Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08107g62561533040.0
CAGL0L11880g980782105e-17
KLLA0C17710g821822024e-16
Kwal_56.23453828771972e-15
AGR117C799691952e-15
YDR096W (GIS1)894651944e-15
Scas_681.198641181882e-14
YER169W (RPH1)796641863e-14
Scas_709.32822571651e-11
CAGL0M13189g541591622e-11
Sklu_2181.1410551593e-11
KLLA0C17072g474581576e-11
Kwal_47.17241403581567e-11
YER130C443551551e-10
CAGL0K02145g317551512e-10
YMR037C (MSN2)704521533e-10
Scas_602.9547551523e-10
ACL057W520551514e-10
KLLA0F26961g694521481e-09
CAGL0F05995g597581462e-09
CAGL0L06072g300531432e-09
YKL062W (MSN4)630551443e-09
Kwal_26.8351698521427e-09
Scas_649.28730551409e-09
ABR089C571521391e-08
CAGL0M00594g1020621363e-08
YJR127C (ZMS1)1380931311e-07
Scas_721.921152531283e-07
Scas_707.31289551191e-06
AGR172W1057531222e-06
YOR113W (AZF1)914581212e-06
YDR216W (ADR1)1323571203e-06
KLLA0F13046g1379531194e-06
KLLA0B04477g1332801194e-06
Sklu_2443.22213621126e-06
CAGL0E04884g1489531161e-05
Sklu_2357.7157541081e-05
AER159C1191621151e-05
Kwal_47.166211178621151e-05
Scas_712.42*290571121e-05
YDR253C (MET32)1911231072e-05
Kwal_23.5400429741112e-05
Scas_697.35839581122e-05
YPL038W (MET31)1771191053e-05
Scas_703.231341621105e-05
CAGL0K04631g1013521095e-05
AGR031W140501025e-05
ACR264W769581095e-05
YML081W1251621096e-05
YGR067C794561087e-05
Scas_683.25879521087e-05
CAGL0L03916g642571087e-05
YBR066C (NRG2)220751047e-05
KLLA0F23782g782571088e-05
YDR043C (NRG1)231541031e-04
Kwal_26.80215071361061e-04
KLLA0B07909g922521071e-04
AGL071C396501051e-04
Kwal_47.17888786571061e-04
CAGL0C02519g318691041e-04
Kwal_27.10925264541031e-04
KLLA0F18524g357541042e-04
Kwal_27.11460531781042e-04
YER028C394571042e-04
Scas_718.44266641022e-04
KLLA0E10989g474571032e-04
CAGL0K12078g4631031033e-04
AFR580C838521033e-04
CAGL0M06831g645521023e-04
Scas_717.17525521014e-04
KLLA0F01463g781721024e-04
KLLA0E08679g596481014e-04
AEL174W661681014e-04
Scas_695.2571601005e-04
KLLA0B03454g472521006e-04
Scas_711.56832621006e-04
CAGL0L12562g22349976e-04
AEL278W47652997e-04
KLLA0B00605g23954977e-04
AGL246W227102960.001
CAGL0H04213g132165990.001
Scas_569.229354960.001
Kwal_47.1904526656960.001
YNL027W (CRZ1)67877960.002
Scas_631.743358960.002
Sklu_2389.276768960.002
Scas_378.120857930.002
YGL209W (MIG2)38257950.002
KLLA0E18645g43152950.002
Kwal_27.1182419965920.002
KLLA0A10373g20681910.003
YPL230W39153940.003
Sklu_2351.654857940.003
CAGL0K09372g39657930.004
Scas_713.1146557930.004
ADL198W54752930.004
CAGL0M01870g31552920.004
CAGL0A01628g42457920.005
CAGL0G10021g39453910.006
YGL035C (MIG1)50458920.006
CAGL0J05060g713130920.006
Scas_575.345556910.006
Scas_719.68135062920.007
Sklu_2289.129154890.008
Kwal_14.254371168910.008
CAGL0E06116g61343900.009
CAGL0L07480g31450880.011
YJL056C (ZAP1)88059890.012
Scas_568.519955860.012
Scas_720.3331653880.012
Sklu_1527.120550860.013
YMR182C (RGM1)21143860.015
CAGL0K01727g49959870.017
Scas_718.36d33052860.021
YPR186C (PZF1)42982870.021
Scas_687.3328858860.021
Scas_636.14d275130850.024
KLLA0D11902g28955850.026
Kwal_26.930030450840.035
Kwal_33.1422755159840.041
YDR463W (STP1)51969840.052
Scas_627.17d27554820.053
AGL207W27754820.053
AFR471C38957830.055
YMR070W (MOT3)49059830.056
Kwal_14.227846380830.058
Scas_718.6747359830.059
CAGL0E04312g68869830.068
AFL136W40943820.071
YDL020C (RPN4)53177810.11
KLLA0C04103g56459810.12
YDL048C (STP4)49051800.14
ADL051W17348760.17
AFR461C54464790.20
KLLA0C16005g33155780.22
Kwal_47.1657788162790.22
KLLA0F10109g62364780.22
Scas_721.5619966760.22
YDR146C (SWI5)70946780.25
Sklu_2206.235878770.26
Kwal_26.801119052750.27
Scas_641.2453264770.30
CAGL0K03003g64750770.31
Scas_717.60d16765740.36
Kwal_27.1016728544750.41
Sklu_2436.951764760.44
CAGL0L00583g38839740.64
YHL027W (RIM101)62536740.69
ADL042W28153730.71
AFR588W31950730.77
YHR006W (STP2)54164730.83
AER227W64557730.86
CAGL0E03762g58436730.86
KLLA0F11682g37458730.89
CAGL0K04697g51559730.89
Scas_670.243525730.90
Kwal_47.1833753668730.91
Scas_683.3047825731.0
CAGL0I02816g29124721.1
AFR190C43236721.2
YLR375W34350711.6
Kwal_27.1046730252701.6
CAGL0B02651g18956691.9
KLLA0D16456g85448711.9
Scas_717.1835496701.9
Kwal_55.2063441936702.0
Sklu_2126.544836702.2
Scas_660.1236769682.9
Scas_613.218629673.1
CAGL0K06413g35964683.4
KLLA0E00726g51736683.7
Scas_712.232757673.8
KLLA0A04609g42360665.6
CAGL0B05049g1470109675.8
AAL072C122090658.5
Scas_604.458536658.6
KLLA0E01364g42574659.1
CAGL0I02838g65539659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08107g
         (615 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...  1277   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...    86   5e-17
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...    82   4e-16
Kwal_56.23453                                                          80   2e-15
AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...    80   2e-15
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...    79   4e-15
Scas_681.19                                                            77   2e-14
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...    76   3e-14
Scas_709.32                                                            68   1e-11
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    67   2e-11
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            66   3e-11
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    65   6e-11
Kwal_47.17241                                                          65   7e-11
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    64   1e-10
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    63   2e-10
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    64   3e-10
Scas_602.9                                                             63   3e-10
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    63   4e-10
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    62   1e-09
CAGL0F05995g complement(598819..600612) some similarities with s...    61   2e-09
CAGL0L06072g complement(679924..680826) some similarities with s...    60   2e-09
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    60   3e-09
Kwal_26.8351                                                           59   7e-09
Scas_649.28                                                            59   9e-09
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    58   1e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    57   3e-08
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    55   1e-07
Scas_721.92                                                            54   3e-07
Scas_707.31                                                            50   1e-06
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    52   2e-06
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    51   2e-06
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    51   3e-06
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    50   4e-06
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    50   4e-06
Sklu_2443.22 , Contig c2443 45390-46027                                48   6e-06
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    49   1e-05
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        46   1e-05
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    49   1e-05
Kwal_47.16621                                                          49   1e-05
Scas_712.42*                                                           48   1e-05
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    46   2e-05
Kwal_23.5400                                                           47   2e-05
Scas_697.35                                                            48   2e-05
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    45   3e-05
Scas_703.23                                                            47   5e-05
CAGL0K04631g complement(440721..443762) some similarities with s...    47   5e-05
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    44   5e-05
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    47   5e-05
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    47   6e-05
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    46   7e-05
Scas_683.25                                                            46   7e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    46   7e-05
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    45   7e-05
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    46   8e-05
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    44   1e-04
Kwal_26.8021                                                           45   1e-04
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    46   1e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    45   1e-04
Kwal_47.17888                                                          45   1e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    45   1e-04
Kwal_27.10925                                                          44   1e-04
KLLA0F18524g complement(1701498..1702571) some similarities with...    45   2e-04
Kwal_27.11460                                                          45   2e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    45   2e-04
Scas_718.44                                                            44   2e-04
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    44   2e-04
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    44   3e-04
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    44   3e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    44   3e-04
Scas_717.17                                                            44   4e-04
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    44   4e-04
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    44   4e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    44   4e-04
Scas_695.2                                                             43   5e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    43   6e-04
Scas_711.56                                                            43   6e-04
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    42   6e-04
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    43   7e-04
KLLA0B00605g complement(46736..47455) some similarities with sp|...    42   7e-04
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    42   0.001
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    43   0.001
Scas_569.2                                                             42   0.001
Kwal_47.19045                                                          42   0.001
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    42   0.002
Scas_631.7                                                             42   0.002
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            42   0.002
Scas_378.1                                                             40   0.002
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    41   0.002
KLLA0E18645g complement(1648263..1649558) some similarities with...    41   0.002
Kwal_27.11824                                                          40   0.002
KLLA0A10373g complement(907244..907864) some similarities with c...    40   0.003
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    41   0.003
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       41   0.003
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    40   0.004
Scas_713.11                                                            40   0.004
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    40   0.004
CAGL0M01870g complement(219813..220760) some similarities with t...    40   0.004
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    40   0.005
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    40   0.006
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    40   0.006
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    40   0.006
Scas_575.3                                                             40   0.006
Scas_719.68                                                            40   0.007
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          39   0.008
Kwal_14.2543                                                           40   0.008
CAGL0E06116g complement(604708..606549) some similarities with t...    39   0.009
CAGL0L07480g complement(822240..823184) some similarities with s...    39   0.011
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    39   0.012
Scas_568.5                                                             38   0.012
Scas_720.33                                                            39   0.012
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             38   0.013
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    38   0.015
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    38   0.017
Scas_718.36d                                                           38   0.021
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    38   0.021
Scas_687.33                                                            38   0.021
Scas_636.14d                                                           37   0.024
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    37   0.026
Kwal_26.9300                                                           37   0.035
Kwal_33.14227                                                          37   0.041
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    37   0.052
Scas_627.17d                                                           36   0.053
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    36   0.053
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    37   0.055
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    37   0.056
Kwal_14.2278                                                           37   0.058
Scas_718.67                                                            37   0.059
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    37   0.068
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    36   0.071
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    36   0.11 
KLLA0C04103g complement(372753..374447) weakly similar to sp|Q03...    36   0.12 
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    35   0.14 
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    34   0.17 
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    35   0.20 
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    35   0.22 
Kwal_47.16577                                                          35   0.22 
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    35   0.22 
Scas_721.56                                                            34   0.22 
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    35   0.25 
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            34   0.26 
Kwal_26.8011                                                           33   0.27 
Scas_641.24                                                            34   0.30 
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    34   0.31 
Scas_717.60d                                                           33   0.36 
Kwal_27.10167                                                          33   0.41 
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          34   0.44 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    33   0.64 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    33   0.69 
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    33   0.71 
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    33   0.77 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    33   0.83 
AER227W [2729] [Homologous to ScYDL020C (RPN4) - SH] complement(...    33   0.86 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    33   0.86 
KLLA0F11682g complement(1068992..1070116) some similarities with...    33   0.89 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    33   0.89 
Scas_670.2                                                             33   0.90 
Kwal_47.18337                                                          33   0.91 
Scas_683.30                                                            33   1.0  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   1.1  
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    32   1.2  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    32   1.6  
Kwal_27.10467                                                          32   1.6  
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    31   1.9  
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    32   1.9  
Scas_717.18                                                            32   1.9  
Kwal_55.20634                                                          32   2.0  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            32   2.2  
Scas_660.12                                                            31   2.9  
Scas_613.2                                                             30   3.1  
CAGL0K06413g 627811..628890 some similarities with sp|Q00947 Sac...    31   3.4  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    31   3.7  
Scas_712.2                                                             30   3.8  
KLLA0A04609g complement(411494..412765) some similarities with s...    30   5.6  
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    30   5.8  
AAL072C [115] [Homologous to ScYDR293C (SSD1) - SH] (218958..222...    30   8.5  
Scas_604.4                                                             30   8.6  
KLLA0E01364g 138197..139474 highly similar to sp|Q12377 Saccharo...    30   9.1  
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    30   9.2  

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 1277 bits (3304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/615 (100%), Positives = 615/615 (100%)

Query: 1   MENFNTLEDEFLEQSLHHHDNFEDMIKNNIQIYEKSPVMKVRLLDSYIFDKFGEIYDTEF 60
           MENFNTLEDEFLEQSLHHHDNFEDMIKNNIQIYEKSPVMKVRLLDSYIFDKFGEIYDTEF
Sbjct: 1   MENFNTLEDEFLEQSLHHHDNFEDMIKNNIQIYEKSPVMKVRLLDSYIFDKFGEIYDTEF 60

Query: 61  ITTVFQHVIGEDVPNIVEVPKEIDYHFWIDMMDQGKRSKKKCSTSGILDFGMSLSVAENF 120
           ITTVFQHVIGEDVPNIVEVPKEIDYHFWIDMMDQGKRSKKKCSTSGILDFGMSLSVAENF
Sbjct: 61  ITTVFQHVIGEDVPNIVEVPKEIDYHFWIDMMDQGKRSKKKCSTSGILDFGMSLSVAENF 120

Query: 121 SFVEIPAVTKKLENIFWEHQYAYTSYYSSLILDKTVPQNEINKELYDLEYILSSERPDCK 180
           SFVEIPAVTKKLENIFWEHQYAYTSYYSSLILDKTVPQNEINKELYDLEYILSSERPDCK
Sbjct: 121 SFVEIPAVTKKLENIFWEHQYAYTSYYSSLILDKTVPQNEINKELYDLEYILSSERPDCK 180

Query: 181 EKIKLCCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSET 240
           EKIKLCCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSET
Sbjct: 181 EKIKLCCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSET 240

Query: 241 CNAFYIHKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKC 300
           CNAFYIHKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKC
Sbjct: 241 CNAFYIHKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKC 300

Query: 301 DQTIFTAQHVFPALCTCGKFDQTNTVFDQILSSNSDIYGHFNENLNQQFHMSQDNGLEHY 360
           DQTIFTAQHVFPALCTCGKFDQTNTVFDQILSSNSDIYGHFNENLNQQFHMSQDNGLEHY
Sbjct: 301 DQTIFTAQHVFPALCTCGKFDQTNTVFDQILSSNSDIYGHFNENLNQQFHMSQDNGLEHY 360

Query: 361 WLSSENNKYWTSQVKTLLNKSSNSENFETNSPETRLCVSTPPTDMTKSLTPHDIKLANSI 420
           WLSSENNKYWTSQVKTLLNKSSNSENFETNSPETRLCVSTPPTDMTKSLTPHDIKLANSI
Sbjct: 361 WLSSENNKYWTSQVKTLLNKSSNSENFETNSPETRLCVSTPPTDMTKSLTPHDIKLANSI 420

Query: 421 PEFIKRQLETMKPIYKEKVTDDKEVIYWLASDLDYYHNSECEDMVLFSTKPKRKCVKRGK 480
           PEFIKRQLETMKPIYKEKVTDDKEVIYWLASDLDYYHNSECEDMVLFSTKPKRKCVKRGK
Sbjct: 421 PEFIKRQLETMKPIYKEKVTDDKEVIYWLASDLDYYHNSECEDMVLFSTKPKRKCVKRGK 480

Query: 481 YPNKSRKPLKFKIRYFQTKIQTNTKSTFPVAKKLRLLPQPSGFSLLVPEETFLSDDESSK 540
           YPNKSRKPLKFKIRYFQTKIQTNTKSTFPVAKKLRLLPQPSGFSLLVPEETFLSDDESSK
Sbjct: 481 YPNKSRKPLKFKIRYFQTKIQTNTKSTFPVAKKLRLLPQPSGFSLLVPEETFLSDDESSK 540

Query: 541 NVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF 600
           NVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF
Sbjct: 541 NVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF 600

Query: 601 KRKDHVSQHLKKKTP 615
           KRKDHVSQHLKKKTP
Sbjct: 601 KRKDHVSQHLKKKTP 615

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 1/78 (1%)

Query: 539 SKNVESLGQIFN-SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICS 597
           SK+VE+ G  F   ++  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C 
Sbjct: 878 SKSVEAQGPKFEKGEVILSDSGKIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCG 937

Query: 598 KGFKRKDHVSQHLKKKTP 615
           K FKR+DHV QHL KK P
Sbjct: 938 KRFKRRDHVLQHLNKKIP 955

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 45/100 (45%)

Query: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253
           W ++  + Y + +  FG P QWY +   + +    ++K+  P+ +  C  F  HK +   
Sbjct: 237 WHLEDQDLYSINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVS 296

Query: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293
           P  L+  NI    +     +  I+ P      F+YGY++ 
Sbjct: 297 PKVLKENNIKCNKVTHYEHEFIITYPYGYHAGFNYGYNLA 336

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 535 DDESSKNVESLGQIFNSKIRY-SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC 593
           D ES  +  +  +I + +I +  DG K + C+ C   F S +HL RH+ SVHS EKP++C
Sbjct: 727 DPESPTSALAQSKINDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSC 786

Query: 594 PICSKGFKRKDHVSQHLKKKTP 615
           P C K FKR+DHV QHL KK P
Sbjct: 787 PKCGKKFKRRDHVLQHLNKKIP 808

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%)

Query: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253
           W ++  + Y + +  FG P QWY +   + +   +++K+  P+ S+ C+ F  HK +   
Sbjct: 235 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVS 294

Query: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293
           P  L+   I    +V    +  ++ P      F+YGY++ 
Sbjct: 295 PKLLQSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLA 334

>Kwal_56.23453
          Length = 828

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (63%)

Query: 539 SKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSK 598
           SK   +  +I + +I  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C K
Sbjct: 712 SKRPIAPSKINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 771

Query: 599 GFKRKDHVSQHLKKKTP 615
            FKR+DHV QHL KK P
Sbjct: 772 KFKRRDHVLQHLNKKIP 788

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%)

Query: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253
           W ++  + Y + +  FG P QWY +   + D    ++++  P+ +  C+ F  HK +   
Sbjct: 245 WHLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVS 304

Query: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293
           P  LE+  I    +V    +  I+ P      F+YGY++ 
Sbjct: 305 PKILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLA 344

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%)

Query: 547 QIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHV 606
           +I   +I  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV
Sbjct: 717 KISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 776

Query: 607 SQHLKKKTP 615
            QHL KK P
Sbjct: 777 LQHLNKKIP 785

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%)

Query: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253
           W ++  + Y + +  FG P QWY +   +      ++++  P+ S  C  F  HK +   
Sbjct: 237 WHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVS 296

Query: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293
           P  LER  I   ++V    +  ++ P      F+YGY++ 
Sbjct: 297 PKVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLA 336

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (67%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           +++  SD  K + C  C+  F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL
Sbjct: 817 NEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHL 876

Query: 611 KKKTP 615
            KK P
Sbjct: 877 NKKIP 881

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 57/133 (42%), Gaps = 6/133 (4%)

Query: 186 CCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFY 245
           C F    PW +D  N+  + +  FG P QWY +   N D  +  L K      E C AF 
Sbjct: 199 CIF----PWHLDEQNKCSINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFI 254

Query: 246 IHKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKCDQTIF 305
            H+     PDFL + NI +  +VQ   +  I+ P   +  F+YGY+         DQ   
Sbjct: 255 RHQNIITSPDFLRKNNIKFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAV 314

Query: 306 TAQHVFPALCTCG 318
             +   P  C CG
Sbjct: 315 VRKQ--PLKCGCG 325

>Scas_681.19
          Length = 864

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 499 KIQTNTKSTFPVAKKLRL-LPQPSGFSLLVPEETFLSDDESSKNVESLGQIFNSKIRYSD 557
           K Q  T  T    +K+ L + QPSG  +L+   +  +++ ++       +  + +I  S+
Sbjct: 704 KKQRLTNGTRSNQRKMELGVEQPSGDGVLIGNSSSNNNNNTNAQAP---KFTSDEIIMSE 760

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKTP 615
             K + C  C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL KK P
Sbjct: 761 TGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKIP 818

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 77/189 (40%), Gaps = 6/189 (3%)

Query: 132 LENIFWEH----QYAYTSYYSSLILDKTVPQNEINKELYDLEYILSSERPDCKEK-IKLC 186
           LEN +W+        Y +  S  I ++ +    ++K    L+Y L  E P   +  +   
Sbjct: 182 LENYYWKTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDY-LDKEIPGVNDSFLYAG 240

Query: 187 CFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYI 246
            +    PW ++  + Y + F  FG P QWY +   +     +++++  P+ ++ C  F  
Sbjct: 241 LWKASFPWHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLR 300

Query: 247 HKKYCFGPDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIVMEKTIKCDQTIFT 306
           HK +   P  L    I    +V    +  I+ P      F+YGY++        ++ +  
Sbjct: 301 HKTFMASPKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEI 360

Query: 307 AQHVFPALC 315
            +     LC
Sbjct: 361 GERANKCLC 369

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 42/64 (65%)

Query: 552 KIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           +I  S   K + C+ C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV QHL 
Sbjct: 699 EIVLSGKNKIYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLN 758

Query: 612 KKTP 615
           KK P
Sbjct: 759 KKIP 762

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%)

Query: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253
           W ++  + Y + +  FG P QWY +   +R     ++++  P+ ++ C  F  HK +   
Sbjct: 234 WHLEDQDLYSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLAS 293

Query: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293
           P  L+   I    +V   G+  I+ P      F+YGY++ 
Sbjct: 294 PKLLQENGIRCNEIVHHEGEFMITYPYGYHAGFNYGYNLA 333

>Scas_709.32
          Length = 822

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 555 YSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           +SD  K F CE C   F  S HL RH  SVHS+E+P+ CP C K F R D+++QH+K
Sbjct: 758 FSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIK 814

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 35/59 (59%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           +   DG K F C  CD  F  S HL RH  SVHS E+P+ C  C K F R D++SQHLK
Sbjct: 475 VELPDGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLK 533

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F CE CD  F    HL RH  S+H  EKPY C IC K F R D+++QH+K
Sbjct: 349 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIK 403

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 579 RHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           R  + +  A K + C  C + FKR++H+ +H++
Sbjct: 342 RKPSPILDASKQFGCEFCDRRFKRQEHLKRHVR 374

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 34/58 (58%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           D  K F CE CD  F    HL RH  S+H  EKPY C +C K F R D++SQHLK  T
Sbjct: 413 DASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLKTHT 470

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 579 RHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           R  + +  A KP+ C  C + FKR++H+ +H++
Sbjct: 406 RKPSPILDASKPFGCEYCDRRFKRQEHLKRHIR 438

>Kwal_47.17241
          Length = 403

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 35/58 (60%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           D  K F C+ CD  F    HL RH  S+H  EKP++C IC K F R D+++QH+K  T
Sbjct: 341 DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIKTHT 398

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 579 RHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           R  + +  A K + C  C + FKR++H+ +H++
Sbjct: 334 RKPSPILDASKQFACDFCDRRFKRQEHLKRHVR 366

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (61%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F CE CD  F    HL RH  S+H  EKP+ C IC+K F R D+++QH+K
Sbjct: 384 DASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVK 438

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 34/55 (61%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F CE CD  F    HL RH  S+H  EKPY C IC+K F R D+++QH+K
Sbjct: 259 DLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIK 313

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 35/52 (67%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F+C IC  +F  S HL RH  SVHS E+P+ C IC K F R D++SQH+K
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLK 611
           EKP++C IC K FKR +H+ +H++
Sbjct: 644 EKPFHCHICPKSFKRSEHLKRHVR 667

>Scas_602.9
          Length = 547

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F C+ C+  F    HL RH  S+H  EKPY C IC+K F R D+++QH+K
Sbjct: 490 DATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIK 544

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 33/55 (60%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F CE C+  F    HL RH  S+H  EKPY C IC K F R D+++QH+K
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIK 509

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 34/52 (65%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F C+ C+  F  S HL RH  SVHS E+P++C  C K F R D++SQHLK
Sbjct: 619 KPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLK 670

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLK 611
           EKP+ C  C+K F+R +H+ +H++
Sbjct: 618 EKPFKCDQCNKTFRRSEHLKRHVR 641

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 37/58 (63%)

Query: 554 RYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           R +D  K F C +C   F  S HL RH  SVHS ++P++C +C K F R D++SQH+K
Sbjct: 527 RNNDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIK 584

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           D  K F C++C+  F    HL RH +S+H  E+PY+C IC K F R D+++QH
Sbjct: 213 DDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 34/55 (61%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F C+ C+  F  S HL RH  SVHS E+P+ C  C K F R D++SQHLK
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLK 622

>Kwal_26.8351
          Length = 698

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 34/52 (65%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F C+ C   F  S HL RH  SVHS+E+P++C  C K F R D++SQHLK
Sbjct: 639 KPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLK 690

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 584 VHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           V   EKP+ C  C+K F+R +H+ +H++
Sbjct: 634 VEEEEKPFKCQECTKAFRRSEHLKRHIR 661

>Scas_649.28
          Length = 730

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 33/55 (60%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K F C  C   F  S HL RH  SVHS+E+P+ C  C K F R D++SQHLK
Sbjct: 668 DKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLK 722

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 583 SVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           S+    KP+ C  C K F+R +H+ +H++
Sbjct: 665 SLDDKNKPFKCSECIKAFRRSEHLKRHIR 693

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F C+ C   F  S HL RH  SVHS+++P+ C  C K F R D++SQHLK
Sbjct: 502 KPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLK 553

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLK 611
           EKP+ C  C+K F+R +H+ +H++
Sbjct: 501 EKPFKCQECTKAFRRSEHLKRHIR 524

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C IC   F    HL RH+NS H+ EKP+ C IC K F RKD V +HL
Sbjct: 16  SRAVKTDKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHL 74

Query: 611 KK 612
           +K
Sbjct: 75  QK 76

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ CPICS+GF R++H+ +H    T
Sbjct: 25  RPFLCPICSRGFVRQEHLKRHQNSHT 50

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 525 LLVPEETFLSDDESSKNVESLGQIF-----NSKIRYSDGFKYFYCEICDHNFPSSYHLIR 579
           LLVPE +   +   S   +  GQ        S+I  +D  + F C  C   F    HL R
Sbjct: 109 LLVPEPSMFVNGNQSNFAKPAGQGILPIPKKSRIIKTDKPRPFLCPTCTRGFVRQEHLKR 168

Query: 580 HRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           H++S H+ EKPY C  C + F R+D V +H +K
Sbjct: 169 HQHS-HTREKPYLCIFCGRCFARRDLVLRHQQK 200

>Scas_721.92
          Length = 1152

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           + F C++C   F    HL RH  S H+ EKPY C IC+K F R+D + +H +K
Sbjct: 76  RLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>Scas_707.31
          Length = 289

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           D  K ++C +C   F    HL RH  ++H   +P+ C +C K F R D+++QH++
Sbjct: 218 DDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVR 272

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           + F C  C   F    HLIRH+ S H+ EKPY C IC + F R+D + +H  K
Sbjct: 47  RLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHAHK 98

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           +R   G+K F C+ C   F    +L  H   +H+ EKPY+C IC K F RK +++ HL
Sbjct: 612 VRSHIGYKPFVCDYCGKRFTQGGNLRTHE-RLHTGEKPYSCDICDKKFSRKGNLAAHL 668

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           S   + F CE+C   F    HL RH  S H+ EKPY C +C++ F R+D + +H +K
Sbjct: 98  SGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           + F C++C   F    HL RH  S H+ EKPY C IC + F R+D + +H +K
Sbjct: 123 RLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHCQK 174

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 4/80 (5%)

Query: 536 DESSKNVESLGQI---FNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYN 592
           D+ S++  S G +     S++  +D  + F C IC   F    HL RH  S H+ EKP+ 
Sbjct: 54  DQDSEHAGSSGLVPIPKKSRLIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFL 112

Query: 593 CPICSKGFKRKDHVSQHLKK 612
           C  C + F R+D V +H +K
Sbjct: 113 CAFCGRCFARRDLVLRHQQK 132

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ CPIC++GF R++H+ +H +  T
Sbjct: 81  RPFLCPICTRGFARQEHLRRHERSHT 106

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C IC   F    HL RH+ S H+ EKP+ C  C + F R+D V +H 
Sbjct: 37  SRTIKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQ 95

Query: 611 KK 612
           +K
Sbjct: 96  QK 97

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 20/26 (76%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ CPIC++GF R++H+ +H +  T
Sbjct: 46  RPFLCPICTRGFARQEHLKRHQRSHT 71

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           + F C+ C   F    HL RH  S H+ EKPY C IC + F R+D + +H  K
Sbjct: 28  RLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           + + C+IC   F +S HL RH N +H+ EK + CP   C + F R D+  QH +
Sbjct: 98  RRYVCKICSRGFTTSGHLARH-NRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C +C   F    HL RH+ S H+ EKP+ C  C + F R+D V +H 
Sbjct: 69  SRTIKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQ 127

Query: 611 KK 612
           +K
Sbjct: 128 QK 129

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 20/26 (76%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ CP+C++GF R++H+ +H +  T
Sbjct: 78  RPFLCPVCTRGFARQEHLKRHQRSHT 103

>Kwal_47.16621
          Length = 1178

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C IC   F    HL RH+ + H+ EKP+ C  C + F R+D V +H 
Sbjct: 67  SRTIKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCFARRDLVLRHQ 125

Query: 611 KK 612
           +K
Sbjct: 126 QK 127

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ C IC++GF R++H+ +H +  T
Sbjct: 76  RPFLCSICTRGFARQEHLKRHQRAHT 101

>Scas_712.42*
          Length = 290

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLKKKT 614
           + F CE C   F    H  RH  + H+ EKP++C  P C KGF R D + +HL+  T
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHLRTHT 71

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKKKT 614
           E+P+ C  C++GF R +H  +H++  T
Sbjct: 15  ERPFRCETCARGFHRLEHKKRHMRTHT 41

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 52/123 (42%), Gaps = 9/123 (7%)

Query: 487 KPLKFKIRYFQTKIQTNTKSTFPVAKKLRLLPQPSGFSLLVPEETFLSDDESSKNVESLG 546
           K L  ++R  Q ++Q    +  P    + +  Q  G ++ V +E  L     S   +   
Sbjct: 31  KELLERVRNRQNRLQNKKPALIPAENGVDINSQ--GGNIKVKKENALPKPPKSSKSKPQD 88

Query: 547 QIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHV 606
           +      R S G K F C  C   F  S  L RH  + H A  P  CP C KGF RKD +
Sbjct: 89  R------RNSTGEKRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDAL 141

Query: 607 SQH 609
            +H
Sbjct: 142 KRH 144

>Kwal_23.5400
          Length = 429

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 539 SKNVESLGQIFNSKIRYSDGFKYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPIC 596
           S++VES+G I +     S   K ++CE   C   F     L  H+  VH   KP+ C +C
Sbjct: 27  SESVESMGSISSVDSSSSSRVKKWFCEYEGCSKAFSRPSQLTEHQEVVHQGIKPFQCTVC 86

Query: 597 SKGFKRKDHVSQHL 610
           ++ F RK H+ +H+
Sbjct: 87  ARQFSRKTHLERHM 100

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 1/52 (1%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           G K F C +C   F    HL RH  S HS +KP+ C  C KG   K  + +H
Sbjct: 77  GIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKGVTTKQQLRRH 127

>Scas_697.35
          Length = 839

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           IR   G+K + C  C   F    +L  H+  +H+ EKPY C +C K F RK +++ HL
Sbjct: 534 IRSHLGYKPYQCGYCGKRFTQGGNLRTHQ-RLHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 1/55 (1%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           +G K   C  C   F  S HL  H  S H   KPY C  C K F +  ++  H +
Sbjct: 510 EGSKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTHQR 563

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 500 IQTNTKSTFPVAKKL-RLLPQPSGFSLLVPE-ETFLSDDESSKNVESLGQIFNSKIRYS- 556
           I ++   T P+ ++L   + Q S  S ++P  E  L   E       L +I  ++ + + 
Sbjct: 24  ISSSPTHTDPIIRELLHRIRQSSPLSAVIPAPENVLKAGEPENMARGLIRIPETQTKRTG 83

Query: 557 ------DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
                 +G + + C  C   F  S  L RH   VHS   P+ C  C KGF RKD + +H
Sbjct: 84  GNNHSKEGAQLYSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRH 141

>Scas_703.23
          Length = 1341

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S++  +D  + F C  C   F    HL RH+ S H+ EKP+ C  C + F R+D V +H 
Sbjct: 61  SRVIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQ 119

Query: 611 KK 612
            K
Sbjct: 120 HK 121

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ CP C++GF R++H+ +H +  T
Sbjct: 70  RPFLCPTCTRGFVRQEHLKRHQRSHT 95

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K  +C  C+  F  S H  RH  S H+  KP+ C +CS  F R+D + +H++
Sbjct: 10  KRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHIR 60

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           C+ C   F +S HL RH N +H+ EK + C  P C + F R D+  QH +
Sbjct: 82  CQTCGKGFTTSGHLARH-NRIHTGEKNHACHFPGCGQRFSRHDNCLQHYR 130

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           +R   G+K F CE C   F    +L  H   +H+ E+PY C  C K F RK +++ H+
Sbjct: 506 VRSHIGYKPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           S G K   C  C   F  S HL  H  S H   KP+ C  C K F +  ++  H++
Sbjct: 481 SRGVKQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVR 535

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C IC   F    HL RH+ + H+ EKP+ C  C + F R+D V +H 
Sbjct: 50  SRTIKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQ 108

Query: 611 KK 612
            K
Sbjct: 109 HK 110

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +P+ C IC++GF R++H+ +H +  T
Sbjct: 59  RPFLCHICTRGFVRQEHLKRHQRAHT 84

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           + G K + C  C   F  S H IRH  S H+  KP+ C +C   F R+D + +H++
Sbjct: 2   AAGQKKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHIR 56

>Scas_683.25
          Length = 879

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F C  C   F  + H IRH  S H+  KPY C +C+  F R D   +H+K
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHIK 63

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           I+   G+K F CE C   F  + +L  HR  +H+ E+P+ C  C K F R+ +++ H
Sbjct: 499 IKAHMGYKPFECEFCGKRFTQAGNLRTHR-RLHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 1/53 (1%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           + C  C   F  S HL  H    H   KP+ C  C K F +  ++  H +  T
Sbjct: 480 YQCAYCSKMFSQSTHLDVHI-KAHMGYKPFECEFCGKRFTQAGNLRTHRRLHT 531

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 539 SKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCP--IC 596
           SK  +++ ++ ++K   +      +C+IC   F +S HL RH N +H+ EK + CP   C
Sbjct: 130 SKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRH-NRIHTGEKNHICPHEGC 188

Query: 597 SKGFKRKDHVSQHLK 611
            + F R D+ +QH +
Sbjct: 189 GQRFSRHDNCNQHYR 203

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           +R   G+K F CE C   F    +L  H   +H+ EKPY C  C + F RK +++ H
Sbjct: 542 VRSHIGYKPFSCEFCGKRFTQGGNLRTHI-RLHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           S G K F C  C   F  S HL  H  S H   KP++C  C K F +  ++  H++
Sbjct: 517 SKGVKQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIR 571

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           + + C+IC   F +S HL RH N +H+ EK + CP   C++ F R D+  QH +
Sbjct: 172 RKYICKICARGFTTSGHLARH-NRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYR 224

>Kwal_26.8021
          Length = 507

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 56/136 (41%), Gaps = 24/136 (17%)

Query: 501 QTNTKSTFPVAKKLRLLPQPSGFSLLVPEETFLSDDE----------------------S 538
           QT  +   P + + ++ PQP  ++  +P+  ++ D +                       
Sbjct: 305 QTYNQGFAPASDRPQMQPQPQRWATEMPQSAYMPDPQHIGALAARQYAGGYGSGSAAGPD 364

Query: 539 SKNVESLGQIFNSKIRYSDGFKYFY-CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICS 597
           S  V  L  + N            Y C +CD +F       RH  S HS+ KPY+CP C 
Sbjct: 365 SGPVALLAPMSNGPFGMGLVPPVAYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQ 423

Query: 598 KGFKRKDHVSQHLKKK 613
              KR+D++ QH+K K
Sbjct: 424 SRHKRRDNLFQHMKTK 439

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           + + C  C   F  S H  RH  S H+  KP++C ICS  F R+D + +H++
Sbjct: 6   RKYICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHIR 56

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           C  C+  F     L RH  S HS  KPY+CP C    KRKD++SQHLK K
Sbjct: 187 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>Kwal_47.17888
          Length = 786

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           +R   G+K F CE C   F    +L  H   +H+ EKPY C  C + F RK +++ H
Sbjct: 522 VRSHIGYKPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 546 GQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRK 603
           G    + +R   G K + CE C   F    +L  HR   H   KP++C +  C+K F + 
Sbjct: 543 GGNLRTHVRLHTGEKPYECEKCGRRFSRKGNLAAHR-LTHENLKPFHCKLDGCNKSFTQL 601

Query: 604 DHVSQHLKK 612
            ++  H  +
Sbjct: 602 GNMKAHQNR 610

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 4/69 (5%)

Query: 543 ESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKR 602
           E +G +   K R   G K   C  C   F  S HL  H  S H   KP+ C  C K F +
Sbjct: 487 ELVGGVEKPKAR---GAKQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQ 542

Query: 603 KDHVSQHLK 611
             ++  H++
Sbjct: 543 GGNLRTHVR 551

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 546 GQIFNSKIRYSDGFKY-FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKR 602
           G+I N      D FK  F CEIC   F    H  RH  + H+ EKP+ C  P C K F R
Sbjct: 3   GKIKNQDSYPPDNFKRPFRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSR 61

Query: 603 KDHVSQHLK 611
            D + +H +
Sbjct: 62  ADELKRHSR 70

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKKKT 614
           ++P+ C ICS+GF R +H  +H +  T
Sbjct: 17  KRPFRCEICSRGFHRLEHKKRHFRTHT 43

>Kwal_27.10925
          Length = 264

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQHLK 611
           + + C+IC   F +S HL RH N +H+ EK + CP   C + F R D+  QH K
Sbjct: 199 RRYVCKICVKGFTTSGHLARH-NRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYK 251

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           + + C+IC   F +S HL RH N +H+ EK + C  P C++ F R D+  QH +
Sbjct: 282 RKYICKICSRGFTTSGHLARH-NRIHTGEKRHQCQFPGCNQRFSRHDNYIQHYR 334

>Kwal_27.11460
          Length = 531

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 532 FLSDDESSKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPY 591
           + S DE +  + + G I    ++ +     + CE+CD  F   Y+L  H  + H+ E+P+
Sbjct: 385 YESADEGTSPLNATGIIRRKSLQKN--ASVYACELCDKKFTRPYNLKSHLRT-HTDERPF 441

Query: 592 NCPICSKGFKRKDHVSQH 609
           +C IC K F R+    +H
Sbjct: 442 SCAICGKAFARQHDRKRH 459

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 10/72 (13%)

Query: 549 FNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI---------CSKG 599
             S +R     + F C IC   F   +   RH + +H+ +K Y C           C K 
Sbjct: 428 LKSHLRTHTDERPFSCAICGKAFARQHDRKRHED-LHTGQKRYTCHGKLKDGTEWGCGKK 486

Query: 600 FKRKDHVSQHLK 611
           F R D + +H K
Sbjct: 487 FARSDALGRHFK 498

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLKKKT 614
           + F CEIC   F    H  RH    H+ EKP+ C +  C K F R D + +HL+  T
Sbjct: 15  RPFRCEICSRGFHRLEHKKRH-GRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHT 70

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 578 IRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           +R R    + ++P+ C ICS+GF R +H  +H +  T
Sbjct: 4   LRDRFPPDNDQRPFRCEICSRGFHRLEHKKRHGRTHT 40

>Scas_718.44
          Length = 266

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 550 NSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVS 607
           N  ++     +   C+IC   F +S HL RH N +H+ EK ++CP   C++ F R D+  
Sbjct: 198 NIAMKRQQNRRKHVCKICSTGFTTSGHLSRH-NRIHTGEKNHSCPFEGCNQKFSRHDNCL 256

Query: 608 QHLK 611
           QH +
Sbjct: 257 QHYR 260

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           DG + + C IC   F    H  RH    H+ E+P+ C  P CSK F R D +++H +
Sbjct: 21  DGPRPYVCPICQRGFHRLEHQTRHIR-THTGERPHACDFPGCSKRFSRSDELTRHRR 76

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 589 KPYNCPICSKGFKRKDHVSQHLKKKT 614
           +PY CPIC +GF R +H ++H++  T
Sbjct: 24  RPYVCPICQRGFHRLEHQTRHIRTHT 49

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 18/103 (17%)

Query: 524 SLLVPEETFLSDDESSKNVESLGQIFNSKIRY----------SDGF---KYFYCEICDHN 570
           SL VP +T +S   S +  +  GQ   SK++           SD     + + C++C   
Sbjct: 353 SLTVPSKTKIS--ASPQKHKKHGQSRKSKLQQKKHSISSLCNSDDIELRRKYLCKVCGKG 410

Query: 571 FPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           F +S HL RH N +H+ EK + CP   C + F R D+  QH K
Sbjct: 411 FTTSGHLARH-NRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYK 452

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           + + C  C   F  S H  RH  S H+  KP++C +C+  F R+D + +H++
Sbjct: 6   RKYICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHIR 56

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           + CE+C   F   Y+L  H  + H+ EKPY C IC K F R     QH KK+
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFAR-----QHDKKR 566

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 16/87 (18%)

Query: 543 ESLGQIFN------SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI- 595
           E  G++F+      S +R     K + C IC   F   +   RH + +H+ +K Y C   
Sbjct: 524 EVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKRHED-LHTGKKRYVCGGK 582

Query: 596 --------CSKGFKRKDHVSQHLKKKT 614
                   C K F R D + +H K  +
Sbjct: 583 LKDGTFWGCGKKFARSDALGRHFKTSS 609

>Scas_717.17
          Length = 525

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           + C IC  NF     L RH  S HS+E+ Y CP C    KR+D++ QH+K K
Sbjct: 388 YICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 7/72 (9%)

Query: 546 GQIFNSK------IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKG 599
           G+ FN++      +R   G + F C +C  ++ +S  L  H  + H+ EKP +CPIC+K 
Sbjct: 698 GKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKR 756

Query: 600 FKRKDHVSQHLK 611
           F    ++++H++
Sbjct: 757 FNESSNLAKHIR 768

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 558 GFKYFYCE--ICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           G   + CE   C+  F     LIRH   VHS  KP+ C  C K F  +D ++QHL+
Sbjct: 658 GLSSYKCEWEGCNKVFVQKQKLIRHL-KVHSKYKPFRCAECGKCFNTQDILTQHLR 712

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           ++    +K F C  C   F +   L +H   VHS E+P+ C +C K +     +  H++ 
Sbjct: 683 LKVHSKYKPFRCAECGKCFNTQDILTQHL-RVHSGERPFKCHLCPKSYSTSSSLRIHIRT 741

Query: 613 KT 614
            T
Sbjct: 742 HT 743

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           + C+ICD  F   Y+L  H  S H+ E+PY C +C K F R    ++H
Sbjct: 469 YACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFARMHDKNRH 515

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 544 SLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRK 603
           S   I    IR   G + F+C  C   F +S  L  H  + H+ EKP +C +C K F   
Sbjct: 554 STDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFNES 612

Query: 604 DHVSQHLK 611
            ++S+H+K
Sbjct: 613 SNLSKHMK 620

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           IR   G K   C +C   F  S +L +H   +H  E+ Y C +C + F R    + H+ K
Sbjct: 591 IRTHTGEKPLSCTVCGKRFNESSNLSKHMK-IH--ERKYMCKLCKRSFDRLPQYNSHVAK 647

>Scas_695.2
          Length = 571

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 28/60 (46%), Gaps = 5/60 (8%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFK----RKDHVSQHLKKK 613
           G   + CE+CD  F   Y+L  H    H+ E P+ C IC K F     RK H   H  KK
Sbjct: 448 GSGAYACELCDKTFTRPYNLKSHL-RTHTNEXPFVCNICGKAFARQHDRKRHEDLHTGKK 506

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           G K F C+ C   F    HL RH  S H+ +KP+ C IC KG   +  + +H
Sbjct: 133 GIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQLKRH 183

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 560 KYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           K ++C+   C+ +F     L  H+ +VH   KP+ C  C K F +K H+++H+
Sbjct: 104 KVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 539 SKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSK 598
            K V +  Q+   +I ++  F   Y E C+ +F     L  H  SVH  EK   CP C+K
Sbjct: 171 GKGVTTRQQLKRHEITHTKSFHCSY-EGCNESFYKHPQLRSHILSVH--EKKLTCPHCNK 227

Query: 599 GFKR----KDHVSQH 609
            F+R    K+H+ +H
Sbjct: 228 TFQRPYRLKNHIDKH 242

>Scas_711.56
          Length = 832

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           +R   G+K F C IC  +F +   L +H  + HS EKP+ C IC K F     +  H++ 
Sbjct: 717 MRVHSGYKPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRFAISSSLKIHIRT 775

Query: 613 KT 614
            T
Sbjct: 776 HT 777

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 554 RYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           R   G K F C+IC   F  S  L  H  + H+ EKP +C IC K F    ++S+H+K
Sbjct: 746 RTHSGEKPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHMK 802

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 561 YFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           Y YC  C   F  S  L RH  + H    PY C  C KGF RKD + +H
Sbjct: 141 YHYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGFARKDALKRH 188

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           G + + CE C   F    HL RH  S HS  KP++C +C KG   +  + +H
Sbjct: 146 GIRAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRH 196

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 533 LSDDESSKNVESLGQIFNSKIRYSDGFKYFYC--EICDHNFPSSYHLIRHRNSVHSAEKP 590
           LS   S+ +  SL  + ++    S   K  YC  E C   F     L  H+ + H   + 
Sbjct: 92  LSRTTSAGSTVSLSSVESTA--SSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRA 149

Query: 591 YNCPICSKGFKRKDHVSQHL 610
           Y C  C +GF +K H+ +HL
Sbjct: 150 YQCEQCGRGFTKKSHLERHL 169

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           + + CEIC + F    H  RH  + H+ EKP+ C  P C K F R D + +H+K
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHIK 62

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 45/102 (44%), Gaps = 14/102 (13%)

Query: 520 PSGFSLLVPEET------FLSDDE--SSKNVESLGQIF----NSKIRYSDGFKYFYCEIC 567
           PS   +  PE        +LS+DE  + K   S G         +   +DG K F+C  C
Sbjct: 94  PSAPGVARPERAREASLAYLSEDELLTKKRKTSPGAALEVSGGPEETVNDG-KRFHCTKC 152

Query: 568 DHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           +  F  S  L RH   VH    P  C +C KGF RKD + +H
Sbjct: 153 ELVFRRSGDLRRH-EKVHLPILPNICSLCGKGFARKDALKRH 193

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  +   C IC   F    HL RH+ + H+ EKP+ C  C + F R+D V +H 
Sbjct: 22  SRTIKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQ 80

Query: 611 KKKTP 615
            K  P
Sbjct: 81  YKLHP 85

>Scas_569.2
          Length = 293

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           + + C++C   F +S HL RH N +H+ EK ++C  P C   F R D+  QH +
Sbjct: 226 RKYICKVCSKGFTTSGHLARH-NRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYR 278

>Kwal_47.19045
          Length = 266

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           G + F C++C   F    H  RH  + H+ EKP++C  P C K F R D + +H++
Sbjct: 10  GHRPFKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHVR 64

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 587 AEKPYNCPICSKGFKRKDHVSQHLKKKT 614
             +P+ C +C KGF R +H  +H++  T
Sbjct: 10  GHRPFKCDMCGKGFHRLEHKRRHIRTHT 37

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 541 NVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF 600
           N+E L  + N++   ++    F C++C   F   Y+L  H    H+ E+P+ C IC K F
Sbjct: 552 NLEKLDSVTNNRKNPAN----FACDVCGKKFTRPYNLKSHL-RTHTNERPFICSICGKAF 606

Query: 601 K----RKDHVSQHLKKK 613
                RK H   H  KK
Sbjct: 607 ARQHDRKRHEDLHTGKK 623

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 10/73 (13%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI---------CSKGFK 601
           S +R     + F C IC   F   +   RH + +H+ +K Y C           C K F 
Sbjct: 586 SHLRTHTNERPFICSICGKAFARQHDRKRHED-LHTGKKRYVCGGKLKDGKPWGCGKKFA 644

Query: 602 RKDHVSQHLKKKT 614
           R D + +H K ++
Sbjct: 645 RSDALGRHFKTES 657

>Scas_631.7
          Length = 433

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 552 KIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           ++ +  G K F CE CD  F    HL RH  S HS  KP+ C  C KG   +  + +H
Sbjct: 78  QLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKGVTTRQQLKRH 134

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 560 KYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           K ++C+   C   F     L  H+ + H   KP+ C  C K F RK H+ +HL
Sbjct: 55  KNYFCDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 544 SLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRK 603
           S   I    IR   G + F C  C   F +S  L  H  + H+ EKP  C IC K F   
Sbjct: 668 STEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPLKCKICGKRFNES 726

Query: 604 DHVSQHLK 611
            ++S+H+K
Sbjct: 727 SNLSKHMK 734

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 558 GFKYFYC--EICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           G   + C  + C  +F     L+RH   VHS  KP+ CP C+K F  +D + QH++
Sbjct: 624 GQSSYQCSWDTCSKSFTQRQKLLRHL-KVHSGYKPFKCPHCTKKFSTEDILQQHIR 678

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           ++   G+K F C  C   F S+  +++     HS E+P+ C  C+K F     +  H++ 
Sbjct: 649 LKVHSGYKPFKCPHCTKKF-STEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT 707

Query: 613 KT 614
            T
Sbjct: 708 HT 709

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           IR   G K   C+IC   F  S +L +H   + + E+ Y C  C + F + + +  H  +
Sbjct: 705 IRTHTGEKPLKCKICGKRFNESSNLSKH---MKTHERKYKCEKCKRSFNQLEQLRLHQNR 761

>Scas_378.1
          Length = 208

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           D    + C +C  +F     L RH    HS+++ Y+CP C    KRKD++ QHLK K
Sbjct: 79  DTPSVYQCHMCVKSFRRHSWLKRHL-LAHSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLKKKT 614
           + F C+ C   F    H  RH  + H+ EKP++C  P C K F R D + +H++  T
Sbjct: 15  RPFRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHMRTHT 70

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           + C +C+  F     L RH  S HS  K ++CP CS   KRKD++ QHLK K
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>Kwal_27.11824
          Length = 199

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 550 NSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           N+ +    G K F C  C+  F  S  L RH  + H    P  C +C KGF RKD + +H
Sbjct: 107 NASVEDDAGAKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 165

Query: 610 LKKKT 614
               T
Sbjct: 166 FDTLT 170

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 36/81 (44%), Gaps = 9/81 (11%)

Query: 542 VESLGQ------IFNSKIRYSDGFKYFYCE--ICDHNFPSSYHLIRHRNSVHSAEKPYNC 593
           +ES G+      +    +R     K F+C    CD  F    HL  H  S HS  KPYNC
Sbjct: 12  IESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLS-HSKVKPYNC 70

Query: 594 PICSKGFKRKDHVSQHLKKKT 614
            +C KGF  K    +H +  T
Sbjct: 71  SVCGKGFATKQQFQRHQQTHT 91

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 560 KYFYC---EICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           K F C   + C  +F  + HL RH    H+ EKP+ CP C K F R D++ QH
Sbjct: 39  KTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           D  + + C IC   F    H  RH    H+ EKP+ C  P C K F R D +++H +
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIR-THTGEKPHACEFPGCGKRFSRSDELTRHTR 84

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 579 RHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           R  NS   + +PY CPICS+ F R +H ++H++  T
Sbjct: 22  RSPNSGPDSPRPYVCPICSRAFHRLEHQTRHIRTHT 57

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLKKKT 614
           + F CE C   F    H  RH  + H+ EKP+ C  P C K F R D + +H +  T
Sbjct: 15  RPFKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRHNRTHT 70

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKKKT 614
           E+P+ C  CS+GF R +H  +H++  T
Sbjct: 14  ERPFKCEHCSRGFHRLEHKKRHMRTHT 40

>Scas_713.11
          Length = 465

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 10/57 (17%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEK-PYNCPIC---------SKGFKRKDHVSQHLKKK 613
           C   F  SY L+RH+N++H+ +K  ++C  C         SK F R D +S+HLK K
Sbjct: 383 CSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKTFSRLDALSRHLKSK 439

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 6/52 (11%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           + C +CD  F   Y+L  H  + H+ E+P++C +C K F R     QH +K+
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFAR-----QHDRKR 471

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 10/75 (13%)

Query: 549 FNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI---------CSKG 599
             S +R     + F C +C   F   +   RH + +HS +K Y C           C K 
Sbjct: 441 LKSHLRTHTDERPFSCSVCGKAFARQHDRKRHED-LHSGKKRYVCGGKLKGGATWGCGKK 499

Query: 600 FKRKDHVSQHLKKKT 614
           F R D + +H K ++
Sbjct: 500 FARSDALGRHFKTES 514

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           F C++C   F     L  H N +H+ EKPY CP   C+K F  K ++ +H K
Sbjct: 173 FICKVCLKKFKRPSSLSTHMN-IHTGEKPYPCPFDNCTKSFNAKSNMLRHYK 223

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           D  +   C IC   F    H  RH    H+ EKP+ C  P C K F R D +++H +
Sbjct: 38  DAPRPHVCPICGRAFHRLEHQTRHMR-THTGEKPHACDFPGCVKRFSRSDELTRHRR 93

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 587 AEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           A +P+ CPIC + F R +H ++H++  T
Sbjct: 39  APRPHVCPICGRAFHRLEHQTRHMRTHT 66

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 560 KYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           K + CE   CD  F     L  H+N+VH   KP+ C  C   F +K H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           G K + C  C+ +F    HL RH  + H+ E+P+ C  C KG   +  + +H
Sbjct: 63  GRKPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           S+  +   C IC   F    H  RH   +H+ EKP+ C  P C K F R D +++H +
Sbjct: 32  SEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRSDELTRHRR 88

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 58/130 (44%), Gaps = 18/130 (13%)

Query: 493 IRYFQTKIQTNTKSTFPVAK----KLRLLPQPSGFSLLVPEET-----FLSDDESSKNVE 543
           I+  Q     N+ ST   A+    + + LP+P+      P+ET     +   +E  K+  
Sbjct: 495 IKAEQENDLNNSNSTRTRARQRVSRSKKLPEPTK-----PDETEFCCKWAGCNERFKSAG 549

Query: 544 SLGQIFNSKIRYSDGFKYFYCE--ICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFK 601
            L      ++  + G   + CE   C+  F     L+RH   VHS  KPY CP C K F 
Sbjct: 550 DLNDHL-EEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHL-KVHSKYKPYQCPQCQKCFS 607

Query: 602 RKDHVSQHLK 611
            +D ++QH +
Sbjct: 608 TEDTLNQHKR 617

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 544 SLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRK 603
           S     N   R   G K + C IC   F  S  L  H  + H+ EKP  C +C + F   
Sbjct: 607 STEDTLNQHKRVHSGEKPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNES 665

Query: 604 DHVSQHLK 611
            ++S+H+K
Sbjct: 666 SNLSKHMK 673

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 559 FKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           +K + C  C   F +   L +H+  VHS EKPY C IC K F   + +  H++  T
Sbjct: 594 YKPYQCPQCQKCFSTEDTLNQHK-RVHSGEKPYECHICHKRFAISNSLKIHIRTHT 648

>Scas_575.3
          Length = 455

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 556 SDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQH 609
            D  +   C IC   F    H  RH  + H+ EKP+ C  P C K F R D +++H
Sbjct: 62  GDAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 587 AEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           A +P+ CPIC + F R +H ++H++  T
Sbjct: 64  APRPHVCPICQRAFHRLEHQTRHMRTHT 91

>Scas_719.68
          Length = 1350

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 551 SKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           S+   +D  + F C IC      + HL RH+ S H+ EKP+ C  C + F R+D V ++ 
Sbjct: 30  SRTIKTDKPRPFLCPICTR----TEHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQ 84

Query: 611 KK 612
            K
Sbjct: 85  TK 86

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 560 KYFYCE--ICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           + F CE   C   F  + HL  H+ S HS  KP  CP+CSKGF     +S+H K
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRHKK 88

>Kwal_14.2543
          Length = 711

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)

Query: 544 SLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRK 603
           S   I    +R   G K + C  C   F +S  L  H  + H+ EKP  C +C K F   
Sbjct: 616 STQDILQQHMRTHSGEKPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFNES 674

Query: 604 DHVSQHLK 611
            ++S+H++
Sbjct: 675 SNLSKHMR 682

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 543 ESLGQIFNSK------IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPIC 596
           E+ G++   +      +R    +K   C  C   F S+  +++     HS EKPY C  C
Sbjct: 581 ENCGRVITQRQKLLRHLRVHTRYKPCKCVHCLKTF-STQDILQQHMRTHSGEKPYKCSHC 639

Query: 597 SKGFKRKDHVSQHLKKKT 614
            KGF     +  H++  T
Sbjct: 640 GKGFATSSSLRIHIRTHT 657

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 3/60 (5%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           IR   G K   C++C   F  S +L +H   + + E+ Y C  C + F  K+ +  H  +
Sbjct: 653 IRTHTGEKPLECKVCGKRFNESSNLSKH---MRTHERKYKCQKCKRSFDFKEQLEVHQSR 709

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           C+ +F  + HL RH    H+ EKP+ C IC K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHI-RRHTGEKPFKCDICLKYFSRIDNLKQH 74

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQHLK 611
           C+IC   F +S HL RH   +H+ EK + CP   C++ F R D+  QH +
Sbjct: 254 CQICLTGFTTSGHLSRHA-KIHTGEKSHVCPHEGCNQSFSRHDNCLQHYR 302

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
            R   G K + C IC+  F  S  L  H    H+ EKP  C IC K F    ++S+H+K
Sbjct: 787 TRTHSGEKPYKCHICNKKFAISSSLKIHI-RTHTGEKPLQCKICGKRFNESSNLSKHIK 844

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 559 FKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           +K + C+ C   F S   L++H    HS EKPY C IC+K F     +  H++  T
Sbjct: 765 YKPYKCKTCKRCFSSEETLVQHT-RTHSGEKPYKCHICNKKFAISSSLKIHIRTHT 819

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 528 PEETFLSDDESSKNVESLGQIFN--SKIRYSDGFKYFYC--EICDHNFPSSYHLIRHRNS 583
           PE+     D  +K+  S  ++ +    +  + G   + C    C   FP    LIRH   
Sbjct: 702 PEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHL-K 760

Query: 584 VHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           VHS  KPY C  C + F  ++ + QH +
Sbjct: 761 VHSKYKPYKCKTCKRCFSSEETLVQHTR 788

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF 600
           IR   G K   C+IC   F  S +L +H   + + +K Y C  CSK F
Sbjct: 815 IRTHTGEKPLQCKICGKRFNESSNLSKH---IKTHQKKYKCSDCSKSF 859

>Scas_568.5
          Length = 199

 Score = 37.7 bits (86), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           K + C  C+  F  S  L RH  + H    P+ C  C KGF RKD + +H   +T
Sbjct: 116 KRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFARKDALKRHFNTQT 169

>Scas_720.33
          Length = 316

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 560 KYFYCEI---CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           K F C+    C   F    HL RH    H+ EKP+ C IC + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           K + C+ C+  F  S  L RH  + H    P  C +C KGF RKD + +H
Sbjct: 123 KKYQCDKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRH 171

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           C+ +F  + HL RH    H+ EKP+ C IC K F R D++ QH
Sbjct: 27  CNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 10/59 (16%)

Query: 565 EICDHNFPSSYHLIRHRNSVHSAEKP-YNCPIC---------SKGFKRKDHVSQHLKKK 613
           E+C   F  +Y L RH+N++H+ ++  + C  C          K F R D +++H+K K
Sbjct: 416 EVCGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFSRLDALTRHIKAK 474

>Scas_718.36d
          Length = 330

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           ++C++C   F     L  H N + S  +PY CP   C+K F  K ++ +H K
Sbjct: 239 YFCDVCGKGFRRPSSLRTHSN-IRSGNRPYKCPYSNCTKSFNAKSNMLRHYK 289

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 528 PEETFLSDDESSKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSA 587
           P+  F   D   K       +   ++    G + F C+ C  +F    HL RH  + HS 
Sbjct: 46  PKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSD 104

Query: 588 EKPYNCPICSKGFKRKDHVSQH 609
            KP+ C  C KG   +  + +H
Sbjct: 105 TKPFQCSYCGKGVTTRQQLKRH 126

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 560 KYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           K ++C+   CD  F     L  H+ SVH   + + C  C+K F +K H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

>Scas_687.33
          Length = 288

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 557 DGF-KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           D F + F C IC   F    H  RH  + H+ EKP+ C    C K F R D + +H++
Sbjct: 11  DNFQRPFRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHIR 67

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKKKT 614
           ++P+ CPICS+GF R +H  +H++  T
Sbjct: 14  QRPFRCPICSRGFHRLEHKKRHVRTHT 40

>Scas_636.14d
          Length = 275

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 22/130 (16%)

Query: 507 TFPVAKKLRL-----LPQPSGFSLLVPEETFLSDDESSKNVESLGQIFNSKIRYSDGFKY 561
           T P+  +L L     +  P     +  E + + +  S++ + + G I N+ I  + G   
Sbjct: 139 TLPIVDRLNLEENADVKYPMNEPFVDSEFSLIGEANSTEAIATTGTIENTGITEAIGSTE 198

Query: 562 ----------------FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDH 605
                           F C  C   + +     +H   VH  E+ + C  CS+ FKRKDH
Sbjct: 199 PTQAAQPTEALRINPEFPCPHCQKTYRTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDH 257

Query: 606 VSQHLKKKTP 615
           + +H +  +P
Sbjct: 258 MIKHQEGGSP 267

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 37.4 bits (85), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 1/55 (1%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           K F CE C   F  S  L RH    H    P  C +C KGF RKD + +H   +T
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFDTQT 255

>Kwal_26.9300
          Length = 304

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 564 CEICDHNFPSSYHLIRHRNS-VHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           C IC HNF ++  L  HR+S +    KP+ CP+C +GF R + + +H K+
Sbjct: 148 CPIC-HNFYAN--LSTHRSSHLQPENKPHKCPVCGRGFTRHNDLLRHRKR 194

>Kwal_33.14227
          Length = 551

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 10/59 (16%)

Query: 565 EICDHNFPSSYHLIRHRNSVHSAEKP-YNCPIC---------SKGFKRKDHVSQHLKKK 613
           E C   F   Y LIRH+ ++H+++K  + C  C          K F R D +S+H+K K
Sbjct: 469 EPCSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQGAEGYQKTFSRGDALSRHIKVK 527

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 31/69 (44%), Gaps = 13/69 (18%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI----------C--SKGFKRKD 604
           +G + F C  CD  F    +L RH    H+ EK Y+CP           C  S GF R+D
Sbjct: 155 NGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYHCPFFNSATPPDLRCHNSGGFSRRD 213

Query: 605 HVSQHLKKK 613
               HLK +
Sbjct: 214 TYKTHLKAR 222

>Scas_627.17d
          Length = 275

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKTP 615
           F C  C   + +     +H   VH  E+ + C  CS+ FKRKDH+ +H +  +P
Sbjct: 215 FPCPHCQKTYLTEAQQKKHLKDVH-VERKHMCLFCSRWFKRKDHMIKHQEGGSP 267

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           + + C  C   F  +  L  HRN +H+ ++P+ CP   C K F  + ++ +H K
Sbjct: 181 QRYVCTECGKGFARASSLRTHRN-IHTGDRPFTCPFKNCGKSFNARSNMLRHHK 233

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
           D  + + C IC   F    H  RH  + H+ EKP+ C    C K F R+D +++H +
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRHRR 72

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 587 AEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           A +PY CPIC++ F R +H ++H++  T
Sbjct: 18  APRPYVCPICARAFHRLEHQTRHIRTHT 45

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 556 SDGFKYFY-CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           S   KY + C+ C+ +F     L RH  S HS ++ + CP C    KRKD++ QH+K K
Sbjct: 339 SSDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCLSRQKRKDNLLQHMKLK 396

>Kwal_14.2278
          Length = 463

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 15/80 (18%)

Query: 535 DDESSK---NVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPY 591
           DD +SK      +LGQ         +  + + C IC   F    H  RH    H+ EKP+
Sbjct: 2   DDSASKKKRRSANLGQ---------ESPRPYICPICSRAFHRLEHQTRHIR-THTGEKPH 51

Query: 592 NC--PICSKGFKRKDHVSQH 609
            C    C+K F R D +++H
Sbjct: 52  ACDFAGCTKRFSRSDELTRH 71

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 579 RHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           R  N    + +PY CPICS+ F R +H ++H++  T
Sbjct: 11  RSANLGQESPRPYICPICSRAFHRLEHQTRHIRTHT 46

>Scas_718.67
          Length = 473

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 10/59 (16%)

Query: 565 EICDHNFPSSYHLIRHRNSVHSAEKP-YNCPIC---------SKGFKRKDHVSQHLKKK 613
           E C   F  SY L RH+N++H+++K  + C  C          K F R D +++H+K K
Sbjct: 390 EPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKSLGNEGYDKTFSRLDALTRHIKSK 448

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 30/69 (43%), Gaps = 13/69 (18%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI----------C--SKGFKRKD 604
           D  K F C  CD  F    +L RH    H+ EK Y+CP           C  S GF R+D
Sbjct: 193 DDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEVPSKRCHNSGGFSRRD 251

Query: 605 HVSQHLKKK 613
               H+K +
Sbjct: 252 TYKTHMKAR 260

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           CD +F  + HL RH     + EKP  C +C++ F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 19/77 (24%)

Query: 556 SDGF-KYFYCEI--------CDHNFPSSYHLIRHRNSVHSAEK-PYNCPIC--------- 596
           SDG  + F C+I        C   F  SY L RH+N++H+  K  + C  C         
Sbjct: 430 SDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSECIKILGSEGY 489

Query: 597 SKGFKRKDHVSQHLKKK 613
            K F R D +++H+K K
Sbjct: 490 QKTFSRLDALTRHIKSK 506

>KLLA0C04103g complement(372753..374447) weakly similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c SON1 26S proteasome
           subunit singleton, start by similarity
          Length = 564

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 10/59 (16%)

Query: 565 EICDHNFPSSYHLIRHRNSVHSAEKP-YNCPIC-----SKG----FKRKDHVSQHLKKK 613
           E C   F   Y LIRH+ ++H+++K  + C IC     S+G    F R D +S+H+K K
Sbjct: 482 EPCMKKFSRPYDLIRHQKTIHASKKKIFRCLICIQELGSEGYQRTFSRNDALSRHVKVK 540

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 564 CEICDHNFPSSYHLIRHRNSVH--SAEKPYNCPICSKGFKRKDHVSQHLKK 612
           C IC HNF   Y  +    S H    ++P+ CPIC +GF R + + +H K+
Sbjct: 279 CPIC-HNF---YANLSTHKSTHLTPEDRPHKCPICQRGFARNNDLIRHKKR 325

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 33.9 bits (76), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQH 609
           C IC  +F     L  H   +H+  KPY CP   C+K F  K ++ +H
Sbjct: 118 CAICRKSFTRKTSLQTHM-LIHTKAKPYRCPYRTCNKTFNVKSNLYRH 164

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI------------CSKGFKRKDHVSQH 609
           F C  CD  F    +L RH    H+ EK Y+CP              + GF R+D    H
Sbjct: 152 FVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTH 210

Query: 610 LKKK 613
           L+ +
Sbjct: 211 LRSR 214

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 560 KYFYCEI---CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           K F C+    C   F    HL RH    H+ E+P+ C +C + F R D++ QH++
Sbjct: 18  KSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHVE 71

>Kwal_47.16577
          Length = 881

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 10/62 (16%)

Query: 558 GFKYFYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKD----HVSQH 609
           G   F+C    C  +F  S HL RH+ + HS+EK Y C  P C + F R D    H  +H
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRH 66

Query: 610 LK 611
           L+
Sbjct: 67  LR 68

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI------------CSKGFKRKDHVSQH 609
           F C  CD  F    +L RH    H+ EK Y+CP              + GF R+D    H
Sbjct: 242 FVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFWDASLPSEKRCHSTGGFSRRDSYKTH 300

Query: 610 LKKK 613
           L+ +
Sbjct: 301 LRSR 304

>Scas_721.56
          Length = 199

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 550 NSKI-----RYSDGFKY-FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRK 603
           NSKI     R  +G +  F C  C+  F  S  L RH  + H +  P  C  C KGF RK
Sbjct: 97  NSKIMKGTPRSDEGSRTGFQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARK 155

Query: 604 DHVSQH 609
           D + ++
Sbjct: 156 DALKRY 161

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           CD  F  ++ LIRH+ S    EK Y CP C K F R+D +  H  +
Sbjct: 587 CDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSR 629

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 537 ESSKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVH--SAEKPYNCP 594
           + S +V+S     NS  R S   +   C +C HNF   Y  +    S H    ++P+ C 
Sbjct: 137 QRSTSVDSGSPQINSN-RVSKPRRKKECPVC-HNF---YANLSTHKSTHLTPEDRPHKCS 191

Query: 595 ICSKGFKRKDHVSQHLKK 612
           +CS+GF R + + +H K+
Sbjct: 192 VCSRGFARSNDLLRHKKR 209

>Kwal_26.8011
          Length = 190

 Score = 33.5 bits (75), Expect = 0.27,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           + C++C   F  S  L  H  + H+  +P+ CP   CSK F  K ++ +HLK
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLT-HTGSRPFRCPFASCSKTFNVKSNMVRHLK 178

>Scas_641.24
          Length = 532

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 28/64 (43%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI----------C--SKGFKRKDHVSQH 609
           F C  CD  F    +L RH    H+ EK Y+CP           C  + GF R+D    H
Sbjct: 183 FICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSESRCHNTGGFSRRDTYKTH 241

Query: 610 LKKK 613
           LK +
Sbjct: 242 LKAR 245

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613
           C +C   F     L RH  S HS ++ + CP C+   KR+D++ QH+K K
Sbjct: 536 CHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQHMKLK 584

>Scas_717.60d
          Length = 167

 Score = 33.1 bits (74), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 546 GQIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI-CSKGFKRKD 604
           GQ  +S        + F C+ C   F +S  L +H    HS ++ + C   C K FKRKD
Sbjct: 83  GQSADSSCEILTSNELFNCKECSKAFVTSQKLKKHTKDAHS-KRMFPCEYNCGKAFKRKD 141

Query: 605 HVSQH 609
               H
Sbjct: 142 QRKSH 146

>Kwal_27.10167
          Length = 285

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHL 610
           C   F    H+  HR   HS  KP  C  CSKGF  K  +S+HL
Sbjct: 72  CGKRFLRVCHMNVHR-WTHSKIKPLKCEECSKGFTTKQQLSRHL 114

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI------------CSKGFKRKDHVSQH 609
           + C  CD  F    +L RH    H+ EK Y+CP              + GF R+D    H
Sbjct: 162 YVCHYCDAEFRIRGYLTRHIKK-HAVEKAYHCPFFNSKLPPESRCHTTGGFSRRDTYKTH 220

Query: 610 LKKK 613
           LK +
Sbjct: 221 LKSR 224

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 571 FPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           F  + H  RH    H+ EKP+ C IC K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 553 IRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF 600
           IR   G K F C+IC   F    +L +H++SVHSA K       +KGF
Sbjct: 13  IRKHTGEKPFQCDICMKFFSRIDNLKQHKDSVHSANK-------AKGF 53

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  CSK FKR   + +HLK
Sbjct: 198 HITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHLK 232

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 7/53 (13%)

Query: 564 CEICDHNF--PSSYHLIRHRNSVHSAEKPYNCP--ICSKGFKRKDHVSQHLKK 612
           CEIC  +F  PS+   +R    VH+ +KPYNC    C K F  K ++ +H++K
Sbjct: 227 CEICGKDFKRPSA---LRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRK 276

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAE-KPYNCPICSKGFKRKDHVSQHLKK 612
           C +C HNF ++  L  H+++    E +P+ C ICS+GF R + + +H K+
Sbjct: 129 CPVC-HNFYAN--LSTHKSTHLDPEARPHKCDICSRGFARSNDLQRHKKR 175

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI------------CSKGFKRKDHVSQH 609
           + C  CD  F    +L RH    H+  K Y+CP              S GF R+D    H
Sbjct: 204 YICHYCDARFRIRGYLTRHIKK-HAKRKAYHCPFFDNSISQELRCHTSGGFSRRDTYKTH 262

Query: 610 LKKK 613
           LK +
Sbjct: 263 LKSR 266

>AER227W [2729] [Homologous to ScYDL020C (RPN4) - SH]
           complement(1057101..1059038) [1938 bp, 645 aa]
          Length = 645

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 10/57 (17%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKP-YNCPIC---------SKGFKRKDHVSQHLKKK 613
           C   F   Y LIRH+ ++H+ +K  + C IC          + F R D +S+H+K K
Sbjct: 565 CLKKFSRPYDLIRHQKTIHATKKKIFRCLICIQEHGTEGYQRTFSRGDALSRHVKVK 621

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  CSK FKR   + +HLK
Sbjct: 205 HMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHLK 239

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQH--LKKKTP 615
           + C  C   F     L  H N +H+ +KPY C  P C K F  K ++ +H  L  KTP
Sbjct: 304 YRCAECGKAFARPSSLSTHMN-IHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLKTP 360

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 555 YSDGFKYFYCEICDHNFPS-SYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKK 612
           YS   K   C IC   F + S H   H   + S ++P+ C IC  GF R + + +H K+
Sbjct: 317 YSKTKKKRQCPICHKYFANLSTHKSTH---LTSQDRPHKCIICQSGFARNNDLIRHRKR 372

>Scas_670.2
          Length = 435

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKK 612
           ++P+ CPIC +GF R + + +H K+
Sbjct: 276 DRPHKCPICQRGFGRNNDLIRHQKR 300

>Kwal_47.18337
          Length = 536

 Score = 32.7 bits (73), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 13/68 (19%)

Query: 558 GFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI------------CSKGFKRKDH 605
           G K F C  C+  F    +L RH    H+ EK Y CP              + GF R+D 
Sbjct: 153 GQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKAYYCPFFNADAPKDARCHTTGGFSRRDT 211

Query: 606 VSQHLKKK 613
              HL+ +
Sbjct: 212 YKTHLRSR 219

>Scas_683.30
          Length = 478

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 588 EKPYNCPICSKGFKRKDHVSQHLKK 612
           ++P+ CPIC +GF R + + +H K+
Sbjct: 311 DRPHKCPICERGFARNNDLIRHKKR 335

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 586 SAEKPYNCPICSKGFKRKDHVSQH 609
           + EKPY C IC K F RK +++ H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP++C  CS+ FKR   + +HLK
Sbjct: 122 HITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHLK 156

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 564 CEICDHNFPSSYHLIRHRNSVHSAE-KPYNCPICSKGFKRKDHVSQHLKK 612
           C IC  NF ++  L  H+ +  + E +P+ CPIC +GF R + + +H K+
Sbjct: 144 CPIC-RNFYAN--LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRHKKR 190

>Kwal_27.10467
          Length = 302

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLK 611
           + C  C   F     L  H N+ H+ +KPY CP   C K F  + ++++H K
Sbjct: 198 YTCTKCGKVFNRPSSLATH-NNTHTGDKPYCCPFDNCDKQFNARSNMTRHYK 248

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 25/56 (44%)

Query: 554 RYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQH 609
           R     K + C IC  ++     L +H  + H  ++   C  C K F RKD + +H
Sbjct: 112 RRRSNQKIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRH 167

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 567 CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKT 614
           C   F  ++ L+RH+ S    EK Y+C  C K F  +D + +H ++K+
Sbjct: 730 CQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERKS 775

>Scas_717.18
          Length = 354

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 11/96 (11%)

Query: 518 PQPSGFSLLVPEETFLSDDESSKNVESLGQIFNSKIRYSDGFKYFYCEICDHNFPSSYHL 577
           P PS  S  +PE   + +DE      +  +  +   R     +   C ICD     S  L
Sbjct: 260 PDPSPDSTALPE---VQNDE-----PTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSL 311

Query: 578 IRHRNSVHSAEKPYNC--PICSKGFKRKDHVSQHLK 611
             H   +H+ EKPY C  P C      K ++++H K
Sbjct: 312 RSHL-LIHTGEKPYKCTWPNCDTSSSVKSNITRHYK 346

>Kwal_55.20634
          Length = 419

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  C+K FKR   + +HLK
Sbjct: 108 HITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHLK 142

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  C K FKR   + +HL+
Sbjct: 104 HITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHLR 138

>Scas_660.12
          Length = 367

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 13/69 (18%)

Query: 557 DGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPI----------C--SKGFKRKD 604
           +    + C  C   F    +L RH    H+ EK Y+CP           C  S GF R+D
Sbjct: 91  NAINEYVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRD 149

Query: 605 HVSQHLKKK 613
               HLK +
Sbjct: 150 TYKTHLKAR 158

>Scas_613.2
          Length = 186

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 555 YSDGFKY-FYCEICDHNFPSSYHLIRHRN 582
           Y  G ++ FYCEICD  F  S   I H N
Sbjct: 69  YKKGKQFGFYCEICDLTFKDSLQFIDHLN 97

>CAGL0K06413g 627811..628890 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1, hypothetical
           start
          Length = 359

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 13/64 (20%)

Query: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSK------------GFKRKDHVSQH 609
           F C  CD  F    +L RH    H+ +K Y CP  ++            GF R+D    H
Sbjct: 41  FVCHYCDARFKIRGYLTRHIKK-HALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAH 99

Query: 610 LKKK 613
           +K +
Sbjct: 100 MKTR 103

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  C+K FKR   + +HLK
Sbjct: 163 HITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHLK 197

>Scas_712.2
          Length = 327

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)

Query: 562 FYCEI--CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGF----KRKDHVSQHLKK 612
           + C++  C   F    HL  H+   HS  KP  C  C KGF    + K H++ H KK
Sbjct: 43  YICDVEGCGKRFMRPCHLKVHK-WTHSKVKPLKCAFCEKGFITNQQLKRHLNTHAKK 98

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 559 FKYFYCEICDH--NFPSSY--HLIRHRNSVHSAEKPYNCPI--CSKGFKRKDHVSQHLKK 612
            K   C IC    + PS+   HL     S+H+ +KPY CP   C K F  K ++ +H K+
Sbjct: 338 LKKNQCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR 392

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
           Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 6/109 (5%)

Query: 107 ILDFGMSLSVAENFSFVEIPAVTKKLENIFWEHQYAYTSYYSSLILDKTVPQNEINKELY 166
           + DF   LS  +   F E P + K L+N        Y++     I +  V +N IN  L 
Sbjct: 537 VRDFQTILSYLKIHPFSEFPELIKNLDNASVGLTEMYSAENGCPINEIEVIKNGINTNLS 596

Query: 167 DLEYILSSERPDCKEKIKLCCFGTQIPWRIDTVNQYHLIFNLFGTPIQW 215
           DL YI        +  I +      +  +I    Q+ L+  L  TPI+W
Sbjct: 597 DLFYIFK------QYDIAIRHSKANVSSQIKIPKQHLLLIPLKFTPIEW 639

>AAL072C [115] [Homologous to ScYDR293C (SSD1) - SH]
           (218958..222620) [3663 bp, 1220 aa]
          Length = 1220

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 414 IKLANSIPEFIKRQLETMKPIYKEKVTDDKEVIYWLASDLDYYHNSECEDMVLFSTKPKR 473
           + + NS+P  +K +L  +  +  EKV  D   I  L      Y   E E  V  ST  +R
Sbjct: 812 LGMKNSVPNLLKTKLALLDSLDDEKVKVD---INILDKSPAAYVIGEIEHKV-NSTIAER 867

Query: 474 KCVKRG--KYPNKSRKPLKFKIRYFQTKIQ 501
             VK G   +  +  +P+  K++ F+ KIQ
Sbjct: 868 TYVKLGSSAFLRRQPQPISTKLQLFKKKIQ 897

>Scas_604.4
          Length = 585

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 576 HLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLK 611
           H+  H   VH   KP+ C  C+K FKR   + +HL+
Sbjct: 233 HITSHL-RVHVPLKPFACKKCTKKFKRPQDLKKHLR 267

>KLLA0E01364g 138197..139474 highly similar to sp|Q12377
           Saccharomyces cerevisiae YDL097c RPN6 subunit of the
           regulatory particle of the proteasome singleton, start
           by similarity
          Length = 425

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 12/74 (16%)

Query: 410 TPHDIKLANSIPEFIKRQLETMKPIYKEKVTDDKEVIYWLASDLDYYHNSE------CED 463
           T H +K    + EF+ R  E M  + K K+    +V+  L +D +   +S       CED
Sbjct: 58  TTHQLK---KLAEFVPRSREYMMKVAKSKIA---KVLKTLLNDFELIPDSLDTQIEICED 111

Query: 464 MVLFSTKPKRKCVK 477
            + F+TK KR  +K
Sbjct: 112 SIDFATKEKRIFLK 125

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 560 KYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSK 598
           K F C+ C   F    HL  H  S H  +KPY C  C K
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 22,989,121
Number of extensions: 1105771
Number of successful extensions: 4168
Number of sequences better than 10.0: 210
Number of HSP's gapped: 4167
Number of HSP's successfully gapped: 298
Length of query: 615
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 507
Effective length of database: 12,857,365
Effective search space: 6518684055
Effective search space used: 6518684055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)