++++  L   A KI      P     +++  + F  ++K  +
Sbjct: 250 DVVSAI----TRIAPCEILLDEEIL---AFKIESGEWYPE----FVELKKFFIKYQKIPS 298

Query: 518 HNELLANEEAYFGTAD------GWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLI 571
            +  + +    F  AD       +   L N         FS              +E L 
Sbjct: 299 SHRAIRSFHRLFSPADMEGKFSPFDIALHN---------FSQKETAALRNTLLYLEEHLP 349

Query: 572 SMK-NFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMR 630
            M+ N        + + M +D  +   LE+ S     + KG+L      ++TP G R++ 
Sbjct: 350 DMEVNLQVPKRQITSSIMQIDSRTCSALELSSTMRTNTRKGSLLSAIRRTVTPSGSRLLS 409

Query: 631 KWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAG 683
           +WL  P +  ++I++RQ+ V L  NN  L   +        D+ R+L +   G
Sbjct: 410 QWLSAPSMDIKEIKQRQELVTLFRNNPTLTESLVRTLKKTYDMPRILQKFSFG 462

>CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1, hypothetical start
          Length = 949

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 118/217 (54%), Gaps = 13/217 (5%)

Query: 930  DSRVNKDFIP---NDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAES 986
            D+   K+ +P   N+  L   S +I +++G N  GKST LR   I  I+AQ+GC+VP   
Sbjct: 726  DALKKKNLVPFTANNCDLS--SNDIWVISGPNMGGKSTFLRQNAIIAILAQIGCFVPCRK 783

Query: 987  ASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDG 1046
            A +  +D+I +R+G+ D++    STF VE+ ET  IL+ AT+RSL +LDE+GRG S  +G
Sbjct: 784  AHIGLVDKIYSRVGSADDLYNDMSTFMVEMVETSLILNGATDRSLAILDEIGRGTSGKEG 843

Query: 1047 FSIAESVLHHVATHIQSLGFFATHYGS-------LGLSFRSHPQIKPMKMSILVDEATRN 1099
             ++A   L H+  + +    FATHY           LS  +H +I   + SI        
Sbjct: 844  VAVAYGTLKHLLQNNKCRSLFATHYAQELKQVADQDLSEDTH-RIHYFQTSIRETNDPNK 902

Query: 1100 VTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSA 1136
              + +K+  G S+ S  + VA + G  +  +++A +A
Sbjct: 903  FYYDHKMRPGISQKSDALKVARIAGFPQDALNDASTA 939

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 92/409 (22%), Positives = 160/409 (39%), Gaps = 66/409 (16%)

Query: 300 SKMWDCIVFFKKGKFFELYEKDAF----LANALFDWKLAGGGRANMQLAGIPEMSFEHWA 355
           S+  D +V  + G FFELY   A     L N     +    G+       +P++S  H  
Sbjct: 73  SQYPDHVVLTQMGSFFELYFDHASTYAPLLNIALTQRTYTHGKVPFAGFPVPQLS-RHLK 131

Query: 356 SQFIQLGYKVAKVDQ--RESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATY 413
           +     GY V   +Q  ++     E     + + +     ++T GT +D  + +    T+
Sbjct: 132 ALVQDYGYSVVVAEQFKKDGYATNENNRFYRRVTR-----IVTPGTFIDEALDNYSENTF 186

Query: 414 CLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGEVQMTEF-LDDEECSRLDTLMSQV 472
            L + E P NF +     +       G+++ D STGE+ + E  L D     L   ++++
Sbjct: 187 LLTI-EFPENFTNYVAEDNLR----IGISWCDISTGEIYIQELPLKD-----LMNAITRI 236

Query: 473 RPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYF--- 529
           +PKE+++   N   L++ I+     P                       LA  + YF   
Sbjct: 237 KPKEILL---NARELSDDIISGNWYPQ----------------------LAELKRYFINY 271

Query: 530 GTADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEY---------- 579
            T       L  Y+D       S               +   +++N   Y          
Sbjct: 272 YTTTTRYRTLDTYFDMFAATRASGMRQRLRMELNEYSIKETAALRNLLSYVAEHLPECAI 331

Query: 580 --NFVKSQNT---MVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLM 634
              F K Q T   + +D  + + LE+ S   D S +GTL      ++TPMG R++ +WL 
Sbjct: 332 NFQFPKRQITTDILQIDSRTTKALELHSTIRDNSKRGTLLNTMRRTVTPMGTRLLSQWLS 391

Query: 635 NPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHAG 683
            P +  ++I+ RQ  V L + +     KI S    + D+ +LL + + G
Sbjct: 392 GPSMNIKEIKLRQSIVSLFLADKRSHDKIISELKKIQDIVKLLQKFNFG 440

>Scas_697.27
          Length = 948

 Score =  119 bits (297), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 67/177 (37%), Positives = 104/177 (58%), Gaps = 10/177 (5%)

Query: 898  RPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVN--KDFIPNDVTLGNKSPNIGLLT 955
            + ++C +++ STK      ++    RH        +N  + F+ ND  L  +S  + ++T
Sbjct: 708  KNLVCPKMNRSTK------LEIVKGRHLMVEESLAINSLEKFVGNDCNL--ESGKLWVIT 759

Query: 956  GANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVE 1015
            G N  GKST LR   I VI+AQ+G +VP +SA +  +D+I +R+G+ D++    STF VE
Sbjct: 760  GPNMGGKSTFLRQNAIIVILAQIGSFVPCDSARIGLVDKIFSRVGSADDLYNEMSTFMVE 819

Query: 1016 LSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYG 1072
            + ET  IL  AT+RSL +LDE+GRG S  +G SIA + L ++    +    FATH+G
Sbjct: 820  MVETSCILRGATDRSLAILDEIGRGTSGKEGISIAFATLKYLIKRNRCRSLFATHFG 876

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 94/403 (23%), Positives = 158/403 (39%), Gaps = 74/403 (18%)

Query: 306 IVFFKKGKFFELYEKDAFLANALFDWKLAGGGRAN--MQLAGIPEMSF-EHWASQFIQLG 362
           +V  + G F+ELY + A     + +  L     A+  +  AG P      H        G
Sbjct: 91  VVLTQIGSFYELYFEQAVKYAPILNISLTNRTYAHGKVPFAGFPVPQLGRHLKILVNDFG 150

Query: 363 YKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREEPS 422
           Y V   +Q +     ++ E  +    R +  ++T GT +D    +    +Y L++ E P 
Sbjct: 151 YNVVIAEQFKK---NDVAENEQYKFIRRVTRIVTPGTFIDEAFENFQENSYLLSI-EFPE 206

Query: 423 NFYDITQPSSATYTKIFGVAFIDTSTGEVQMTE-FLDDEECSRLDTLMSQVRPKEVIIE- 480
           N         A      G+++ D STGEV + + FL D     L + ++++RPKE+I+  
Sbjct: 207 N----CMKRIALGDLKLGLSWCDVSTGEVFVQQMFLKD-----LISSITRIRPKEIILNE 257

Query: 481 ---KHNLCNLANKIVKFCAAPNALFNYIK------PVEEFYDFEKTHNELLANEEAYFGT 531
              K+N+ +      +  A      NY +       +E FYD                 T
Sbjct: 258 DLYKNNIVS-GEWYPELVALKKYFLNYQRMPSQHRTIESFYDL---------------FT 301

Query: 532 ADGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEY----------NF 581
           +    SV++       K+ F  F             + L +++N   Y          N 
Sbjct: 302 SGNTDSVIRQL-----KLQFQTFT-----------QKELAALRNILIYISDHLPNISTNL 345

Query: 582 VKSQ-----NTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNP 636
              Q     + M +D  +   LE+ S   + S KGTL      +ITP G R++ +WL  P
Sbjct: 346 QIPQREITTSIMQIDSRTSSALELHSTVRNNSKKGTLLSSIRRTITPSGTRLLTQWLSGP 405

Query: 637 LLLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSR 679
            L  ++I  RQ  V   M N ++   I  +     D+ R+L +
Sbjct: 406 SLDLKEIRNRQKLVSYFMENPDIMEHIIQILKDTCDITRVLQK 448

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
            cerevisiae YDL154w MSH5 meiosis-specific protein,
            hypothetical start
          Length = 867

 Score =  116 bits (290), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 131/263 (49%), Gaps = 39/263 (14%)

Query: 897  CRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTL-----------G 945
            C+P++  + D S     QG       RHP   L   ++ +FIPND+ L            
Sbjct: 546  CKPIL--KKDKSVVKITQG-------RHP---LLETLSDNFIPNDIILDGGMLKDINWFS 593

Query: 946  NKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNI 1005
            +    I ++TGANA+GK+  L    + V MA +GCYVPA++A +  +D I+T+  + D+I
Sbjct: 594  SGRQRIAVVTGANASGKTIFLEQIALIVYMAHIGCYVPADTAEIGLVDMILTKFKSFDSI 653

Query: 1006 MQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHH--------- 1056
                S+F  +  +  +I+ LAT RS++ +DE G+G  +  G S+  +++           
Sbjct: 654  STSMSSFERDSKQLSKIMSLATKRSIIFIDEYGKGTDTISGPSLLAAIIQRYSQLPGAPR 713

Query: 1057 --VATHIQSL---GFFATHYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQS 1111
              ++TH   +        H GS+     +   +   ++  LV E    + F Y++V+G  
Sbjct: 714  LLISTHFYEIFQKSSLLKHRGSIKF-LTTKIVLNNCEVENLVTE-NEGIVFFYQIVEGIC 771

Query: 1112 EGSFGMHVASMCGIAKSIVDNAQ 1134
            + S G++ A +CGI K I++ A+
Sbjct: 772  DSSLGIYCAKICGIKKEIINMAE 794

>Sklu_1903.3 YFL003C, Contig c1903 4902-7601
          Length = 899

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 123/242 (50%), Gaps = 17/242 (7%)

Query: 919  FKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQL 978
            FKS RHP      +  K FIPND     +S  I ++TG NA+GKS  L+   I  IMAQ+
Sbjct: 621  FKSARHPILE---KFLKKFIPNDTVSIKESSAIQIITGCNASGKSVYLKQIAILNIMAQM 677

Query: 979  GCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELG 1038
            G  VPA+ A     +R+  R+  ND I    STF  E+ E    L    + +L+VLDELG
Sbjct: 678  GSPVPADYACFPIFNRLHARV-CNDTIEVNSSTFSSEMKEMAYFLHDIDSNTLMVLDELG 736

Query: 1039 RGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDEATR 1098
            RG S  DGF+++ ++  H+ +  +   F +TH+  +     S P +  ++M+   +   +
Sbjct: 737  RGSSIGDGFAVSLAITEHLVS-TKCTAFISTHFRDIPEILTSKPSVVHLQMT--AEVVDK 793

Query: 1099 NVTFLYKLVDGQSEG--SFGMHVASMCGIAKSIVDNAQSAADNLEHTSR------LIKER 1150
            ++T  YK V   + G  ++G+ V       + I+DNA      L+ + +      L KE 
Sbjct: 794  SLTMHYK-VSRTTSGIKNYGLRVVQNL-FPREIMDNAYEIGSLLKSSKKKMSNANLSKEH 851

Query: 1151 KE 1152
            KE
Sbjct: 852  KE 853

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 116/251 (46%), Gaps = 21/251 (8%)

Query: 439 FGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKH----NLCNLANKIVKF 494
            G+  I+ STGE+ +++F+D +   R    +   +P E+++       N+  LA  I+KF
Sbjct: 140 IGLCVINYSTGEMIISDFMDSQIFIRTVHKIQIHQPTEILLPSSSFLPNISKLAT-IIKF 198

Query: 495 CAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAF 554
             + +     +K +E       +   L A EE      +     ++ + D  KK    A 
Sbjct: 199 NVSGS-----VKVIEASLKHYNSQEGLTAIEEYGLFIGNEKNLTVEKFVD--KKFALCAV 251

Query: 555 XXXXXXXXXXXXDESLISMKNFTEYN----FVKSQNTMVLDGISLQNLEIFSNSFDGSDK 610
                         S IS ++++  N    +  ++NTM++D  + + LE+  N+ +   K
Sbjct: 252 SAAIKHTKRIST--SRISNESYSFQNLRIKYEGTENTMLIDPRTSKGLELVENALE--KK 307

Query: 611 G-TLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTG 669
           G +LFK  ++++T MGKR +R  ++ PL  ++ I  R   V  L +N +L   + +    
Sbjct: 308 GMSLFKFLDSTVTKMGKRALRNNILQPLTQEDGIIMRLQCVVELQDNSQLLGDLRAEMRS 367

Query: 670 LPDLERLLSRI 680
             DL+ L S++
Sbjct: 368 CQDLDALYSKL 378

>YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific protein
            involved in reciprocal recombination, not involved in
            mismatch repair [2706 bp, 901 aa]
          Length = 901

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 121/223 (54%), Gaps = 25/223 (11%)

Query: 951  IGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKS 1010
            I ++TGANA+GKS  L    + V +AQ+GC+VPAE A +   D+I+TR+   + + + +S
Sbjct: 638  IIVVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYKTQS 697

Query: 1011 TFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFA-T 1069
            +F ++  +  + L LAT +SL+++DE G+G    DG S+  S++ +++   +     A T
Sbjct: 698  SFLLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPRIIACT 757

Query: 1070 HYGSLGLSFRSHPQIKPMK---MSILV--------------DEATRNVTFLYKLVDGQSE 1112
            H+  L         IK +K     IL+              D  +  +TFL+K+ +G S+
Sbjct: 758  HFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVKEGISK 817

Query: 1113 GSFGMHVASMCGIAKSIVDNAQSAADNLEHTSRLIKERKEALQ 1155
             SFG++ A +CG+++ IV+ A       E  SR+I    + +Q
Sbjct: 818  QSFGIYCAKVCGLSRDIVERA-------EELSRMINRGDDVVQ 853

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 17/150 (11%)

Query: 581 FVKSQNTMVLDGISLQNLEIFSNSFD-GSDKG------TLFKLFNNSITPMGKRMMRKWL 633
           ++  ++ MVLD  ++  L IF  +   G DK       ++F+LFN   +   +R+++ WL
Sbjct: 240 YIDIRDRMVLDENTISALHIFPTAHKLGHDKMMRNGFFSVFELFNQVSSDYARRILKSWL 299

Query: 634 MNPLLLKEDIEKRQDSVELLMN--NHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFD 691
           +NPL  K+ IE R   +  L++  N  + + +       PD    ++++ +G   +  + 
Sbjct: 300 INPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPDAFGFINQLRSGKSTLGTWS 359

Query: 692 KVITAFEN---ILQMTKEI-----ESNELH 713
           KV +  E    I Q+   +     E+N LH
Sbjct: 360 KVASFLEKGIAIFQLVSSLKLGSDEANILH 389

>CAGL0F02167g complement(216080..218767) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 895

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 96/158 (60%), Gaps = 2/158 (1%)

Query: 932  RVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTP 991
            R+ K++I ND++    S  + ++TGAN  GK+  LR   +  IMAQ+G  +PAE+A L  
Sbjct: 622  RLIKNYIRNDISSTLYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPV 681

Query: 992  IDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAE 1051
             + I TRL  ND++    S F  E+ E   IL+     SL+++DELGRG S  DGF+I+ 
Sbjct: 682  YENIHTRL-CNDSMEMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISL 740

Query: 1052 SVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKM 1089
            ++L++++  ++S  F +TH+  + +  ++ P I+ + M
Sbjct: 741  AILNYLS-KLESTTFISTHFDVIPMILKNKPSIRHLHM 777

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 119/275 (43%), Gaps = 36/275 (13%)

Query: 424 FYDITQPSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKH- 482
            + I + S    T I G++ I+ STGE+ +TE++D +   R    +    P +++I  H 
Sbjct: 113 IFSIYESSKEVDTTI-GISLINFSTGEIILTEYVDSQLFIRTMNKIQLYEPTDILIPCHS 171

Query: 483 ---NLCNLA-------NKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTA 532
              ++  LA       N  +K   A ++ +N  + +E    F K          +    A
Sbjct: 172 VRPHMSKLATILKLNINHEIKIHIAKSSCYNNRRSIE----FIKA---------SSINKA 218

Query: 533 DGWPSVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKN--FTEYN-----FVKSQ 585
           DG   +L   Y+  K+    +              + L   KN   ++Y+     +   +
Sbjct: 219 DGIQILLAKLYE--KRHCLFSLAAATEFLQSKNSVKGLTPKKNKVLSDYSRFRIRYEAIE 276

Query: 586 NTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEK 645
           NT+++D  ++ NLE+   + +G +K +LF   N + T MG R +R  ++ PL     I  
Sbjct: 277 NTLLIDSKTVTNLELI-RTLEGDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGITN 335

Query: 646 RQDSVELLMNNHELRTKIESVFTGLPDLERLLSRI 680
           R  SVE L    E    I  V   LPDL+ + S++
Sbjct: 336 RLKSVEEL-TECEFLNGIRLVLRQLPDLDIVFSKL 369

>YFL003C (MSH4) [1678] chr6 complement(134516..137152)
            Meiosis-specific protein homologous to E. coli MutS [2637
            bp, 878 aa]
          Length = 878

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 87/167 (52%), Gaps = 5/167 (2%)

Query: 923  RHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYV 982
            RHP   L  +V K+F+PN ++    S ++ ++TG N +GKS  L+   +  IMAQ+G  +
Sbjct: 604  RHP---LLEKVLKNFVPNTISSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQMGSGI 660

Query: 983  PAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGS 1042
            PA   S     R+  R+  ND++    S F  E+ E    LD     +LL+LDELGRG S
Sbjct: 661  PALYGSFPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETLLILDELGRGSS 719

Query: 1043 SNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKM 1089
              DGF ++ +V  H+    ++  F +TH+  +       P +  + M
Sbjct: 720  IADGFCVSLAVTEHLL-RTEATVFLSTHFQDIPKIMSKKPAVSHLHM 765

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 115/257 (44%), Gaps = 35/257 (13%)

Query: 439 FGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNLCNLANKI---VKFC 495
            G+  I+ +TG++ +++F+D +   R+   +   +P E++I   +L    +K+   +KF 
Sbjct: 120 IGLCIINCNTGQMYLSDFMDSQIYIRVVHKLQIYQPTEILIPSSSLAPTVSKLATMIKFN 179

Query: 496 AAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKK------V 549
            A          +EE                  F + DG  ++ K   D  KK      +
Sbjct: 180 VAETV------KIEE-------------GSRKCFNSQDGLAAITKYLMDDTKKDLKIEEI 220

Query: 550 GFSAFXXXXXXXXXXXXDESLI-SMKNFTEY-----NFVKSQNTMVLDGISLQNLEIFSN 603
               F            +E +  S +N   +      F  ++NTM++D  +++ LE+  N
Sbjct: 221 IDKTFALCAASAAISYMEEIISKSSRNLNAFRKLRIQFEGTENTMLIDSKTVRGLELVEN 280

Query: 604 SFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKI 663
             D  +  +L+K  + + T MG+R +R  ++ PL  +  IE R +++E L  N +L  K+
Sbjct: 281 KLD-KNGISLWKFLDTTSTKMGQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKL 339

Query: 664 ESVFTGLPDLERLLSRI 680
                 LPDL++L SR+
Sbjct: 340 RLEMKSLPDLDKLFSRL 356

>Scas_707.28
          Length = 881

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 90/167 (53%), Gaps = 5/167 (2%)

Query: 923  RHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYV 982
            RHP   L++ + K F+PND+     S  + ++TG N +GKS  L+   +  IM+Q+G  V
Sbjct: 605  RHPI--LETLI-KGFVPNDIVSTKTSSAVQIITGCNRSGKSVYLKQLPLLCIMSQIGSPV 661

Query: 983  PAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGS 1042
            PAESA + PI + +     ND +    STF  E+ E    LD     +LL++DELGRG S
Sbjct: 662  PAESA-IVPIYKKVHARVCNDTMEMNSSTFSFEMKEMAYFLDDTDQDTLLIIDELGRGSS 720

Query: 1043 SNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKM 1089
              DGFSI+ ++  H+    +     +TH+ ++     + P +  + M
Sbjct: 721  IGDGFSISLAITEHL-IGTKGTVLLSTHFEAIPSILVTRPNVLHLHM 766

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 110/256 (42%), Gaps = 34/256 (13%)

Query: 440 GVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPN 499
           G+ F+  +TGE+ ++EF+D +   R    +   +P E+I+   +L    +K+        
Sbjct: 122 GLCFLKYTTGEMILSEFMDSQIFIRTMHKIHIYQPTEIILPSSSLFPTVSKLATIIK--- 178

Query: 500 ALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYY---DSNKKVGFSAF-- 554
              N  + V+           +      YF + DG  SV+KNY    D  K +       
Sbjct: 179 --LNISETVK-----------ISEASSKYFNSQDGI-SVIKNYVIDKDREKTIIEELIDK 224

Query: 555 --XXXXXXXXXXXXDESLISMKNFTEYNFVK-------SQNTMVLDGISLQNLEIFSNSF 605
                         D+ +    N   +NF K       ++NTM++D  ++  LE+  N  
Sbjct: 225 SYALSASAASIAYTDDLIAKSSNDALFNFRKLRIRYEGTENTMLIDPKTINGLELVENII 284

Query: 606 DGSDKGTLF-KLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIE 664
           D   +G  F K  N + T MG+R +R  ++ PL  ++ I  RQ++V+ L  + +L  ++ 
Sbjct: 285 D--KRGMSFWKFLNTTCTKMGERSLRNNILQPLTDEKSIIMRQEAVKELQGDEKLLEQLR 342

Query: 665 SVFTGLPDLERLLSRI 680
                  DL+R+  ++
Sbjct: 343 KHMKVYQDLDRIFVKL 358

>KLLA0F11022g complement(1016214..1018880) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 888

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 93/173 (53%), Gaps = 5/173 (2%)

Query: 923  RHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAVIMAQLGCYV 982
            RHP          +F+ NDV       +  ++TG N +GKS  L+   +  I+AQ+GC V
Sbjct: 612  RHPILE---NTLTNFVANDVEAIPNLSSFQIVTGCNMSGKSIYLKQVAMLTILAQIGCPV 668

Query: 983  PAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRSLLVLDELGRGGS 1042
            P  SAS     ++  R+  ND+I    STF  E+ +    +D  T+++L++LDELGRG S
Sbjct: 669  PCTSASFPLYQKLHARV-CNDDIEAYSSTFSAEMKDMAYFIDDITDKTLMILDELGRGSS 727

Query: 1043 SNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMKMSILVDE 1095
              DGFSIA ++  ++ +   ++ F +TH+  +       P++  ++M   +D+
Sbjct: 728  IADGFSIALAISEYLLSKNATV-FLSTHFRDIPKILAPKPRVLHLEMKTEIDQ 779

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/277 (23%), Positives = 115/277 (41%), Gaps = 33/277 (11%)

Query: 440 GVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNL------------CNL 487
           G+  ++ ST E+ ++EF+D +   +    +   +P E++I  H+L            CN+
Sbjct: 130 GICVVNYSTAEMHVSEFIDTQVFIKTLNKIYVCQPTEILIPSHSLSGKVSKLSTIVKCNI 189

Query: 488 ANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNK 547
           ++  VK C A   ++N   P E     EK          A  GT        +      K
Sbjct: 190 SDN-VKICEAATKVYN---PQEGLEVLEKF---------ALLGTNKSPVPFAEQLI--GK 234

Query: 548 KVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDG 607
           +    A              +  +   NF         NTM++D  ++Q+LE+  N+ + 
Sbjct: 235 EFCLMAVSAASNYMTQIAEADLALKFSNF-RVRIDNGDNTMLIDMKTVQSLELIENTLE- 292

Query: 608 SDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVF 667
           S+  TL K+ + ++T MG R +R  ++ PL     ++ R  +V+ L NN +         
Sbjct: 293 SNGMTLLKVIDKTVTKMGHRALRNDILQPLTDINSLKLRVSAVQELQNNPDFLNSFRMEL 352

Query: 668 TGLPDLERLLSRI----HAGSLKVKDFDKVITAFENI 700
             L DL+ L S++    H   L  +  + VI   E+I
Sbjct: 353 KVLHDLDALFSKLLSFNHTVILPDQKLNYVILLKESI 389

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
           Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 902 CDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAG 961
            D++ PS K  K   VD+   + P   +  R+ ++F+  + T  N SP++ ++ G N +G
Sbjct: 13  VDDLTPSRKRLKIKPVDYDVFK-PGSIVKIRL-ENFVTYNYTEFNLSPSLNMIIGPNGSG 70

Query: 962 KSTVLRMTCIAV 973
           KST +   C+ +
Sbjct: 71  KSTYVCAVCLGL 82

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
           SMC domain N-terminal domain, which bind ATP in
           chromosome-associated proteins, has low similarity to S.
           pombe Spr18p, which is likely to be involved in the
           maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 24/39 (61%)

Query: 935 KDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIAV 973
           +DF+   +T  N SP++ ++ G N +GKST +   C+ +
Sbjct: 48  QDFVTYTLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGL 86

>KLLA0F08613g complement(801623..803158) similar to sp|Q12499
           Saccharomyces cerevisiae YOR310c NOP58 required for
           pre-18S rRNA processing, start by similarity
          Length = 511

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 432 SATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDT-----LMSQVRPKEVIIEKHNLCN 486
           S  Y +I     I  +  E  M+E L +E   R+ T     + +++ P ++I    N+  
Sbjct: 202 SVAYARIILTMGIRVNAAETDMSEILPEEIEERVKTAAEVSMGTEITPVDLI----NIKC 257

Query: 487 LANKIVKFCAAPNALFNYI 505
           LA +IV+F A    L NY+
Sbjct: 258 LAEQIVEFAAYREQLSNYL 276

>Scas_557.2
          Length = 446

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 793 DSGKEIYTIEVP--VSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEAR 843
           D+G E+YT E+P           +W +  + KN +R Y  EV+++ RSV E+R
Sbjct: 92  DNG-EMYTEELPRLFRWLGISGKSWKRYRSRKNEERLYLKEVKLIKRSVVESR 143

>Scas_718.32
          Length = 1001

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 68/140 (48%), Gaps = 7/140 (5%)

Query: 537 SVLKNYYDSNKKVGFSAFXXXXXXXXXXXXDESLISMKNFTEYNFVKSQNTMVLDGISLQ 596
           SVL NYY++  KV F +              E   +  N TE  F    +T++L  ++++
Sbjct: 275 SVLANYYENMVKVFFVSGDQLLHTTAWNKFYEIYSTNPNATEEQFKTYASTILLSALAIK 334

Query: 597 NLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLK--EDIEKRQDSVELLM 654
             ++ +  +D   +  L++L +    P  K +++  L + +  K  ED++K  + +E+  
Sbjct: 335 LDDVPAVGYDSQQR--LYRLLDLESKPSRKALIQDILDSDMFSKVDEDVKKLYELIEVNY 392

Query: 655 NNHELRTKIESVFTGLPDLE 674
           N   +++++ ++   LP L+
Sbjct: 393 NADTIKSELSTL---LPQLQ 409

>Sklu_2438.10 YDL176W, Contig c2438 22731-24761 reverse complement
          Length = 676

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 7/101 (6%)

Query: 1046 GFSIAESVLHHVATHIQSLGFFA-THYGSLGLSFRSHPQIKPMKMSILVDEATRNVTFLY 1104
            G+SI  S+ +H+ T    +  F  T Y +L  +  S+  I P+    ++  A R    ++
Sbjct: 211  GYSI--SLAYHLQTKYPGISMFKETIYVNLKKNI-SNFHINPLDRFSIITIAPRTPLTIH 267

Query: 1105 KLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLEHTSR 1145
            KL   Q   SF  +  ++ G+ KSIVD+A     +++ + R
Sbjct: 268  KL---QLPKSFVDYFIALIGLKKSIVDSAPEEIKDIDESCR 305

>Scas_665.12
          Length = 515

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 432 SATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPKEVI-IEKHNLCNLANK 490
           S  Y +I     I +   +  M+E L +E   R+ T        E+  ++  N+  LA++
Sbjct: 202 SVAYARIILTMGIRSKAADTDMSEILPEEIEERVKTAAEVSMGTEITQLDLENIKCLADQ 261

Query: 491 IVKFCAAPNALFNYI 505
           IV+F A    L NY+
Sbjct: 262 IVEFAAYREQLSNYL 276

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,841,117
Number of extensions: 1594104
Number of successful extensions: 6948
Number of sequences better than 10.0: 138
Number of HSP's gapped: 7140
Number of HSP's successfully gapped: 197
Length of query: 1198
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1085
Effective length of database: 12,684,275
Effective search space: 13762438375
Effective search space used: 13762438375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)