Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08085g1578155479800.0
YDR093W (DNF2)1612147453110.0
Scas_576.81591160051710.0
YER166W (DNF1)1571156851700.0
Scas_636.161554155551610.0
CAGL0L11814g1576155851450.0
KLLA0C17644g1576147248150.0
AGR120C1547158046350.0
Kwal_26.70701315104617900.0
CAGL0G06270g1328105317780.0
KLLA0A04015g1343105217520.0
YAL026C (DRS2)1355103817160.0
ADR350W1311105516420.0
YIL048W (NEO1)115110188795e-98
CAGL0L00715g11448938724e-97
Sklu_2193.111438958715e-97
ADL079C11668988709e-97
Scas_704.3811618968574e-95
Kwal_23.578911338988326e-92
KLLA0C08393g11489338167e-90
CAGL0H04477g16265398153e-88
KLLA0E01650g15505418135e-88
Kwal_23.355615975388073e-87
AFL191W15755507966e-86
YMR162C (DNF3)16565507932e-85
Scas_669.316385357423e-79
Kwal_56.234672802886591e-77
Scas_505.410253666512e-69
Scas_89.12712813919e-42
Kwal_26.920714693211719e-12
Scas_665.3014393301655e-11
CAGL0M11308g14523221621e-10
Kwal_47.1754712406391575e-10
AFR567W14493191558e-10
CAGL0A00517g11225401371e-07
KLLA0B08217g14393341371e-07
YOR291W14723311352e-07
CAGL0L01419g12143271307e-07
YGL006W (PMC1)11733761298e-07
AFR354C12103211262e-06
KLLA0E22352g12063121244e-06
Scas_583.14*8753341226e-06
AFL011W12423791217e-06
Kwal_23.316011006231208e-06
YEL031W (SPF1)12153341163e-05
KLLA0E14630g10826621145e-05
KLLA0A08910g12801921111e-04
CAGL0I04312g9511841083e-04
AEL301W9571701056e-04
YDR040C (ENA1)10916781010.001
KLLA0F20658g10826511000.002
Scas_227.0d307305950.004
YDR039C (ENA2)1091678960.007
YDR038C (ENA5)1091678950.008
Kwal_14.1498939168880.048
CAGL0K12034g1087432880.054
KLLA0A03157g938173860.082
AGL097C1096177850.11
YGL167C (PMR1)950182840.17
Scas_297.180067830.17
Scas_710.4190454830.21
CAGL0A00495g90254820.27
Scas_688.191354820.28
YPL036W (PMA2)94754810.37
YGL008C (PMA1)91854810.38
CAGL0J01870g946325800.42
AGL085C90954780.80
Kwal_47.1752289954761.2
KLLA0A09031g89954761.3
Scas_707.48*741181761.4
CAGL0I08019g1285146742.2
KLLA0E18117g8563672.6
YFL046W207117703.5
Scas_676.752574723.5
Scas_670.3173563723.9
ACL116W80482715.6
Scas_675.4485108705.7
YFL008W (SMC1)1225172707.5
KLLA0D04092g115265707.8
CAGL0J02816g62554698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08085g
         (1554 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...  3078   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...  2050   0.0  
Scas_576.8                                                           1996   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...  1996   0.0  
Scas_636.16                                                          1992   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...  1986   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...  1859   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...  1790   0.0  
Kwal_26.7070                                                          694   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   689   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   679   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   665   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   637   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   343   5e-98
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   340   4e-97
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         340   5e-97
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   339   9e-97
Scas_704.38                                                           334   4e-95
Kwal_23.5789                                                          325   6e-92
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   318   7e-90
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   318   3e-88
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   317   5e-88
Kwal_23.3556                                                          315   3e-87
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   311   6e-86
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   310   2e-85
Scas_669.3                                                            290   3e-79
Kwal_56.23467                                                         258   1e-77
Scas_505.4                                                            255   2e-69
Scas_89.1                                                             155   9e-42
Kwal_26.9207                                                           70   9e-12
Scas_665.30                                                            68   5e-11
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    67   1e-10
Kwal_47.17547                                                          65   5e-10
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    64   8e-10
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    57   1e-07
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    57   1e-07
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    57   2e-07
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    55   7e-07
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    54   8e-07
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    53   2e-06
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    52   4e-06
Scas_583.14*                                                           52   6e-06
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    51   7e-06
Kwal_23.3160                                                           51   8e-06
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    49   3e-05
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    49   5e-05
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    47   1e-04
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    46   3e-04
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    45   6e-04
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    44   0.001
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    43   0.002
Scas_227.0d                                                            41   0.004
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    42   0.007
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    41   0.008
Kwal_14.1498                                                           39   0.048
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    39   0.054
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    38   0.082
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    37   0.11 
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    37   0.17 
Scas_297.1                                                             37   0.17 
Scas_710.41                                                            37   0.21 
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    36   0.27 
Scas_688.1                                                             36   0.28 
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    36   0.37 
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    36   0.38 
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    35   0.42 
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    35   0.80 
Kwal_47.17522                                                          34   1.2  
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    34   1.3  
Scas_707.48*                                                           34   1.4  
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    33   2.2  
KLLA0E18117g join(complement(1608097..1608102), weakly similar t...    30   2.6  
YFL046W (YFL046W) [1638] chr6 (42815..43438) Mitochondrial membr...    32   3.5  
Scas_676.7                                                             32   3.5  
Scas_670.31                                                            32   3.9  
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    32   5.6  
Scas_675.4                                                             32   5.7  
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...    32   7.5  
KLLA0D04092g complement(344666..348124) some similarities with s...    32   7.8  
CAGL0J02816g 272944..274821 highly similar to sp|P40032 Saccharo...    31   8.8  

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score = 3078 bits (7980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1493/1554 (96%), Positives = 1493/1554 (96%)

Query: 1    MPSRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEXX 60
            MPSRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEE  
Sbjct: 1    MPSRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEDD 60

Query: 61   XXXXYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGT 120
                YSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGT
Sbjct: 61   MDDDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGT 120

Query: 121  QRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQP 180
            QRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQP
Sbjct: 121  QRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQP 180

Query: 181  LPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIF 240
            LPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIF
Sbjct: 181  LPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIF 240

Query: 241  GVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL 300
            GVTNPGFSAVPL             EDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL
Sbjct: 241  GVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL 300

Query: 301  WRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNR 360
            WRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNR
Sbjct: 301  WRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNR 360

Query: 361  MSRDVRPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNE 420
            MSRDVRPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNE
Sbjct: 361  MSRDVRPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNE 420

Query: 421  EIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEG 480
            EIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEG
Sbjct: 421  EIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEG 480

Query: 481  PHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIML 540
            PHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIML
Sbjct: 481  PHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIML 540

Query: 541  NAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXX 600
            NAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRD          
Sbjct: 541  NAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDFFDFGTGTGG 600

Query: 601  XXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWN 660
                     WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWN
Sbjct: 601  SATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWN 660

Query: 661  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESK 720
            ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESK
Sbjct: 661  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESK 720

Query: 721  IEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLA 780
            IEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLA
Sbjct: 721  IEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLA 780

Query: 781  LALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE 840
            LALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE
Sbjct: 781  LALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE 840

Query: 841  FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLE 900
            FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLE
Sbjct: 841  FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLE 900

Query: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960
            KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH
Sbjct: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960

Query: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020
            LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV
Sbjct: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020

Query: 1021 IKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDG 1080
            IKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDG
Sbjct: 1021 IKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDG 1080

Query: 1081 EALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSND 1140
            EALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSND
Sbjct: 1081 EALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSND 1140

Query: 1141 VAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYK 1200
            VAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYK
Sbjct: 1141 VAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYK 1200

Query: 1201 NMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQ 1260
            NMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQ
Sbjct: 1201 NMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQ 1260

Query: 1261 LYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVP 1320
            LYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVP
Sbjct: 1261 LYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVP 1320

Query: 1321 VTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFG 1380
            VTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFG
Sbjct: 1321 VTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFG 1380

Query: 1381 TPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEV 1440
            TPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEV
Sbjct: 1381 TPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEV 1440

Query: 1441 HKIAMSDIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESGVG 1500
            HKIAMSDIRVFSGA                       IPLELGKGMNDSGKKSEYESGVG
Sbjct: 1441 HKIAMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGMNDSGKKSEYESGVG 1500

Query: 1501 DEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRF 1554
            DEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRF
Sbjct: 1501 DEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRF 1554

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score = 2050 bits (5311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 988/1474 (67%), Positives = 1184/1474 (80%), Gaps = 26/1474 (1%)

Query: 91   GPDDLERRAQPGKNRESKSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLE 150
            G +D+E     G N +S++  ++KR+R+GT+R +    R DI RSKTLKWAKKN  + ++
Sbjct: 127  GFEDVELDNNEGSNNDSQADHKLKRVRFGTRRNKSG--RIDINRSKTLKWAKKNFHNAID 184

Query: 151  ELIGNENEATDETGMRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLT 210
            E    E ++ + + ++N++DELR +Y+N PLP+DMLDED  PLA YPRNKIRTTKYTPLT
Sbjct: 185  EFSTKE-DSLENSALQNRSDELRTVYYNLPLPEDMLDEDGLPLAVYPRNKIRTTKYTPLT 243

Query: 211  FLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRR 270
            F PKNIL QFHNFANIYFLIL+ILGAFQIFGVTNPGF++VPL             EDSRR
Sbjct: 244  FFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRR 303

Query: 271  TVLDLEVNNTKTHVLTGIENYNVSADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLE 330
            TVLDLEVNNT+TH+L+G++N NV+ D++SLWRRFKKAN+R +    +   E LT  GR +
Sbjct: 304  TVLDLEVNNTRTHILSGVKNENVAVDNVSLWRRFKKANTRALIKIFEYFSENLTAAGREK 363

Query: 331  KAQRKRQMANHKKNLNRKF--RNSLNSYRSNRMSRDV-RPSMDF----RPSTDINGYQQN 383
            K Q+KR+    K+N +R F  R SL+S  S RMS D  RPS+D+    +  +  N Y   
Sbjct: 364  KLQKKREELRRKRN-SRSFGPRGSLDSIGSYRMSADFGRPSLDYENLNQTMSQANRYNDG 422

Query: 384  EDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETK 443
            E+ L+++TL  + E RF+KDYWKNVKVGDIVR+HNN+EIPAD+ILLSTSD DGACYVETK
Sbjct: 423  EN-LVDRTLQPNPECRFAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETK 481

Query: 444  NLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLK 503
            NLDGETNLKVRQS+KC+  I+SS DI RT+FW+ESEGPHANLYSYQGNF+W   ++  ++
Sbjct: 482  NLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIR 541

Query: 504  NEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFN 563
            NEPVNINNLLLRGCTLRNTKWAMG+V FTGDDTKIM+NAGVTPTKKSRIS+ELN SV+ N
Sbjct: 542  NEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILN 601

Query: 564  FALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPIS 623
            F LLF+LCF AG+ NG+Y+ + PRSRD                   WVAVILYQSLVPIS
Sbjct: 602  FVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPIS 661

Query: 624  LYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNV 683
            LYISVEIIKTAQAIFIY DV++YN KLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNV
Sbjct: 662  LYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNV 721

Query: 684  MEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKN 743
            MEFKKCTINGVSYGRAYTEALAGLRKRQGVDV  E + EKE I +DRE MI++L++++ N
Sbjct: 722  MEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDN 781

Query: 744  SQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKA 803
            +QF  +++TFVSKE V+DL G SG  QQK C+HF+LALALCHSVL EP+K+DP KL+IKA
Sbjct: 782  TQFCPEDLTFVSKEIVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKA 841

Query: 804  QSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIP 863
            QSPDE+ALV+TAR +G+SF+  +K G+++E+QG++KEFQ+LN+LEFNSSRKRMSCI+KIP
Sbjct: 842  QSPDESALVSTARQLGYSFVGSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIP 901

Query: 864  GDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRE 923
            G     +PKALLICKGADSVIYSRLD+T  N+ +LLEKTALHLE+YATEGLRTLCLAQRE
Sbjct: 902  GSTPKDEPKALLICKGADSVIYSRLDRTQ-NDATLLEKTALHLEEYATEGLRTLCLAQRE 960

Query: 924  LSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIAL 983
            L+W EYERW K YD+AAA+V +REEEL+KV+D IER LILLGGTAIEDRLQDGVPDSIAL
Sbjct: 961  LTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIAL 1020

Query: 984  LGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLI 1043
            L EAGIKLWVLTGDKVETAINIGFSCN+LNNDMELLV+K +G DVE+ G+ P  +V+ L+
Sbjct: 1021 LAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLV 1080

Query: 1044 SQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNC 1103
            ++YL +KFGM+GSEEELK+AK EH +P+G FAVIIDG+ALK AL+ E+M+RKFLLLCKNC
Sbjct: 1081 TKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNC 1140

Query: 1104 KSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVM 1163
            K+VLCCRVSPAQKAAVVKLVK TLDVMTLAIGDGSNDVAMIQSA++GVGIAGEEGRQAVM
Sbjct: 1141 KAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVM 1200

Query: 1164 SSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLF 1223
             SDYAIGQFRY+TRL+LVHGKWCYKRLAEMIPQFFYKN+IFTL+LFW+GIYN++DGSYLF
Sbjct: 1201 CSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLF 1260

Query: 1224 EYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDG 1283
            EYTYLTFYNLAFTS+PVILL + DQDVSDT+S++ PQLYRVGILRKEW+QTKFLWYMLDG
Sbjct: 1261 EYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDG 1320

Query: 1284 LYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVF 1343
            +YQSVI FFFPYL Y ++M+VT NGLGLDHRY+VGV VTAIA  SCN Y+ ++Q  WD F
Sbjct: 1321 VYQSVICFFFPYLAYHKNMVVTENGLGLDHRYFVGVFVTAIAVTSCNFYVFMEQYRWDWF 1380

Query: 1344 CSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLD 1403
            C  F+ +S+ +F+ WTGIW+S+S SNEFY GAARVF  P +WAVLFVG++FCLLPRFT+D
Sbjct: 1381 CGLFICLSLAVFYGWTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTID 1440

Query: 1404 VFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVHKIAMSDIRVFSG-AXXXXXXXX 1462
              ++ FYPKDI+I+REMW RGDFD +P+ YDPTDP   +I  ++IR  +           
Sbjct: 1441 CIRKIFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRI--NEIRPLTDFKEPISLDTH 1498

Query: 1463 XXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESGVGDEILKYYLGKDSNRNTILTDNQ 1522
                           IP+ +  G  + G +  Y      E       +D       T+N 
Sbjct: 1499 FDGVSHSQETIVTEEIPMSILNG--EQGSRKGYRVSTTLE------RRDQLSPVTTTNNL 1550

Query: 1523 KRLSTYSRASN--RTSLDRTREDMLATNQLDTRF 1554
             R S  S   N  RTSLDRTRE+MLA +QLDTR+
Sbjct: 1551 PRRSMASARGNKLRTSLDRTREEMLANHQLDTRY 1584

>Scas_576.8
          Length = 1591

 Score = 1996 bits (5171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 989/1600 (61%), Positives = 1204/1600 (75%), Gaps = 96/1600 (6%)

Query: 5    SPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDT-------------NTTVYDEFG 51
            +PFED   G  P+S PFDD+ +F+D++         +T             ++T    F 
Sbjct: 6    NPFEDN--GNNPMS-PFDDNFQFEDIDFDAQPNHSSNTTANNTSSSNAYHGDSTHLTSFD 62

Query: 52   DGPYKE-----EXXXXXXYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRE 106
            D   KE     E      +S EPTP +G S NG F+D +         LE       +  
Sbjct: 63   DSKEKESLSFHEDVDNDIHSFEPTPRIGTS-NGAFDDIS---------LENDDHDPSSSH 112

Query: 107  S--KSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETG 164
                S + +KRLR GTQR +K   +  +GR+KTLKWA+K   +P EE   N ++  D+ G
Sbjct: 113  HHSTSENIMKRLRMGTQRNKKG--KPTVGRAKTLKWAQKTFVNPFEE-SNNRDDIFDDAG 169

Query: 165  MRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFA 224
            + N+A ELR +Y+N PLP++M+DED KP+ +YPRNKIRTTKY+PL F PKNI+ QF NFA
Sbjct: 170  LTNRASELRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKNIMFQFQNFA 229

Query: 225  NIYFLILIILGAFQIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHV 284
            N+YFL+LIILGAFQIFGVTNPG +AVPL             EDSRRT+LD+EVNNT+TH+
Sbjct: 230  NVYFLVLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHI 289

Query: 285  LTGIENYNVSADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQ-MANHKK 343
            L G++N NVS D++SLWRRFKKAN+R++  F++ C+   T++GR ++ Q KR  + +   
Sbjct: 290  LEGVDNGNVSVDNVSLWRRFKKANTRLLMKFIEYCKSHFTEEGRQKRRQHKRHILRSQTA 349

Query: 344  NLNRKF---RNSLNSYRSNRMSRDV-RPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWR 399
             +N      RNSL+S  S RMS D  RPS+++  +   +  + +   +++++LP   + +
Sbjct: 350  AINGGIDMARNSLDSIGSYRMSGDYGRPSLEY-DTVGQSALKTDNANIMDRSLPPRSDCK 408

Query: 400  FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459
            FSKDYWKNVKVGDIVRIHNN+EIPADIILLSTSDSDG CY+ETKNLDGETNLKVR+S+KC
Sbjct: 409  FSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKC 468

Query: 460  TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519
            +  IR+S DIART+FW+ESEGPHANLYSYQGN +W   +D  LKNEPV INNLLLRGCTL
Sbjct: 469  SHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTL 528

Query: 520  RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579
            RNTKWAMG+V FTGDDTKIMLN+G TPTKKSRIS+ELNLSV  NF  LF++CFI+ + NG
Sbjct: 529  RNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIING 588

Query: 580  IYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFI 639
            + ++KHPRSRD                   WVAVILYQSLVPISLYISVEIIKTAQA FI
Sbjct: 589  VDYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFI 648

Query: 640  YLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA 699
            Y DV++YN KLDYPCTPKSWNISDD+GQIEYIFSDKTGTLTQNVMEFKKCTING+SYGRA
Sbjct: 649  YGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRA 708

Query: 700  YTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFV 759
            YTEALAGLRKRQG+DV  E + EKE I +DR+ MIN L+NL+ NSQFY D++TF+SKEFV
Sbjct: 709  YTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFV 768

Query: 760  DDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMG 819
            +DL G SG +QQK C+HFMLALALCHSVL EP+K D  KL++KAQSPDEAALV TARD+G
Sbjct: 769  NDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVG 828

Query: 820  FSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKG 879
            FSF+ KTK G+++EVQG++KEFQILN LEFNS+RKRMSCIVKIPG + + +P+ALLICKG
Sbjct: 829  FSFIGKTKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKG 888

Query: 880  ADSVIYSRLD-KTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDI 938
            ADS+IYSRL  K G N E+LLEKTALHLEQYATEGLRTLC+AQRELSW EY  WNK+YDI
Sbjct: 889  ADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDI 948

Query: 939  AAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDK 998
            AAA+V +REE+LE VSDEIER L LLGGTAIEDRLQDGVP+SI++L +AGIKLWVLTGDK
Sbjct: 949  AAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDK 1008

Query: 999  VETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEE 1058
            VETAINIGFSCNLLNNDMELLV+KT G DV++ G  P +I ++LI++YL +KFG+ GSE 
Sbjct: 1009 VETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEM 1068

Query: 1059 ELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAA 1118
            EL  AK  HD PRG+FAV+IDGEALK AL+ E ++RKFLLLCKNCK+VLCCRVSPAQKAA
Sbjct: 1069 ELADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAA 1128

Query: 1119 VVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRL 1178
            VVKLV  +LDVMTLAIGDGSNDVAMIQSA++GVGIAGEEGRQAVM SDYAIGQFRYLTRL
Sbjct: 1129 VVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRL 1188

Query: 1179 LLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSI 1238
            +LVHG+W Y+RLAEMIP FFYKN+IFTLALFW+GIYN++DGSYLFEYT+L FYNLAFTS+
Sbjct: 1189 VLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSL 1248

Query: 1239 PVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLY 1298
            PVI +GI DQDVSDT+SLV PQLYR GILR +W+QTKFLWYMLDGLYQS I FFFPY LY
Sbjct: 1249 PVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYCLY 1308

Query: 1299 RRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTW 1358
             ++ IV++NGLGLDHR+YVGV VT++A +SCN+Y+L+ Q  WD F   F+G+S +I F W
Sbjct: 1309 HKNQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFW 1368

Query: 1359 TGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIR 1418
            TG+WSS+  S EF+  A+R++G P+FW V FVGI++CLLPRFTLD F+++FYP D++I+R
Sbjct: 1369 TGVWSSSLTSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFRKFFYPTDVEIVR 1428

Query: 1419 EMWSRGDFDSFPKKYDPTDPEVHKIAMSDI---RVFSGAXXXXXXXXXXXXXXXXXXXXX 1475
            EMW RGDF  +P  YDPTDP   K+A S     R+  G                      
Sbjct: 1429 EMWQRGDFSHYPPGYDPTDPNRPKVAKSGKFGERIVEG---------------------- 1466

Query: 1476 XXIPLELGKGMNDSGKKSEYESGVGDEILKYYLGKDSNRNTILTDNQKRLSTYSRASN-- 1533
              I L    G N+      +ES   +EI    L  D+ + TI  D Q + ++  + +   
Sbjct: 1467 --IHLSQSFGENN----FSHESVATEEIPMNILHTDAGQ-TIRRDTQDQWASSPKETQDL 1519

Query: 1534 -------------------RTSLDRTREDMLATNQLDTRF 1554
                               R+SL+RTREDMLATNQLD R+
Sbjct: 1520 LFSPRLNQEQEQRQKSNLGRSSLERTREDMLATNQLDNRY 1559

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score = 1996 bits (5170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 985/1568 (62%), Positives = 1192/1568 (76%), Gaps = 58/1568 (3%)

Query: 13   GKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEXXXXXXYSMEPTPI 72
            G  P+S PF+D+ +F+D       ED     T     F DG    +         + TP 
Sbjct: 9    GHAPMS-PFEDTFQFEDNSS---NEDTHIAPT----HFDDGATSNKYSRPQVSFNDETPK 60

Query: 73   VGRSDNGQF--NDD----NRVLMFGP---------DDLERRAQPGKNRESKSGDQIKRLR 117
              R D  +F  NDD    N      P         DD+E     G+   +  G  +KR R
Sbjct: 61   NKREDAEEFTFNDDTEYDNHSFQPTPKLNNGSGTFDDVELDNDSGEPHTNYDG--MKRFR 118

Query: 118  WGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYF 177
             GT+R +K      +GRSKTLKWA+KNI +P E+   ++ +     G  N+A ELR +Y+
Sbjct: 119  MGTKRNKKG--NPIMGRSKTLKWARKNIPNPFEDFTKDDIDP----GAINRAQELRTVYY 172

Query: 178  NQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAF 237
            N PLP+DM+DE+  P+  YPRNKIRTTKYTPLTFLPKNIL QFHNFAN+YFL+LIILGAF
Sbjct: 173  NMPLPKDMIDEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAF 232

Query: 238  QIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADD 297
            QIFGVTNPG SAVPL             EDSRRTVLDLEVNNTKTH+L G+EN NVS D+
Sbjct: 233  QIFGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHILEGVENENVSTDN 292

Query: 298  ISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF-RNSLNSY 356
            ISLWRRFKKANSR++  F+Q C+E LT++G+ ++ QRKR     +K +     R+SL+S 
Sbjct: 293  ISLWRRFKKANSRLLFKFIQYCKEHLTEEGKKKRMQRKRHELRVQKTVGTSGPRSSLDSI 352

Query: 357  RSNRMSRDVRPSMDFRPSTDINGYQQN--EDTLINKTLPTDMEWRFSKDYWKNVKVGDIV 414
             S R+S D       RPS D +  +Q   E  +++++LP   + +F+K+YWK VKVGDIV
Sbjct: 353  DSYRVSADYG-----RPSLDYDNLEQGAGEANIVDRSLPPRTDCKFAKNYWKGVKVGDIV 407

Query: 415  RIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRF 474
            RIHNN+EIPADIILLSTSD+DGACYVETKNLDGETNLKVRQS+KCT+ IR+S DIART+F
Sbjct: 408  RIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKF 467

Query: 475  WIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGD 534
            WIESEGPH+NLY+YQGN +W +L D +++NEP+ INN+LLRGCTLRNTKWAMGVV FTG 
Sbjct: 468  WIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGG 527

Query: 535  DTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXX 594
            DTKIMLN+G+TPTKKSRIS+ELN SV+ NF LLF+LCF++G+ NG+Y++K  RSR     
Sbjct: 528  DTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEF 587

Query: 595  XXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPC 654
                           WVAVILYQSLVPISLYISVEIIKTAQA FIY DV++YN KLDYPC
Sbjct: 588  GTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPC 647

Query: 655  TPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVD 714
            TPKSWNISDDLGQ+EYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+D
Sbjct: 648  TPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGID 707

Query: 715  VAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSC 774
            V  E + EK  I +DR+ MI++L+ L+ NSQFY +EVTFVSKEFV DL G SG VQQ+ C
Sbjct: 708  VETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGASGEVQQRCC 767

Query: 775  QHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEV 834
            +HFMLALALCHSVL E + ++P KL++KAQSPDEAALV TARD+GFSF+ KTK+G+++E+
Sbjct: 768  EHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEM 827

Query: 835  QGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDK-TGL 893
            QGI+KEF+ILNILEFNSSRKRMSCIVKIPG +   +P+ALLICKGADS+IYSRL + +G 
Sbjct: 828  QGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADSIIYSRLSRQSGS 887

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            N E++LEKTALHLEQYATEGLRTLC+AQRELSW EYE+WN+KYDIAAA++ +RE+ELE V
Sbjct: 888  NSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVV 947

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
            +D IER LILLGGTAIEDRLQDGVPD I LL EAGIKLWVLTGDKVETAINIGFSCNLLN
Sbjct: 948  ADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLN 1007

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
            N+MELLVIKTTG DV++ G+ P +IVD L+S+YL + F + GSEEE+ +AK +H+ P+G 
Sbjct: 1008 NEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGN 1067

Query: 1074 FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLA 1133
            +A++IDG+ALK AL  ED++RKFLLLCKNC++VLCCRVSP+QKAAVVKLVK++LDVMTLA
Sbjct: 1068 YAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLA 1127

Query: 1134 IGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEM 1193
            IGDGSNDVAMIQSA++G+GIAGEEGRQAVM SDYAIGQFRYL RL+LVHG+W YKRLAEM
Sbjct: 1128 IGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEM 1187

Query: 1194 IPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDT 1253
            IP+FFYKNMIF LALFW+GIYND+DGSYL+EYTY+ FYNLAFTS+PVI LGI DQDV+DT
Sbjct: 1188 IPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDT 1247

Query: 1254 ISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDH 1313
            ISLV PQLYRVGILRKEW+Q KFLWYMLDGLYQS+I FFFPYL+Y ++MIVTSNGLGLDH
Sbjct: 1248 ISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDH 1307

Query: 1314 RYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYH 1373
            RY+VGV VT IA ISCN Y+L+ Q  WD F   F+ +S ++ F WTGIWSSA  S EF+ 
Sbjct: 1308 RYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSCLVVFAWTGIWSSAIASREFFK 1367

Query: 1374 GAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKY 1433
             AAR++G P+FWAV FV ++FCLLPRFT D F+++FYP D++I+REMW  G FD +P  Y
Sbjct: 1368 AAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHYPPGY 1427

Query: 1434 DPTD---PEVHKIAMSDIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDSG 1490
            DPTD   P+V K      ++  G                        IP+    G  + G
Sbjct: 1428 DPTDPNRPKVTKAGQHGEKIIEG---IALSDNLGGSNYSRDSVVTEEIPMTFMHG--EDG 1482

Query: 1491 KKSEYESGVGDEILKYYLGKDSNRNTILTDNQ-KRLSTYSRASN---RTSLDRTREDMLA 1546
              S Y+        + ++        +L   Q ++  T+ R  +   R+SLDRTRE M+A
Sbjct: 1483 SPSGYQKQ------ETWMTSPKETQDLLQSPQFQQAQTFGRGPSTNVRSSLDRTREQMIA 1536

Query: 1547 TNQLDTRF 1554
            TNQLD R+
Sbjct: 1537 TNQLDNRY 1544

>Scas_636.16
          Length = 1554

 Score = 1992 bits (5161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 985/1555 (63%), Positives = 1180/1555 (75%), Gaps = 34/1555 (2%)

Query: 3    SRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNTTVYDEFGDGPYKEEXXXX 62
            SRSPF+D    +E   SPFDDS +F+D +       +K    TV D        EE    
Sbjct: 2    SRSPFQDRGHDRENPLSPFDDSFQFEDKDKT--NSFLKGDAVTVED-------VEETKYD 52

Query: 63   XXYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQR 122
               S+ PTP+VG +   QF           +D+E  ++   + E+    ++KRLR GT+R
Sbjct: 53   DSSSILPTPVVGGT--AQF-----------EDIELNSELPNSSET----EMKRLRLGTKR 95

Query: 123  RRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQPLP 182
             ++    +D  ++KT+KWA+KN+  P ++   + +   +ETG+ N++DE R IY N PLP
Sbjct: 96   VKRE-TNFDRNKTKTIKWAQKNVHIPFKKHDEDADVDDNETGLLNRSDEFRTIYHNMPLP 154

Query: 183  QDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGV 242
             +ML ED  P+  YPRNKIRTTKYTPLTF PKN++LQF+NFANIYFLI+IILGAFQIFGV
Sbjct: 155  DEMLYEDGLPIMEYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGV 214

Query: 243  TNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWR 302
            TNPG +AVPL             EDSRRT+LD+EVNNT+TH+L G EN NV  D++S WR
Sbjct: 215  TNPGLAAVPLIVIIILTAIKDAIEDSRRTLLDMEVNNTRTHILQGPENPNVPIDNVSSWR 274

Query: 303  RFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKF-RNSLNSYRSNRM 361
            +FKKAN++++  F Q   E  T  G+  + QR+ +    KK    +  R SL+SY+S RM
Sbjct: 275  KFKKANTKLMLKFFQFINERFTATGKEARKQRQMKRRRAKKLGKTELPRTSLDSYQSTRM 334

Query: 362  SRDV-RPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNE 420
            S D  RPS++   S   + ++  E ++++ +LP     +F+ D+WKNV+VGDIVRIHNN+
Sbjct: 335  SADYYRPSLE--QSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNND 392

Query: 421  EIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEG 480
            EIPAD+ILLSTSD DG CYVETKNLDGE+NLKVRQS++CT+ IR+S DI RT+FW+ESEG
Sbjct: 393  EIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEG 452

Query: 481  PHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIML 540
            PHANLY YQGN +W    D Q  NEP+ INN+LLRGCTLRNTKWAMG+V FTGDDTK M+
Sbjct: 453  PHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMI 512

Query: 541  NAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXX 600
            NAGVTPTKKSRIS+ELN SVL NF  LF+LC IAG+ NG Y+ K PRSRD          
Sbjct: 513  NAGVTPTKKSRISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGN 572

Query: 601  XXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWN 660
                     WVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV++YNE+LDYPCTPKSW+
Sbjct: 573  PTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWS 632

Query: 661  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESK 720
            ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+D   E +
Sbjct: 633  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGR 692

Query: 721  IEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLA 780
            IE+EGI +DRE MI+ L+ ++ NSQFY +E+TFVSKEF  DL G +G VQQK CQHFMLA
Sbjct: 693  IEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLA 752

Query: 781  LALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE 840
            LALCHSVL EP K DP KLE+ AQSPDE ALVTTARDMGFSF+ KTK+G+++EVQGI+KE
Sbjct: 753  LALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGLLVEVQGIQKE 812

Query: 841  FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD-KTGLNEESLL 899
            FQILNILEFNSSRKRMSCIVK+P      +P+ALLICKGADSVIYSRL  K G N+E+LL
Sbjct: 813  FQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLL 872

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            EKTALHLEQYATEGLRTLC+ QRE+SW EY+ WN+KY+IAAA++  REEEL+ V+D IER
Sbjct: 873  EKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIER 932

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L+LLGGTAIEDRLQDGVPDSIALL EAGIKLWVLTGDKVETAINIGFSCNLLN DMELL
Sbjct: 933  DLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELL 992

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
            VIKTTG DV++ G  P +IV+ L+S+YL +KF M GSEEEL  AK +H  P+GEFA+IID
Sbjct: 993  VIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGEFAIIID 1052

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139
            GEALK AL+ + MKRKFLLLCKNCK+VLCCRVSPAQKAAVVKLVK+TLDVMTLAIGDGSN
Sbjct: 1053 GEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSN 1112

Query: 1140 DVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFY 1199
            DVAMIQSA++GVGIAGEEGRQAVM SDYAIGQFRY+TRL+LVHGKWCYKRLAEMIPQFFY
Sbjct: 1113 DVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFY 1172

Query: 1200 KNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFP 1259
            KN+IFTLALFW+G++ND+DGSYLFEYTYLTFYNLAFTS+PVI LGI DQDVS T+S++ P
Sbjct: 1173 KNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVP 1232

Query: 1260 QLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGV 1319
            QLYR GILR+EW+QTKFLWYM DG+YQSVI +FFPYL+YR+  I+T NGLGLDHRYYVG+
Sbjct: 1233 QLYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGI 1292

Query: 1320 PVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVF 1379
            PVT IA  SCN Y+L++Q  WD F +FF  +S +++F WTGIWSS+  S EF+ GA+R++
Sbjct: 1293 PVTGIAVTSCNFYVLMEQYRWDWFTTFFAFLSTIVYFGWTGIWSSSIASYEFWKGASRMY 1352

Query: 1380 GTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPE 1439
            GTP+FWAV FVG +FC+LPRFT DVF +Y YP D++IIREMW  GDF  +P  YDPTDP 
Sbjct: 1353 GTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQHGDFARYPDDYDPTDPN 1412

Query: 1440 VHKIAMSDIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESGV 1499
              K+  +                               IP+       DS  +   E  V
Sbjct: 1413 KPKVEKAHEWGQYKIVDESIGDAVVCASDSQGTIVTEEIPMSFLDVKKDSSNQVTREKQV 1472

Query: 1500 GDEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRF 1554
              + L     +  + N      Q R S+ SR   RTSLDRTR++MLA+NQLDTR+
Sbjct: 1473 SRDSLDEDDARRDSMNNARNSMQFRPSSSSRV--RTSLDRTRDEMLASNQLDTRY 1525

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score = 1986 bits (5145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 985/1558 (63%), Positives = 1184/1558 (75%), Gaps = 34/1558 (2%)

Query: 12   GGKEPISSPFDDSNRFQDVE-MVPMEEDVKDTNTTVYDEFGDGPYKEEXXXXXX------ 64
            G  + I+SPFDD+  F++ +  V       + +T+    + DG   EE            
Sbjct: 8    GNGDFITSPFDDAFEFEEGDNTVNNSSSNGNGHTSGSGNWNDGHKMEEKETTLADDTDIE 67

Query: 65   -YSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQRR 123
              S++PTP +G +  G F+D    +    DD            + S  ++KRLR GT+R 
Sbjct: 68   ISSIQPTPHLGGAKTGMFDD----VALDNDD-----------HNDSSREMKRLRMGTRRV 112

Query: 124  RKSFKRY-DIGRSKTLKWAKKNIQDPLEELIGNENEATDETGMRNKADELRNIYFNQPLP 182
            +    ++ ++ R+KTLKWAKKNI++P ++   +E E  D +   N+AD+LR +Y N PLP
Sbjct: 113  KGHKSQFGNMSRNKTLKWAKKNIKNPFDDFSRDEEEENDRS--TNRADQLRTVYHNLPLP 170

Query: 183  QDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGV 242
            ++MLDE+  P+  YPRNKIRTTKYTPL+F PKN+L QF NFAN+YFL+LIILGAFQIFGV
Sbjct: 171  EEMLDEEGNPIMEYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGV 230

Query: 243  TNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWR 302
            TNPG SAVPL             EDSRRT+LDLEVNNT+TH+L G+ N NVS D++SLWR
Sbjct: 231  TNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHILEGVVNENVSVDNVSLWR 290

Query: 303  RFKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNRMS 362
            RFKKANSR++  F+Q C+E +T+ G+  + QR+R+            RNSL+S  S R S
Sbjct: 291  RFKKANSRLLMQFIQWCKERMTEDGKRRRLQRQRRKLRKSTRNGHGPRNSLDSMDSYRPS 350

Query: 363  RDV--RPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNE 420
             D   RPS+D+     I G  ++ D +I++TLP   + RF++DYWK+VKVGDIVRIHNN+
Sbjct: 351  ADYYNRPSLDYDNMGHIVGEDEDVD-IIDRTLPPRTDTRFARDYWKSVKVGDIVRIHNND 409

Query: 421  EIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEG 480
            EIPADIILLSTSDSDG CYVETKNLDGETNLKVRQ++KC+  I++S DIARTRFWIESEG
Sbjct: 410  EIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKTSRDIARTRFWIESEG 469

Query: 481  PHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIML 540
            PHANLYSYQGN +W    +N+L+NEPV INN+LLRGCTLRNTKWAMG+V FTGDDTKIML
Sbjct: 470  PHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWAMGIVVFTGDDTKIML 529

Query: 541  NAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXX 600
            NAGVTPTKKSRIS+ELN SVL NF +LF+LCFI+GL NGI ++KHPRSRD          
Sbjct: 530  NAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKHPRSRDFFEFGTVAGN 589

Query: 601  XXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWN 660
                     WVAVILYQSLVPISLYISVEIIKTAQA FIY DV++YN KLDYPCTPKSWN
Sbjct: 590  PATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWN 649

Query: 661  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESK 720
            ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQG+DV  E +
Sbjct: 650  ISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEAEGR 709

Query: 721  IEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLA 780
             EKE I +DR+ MIN L+NL+ N+QF+ DE+TF+SKE V D  G +G +Q+K C+HFMLA
Sbjct: 710  REKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGRNGDIQKKCCEHFMLA 769

Query: 781  LALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKE 840
            LALCHSVLTEPS  +P KLE+KAQSPDEAALVTTARD+GF F+ KTK GMV+E+QGI+KE
Sbjct: 770  LALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDLGFCFMGKTKTGMVVEIQGIQKE 829

Query: 841  FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD-KTGLNEESLL 899
            F+ILNILEFNS+RKRMSCI+KIPG   N +P+ALLICKGADSVIYSRL  K G N+E+LL
Sbjct: 830  FEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADSVIYSRLSTKAGENDETLL 889

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            EKTALHLEQYATEGLRTLCLAQREL+W EY  WN +YDIAAA++ +REE+LE VSD IER
Sbjct: 890  EKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAASLTNREEQLEIVSDSIER 949

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             LILLGGTAIEDRLQDGVP+SIALL EAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL
Sbjct: 950  DLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1009

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
            V+KT G DV + G  P ++V++LIS+YL +KFG++GSE EL  AK +H  P+G+FAV+ID
Sbjct: 1010 VVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMELDNAKGDHSFPKGDFAVVID 1069

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139
            G+ALK AL+ +DMKRKFLLLCKNCK+VLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN
Sbjct: 1070 GDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1129

Query: 1140 DVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFY 1199
            DVAMIQSA++G+GIAGEEGRQAVM SDYAIGQFRYLTRLLLVHG+W YKRL+EMIP+FFY
Sbjct: 1130 DVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLSEMIPEFFY 1189

Query: 1200 KNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFP 1259
            KN+IFTLALFW+GIYN++DGSYLFEYTYL FYNLAFTSIPVILLGI DQDV+DTISLV P
Sbjct: 1190 KNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPVILLGILDQDVNDTISLVVP 1249

Query: 1260 QLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGV 1319
            QLYRVGILR EW+QTKFLWYM DGLYQSVI FFFPYLLY+R+ +VT NG+GL+HRYYVG+
Sbjct: 1250 QLYRVGILRLEWNQTKFLWYMFDGLYQSVICFFFPYLLYKRNGVVTKNGMGLEHRYYVGI 1309

Query: 1320 PVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVF 1379
             VT IA  +CNLYILI Q  WD F  FF+ +S ++   WTGIW+S+  S + +    R++
Sbjct: 1310 IVTTIAVFACNLYILIHQYRWDWFSGFFIFLSCIVVIGWTGIWTSSFTSLDLWKAGERIY 1369

Query: 1380 GTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPE 1439
             +P+FWAV F+G+ FCLLPRFT D + ++F P D+ IIREMW RGD+D +P  YDPTDP 
Sbjct: 1370 DSPSFWAVFFIGVFFCLLPRFTWDCYTQFFNPSDVQIIREMWKRGDYDHYPVGYDPTDPN 1429

Query: 1440 VHKIAM-SDIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESG 1498
              KI+  +      G                        IP+ +  G + + +  E    
Sbjct: 1430 RPKISKGAKFGERLGQGIVLEDETYAGGNVSRDSVFTEEIPMNIISGTDGTPRGFEMSGR 1489

Query: 1499 VGDEILKYYLGKDSNRNTILTDNQKR--LSTYSRASNRTSLDRTREDMLATNQLDTRF 1554
              D     +   +     +L   Q    L T+ +   R S+DRTR+ MLA  +LD R+
Sbjct: 1490 TPDIPQTQWESPEREEQNLLNSPQANVGLGTFEQTV-RQSIDRTRDSMLANRELDNRY 1546

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score = 1859 bits (4815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/1472 (61%), Positives = 1108/1472 (75%), Gaps = 56/1472 (3%)

Query: 90   FGPDDLERRAQPGKNRESKSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPL 149
            F  D+ + R +  +   ++    +KR+RWGT+R +K   +  +GR+KTL+W KKN  +P 
Sbjct: 129  FAVDEEDEREKDRQLSSAEDSKHVKRMRWGTRRDKKG--KPAMGRAKTLRWTKKNFHNPF 186

Query: 150  EE--LIGNENEATDETGMRN-----KADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIR 202
             +   +  E  ++D+    N     +  E R IY+N PLP+D+LDED      YPRNKIR
Sbjct: 187  ADDTNLAAEGHSSDDDNDENYDKSHRQRETRTIYYNLPLPEDILDEDGNSTIYYPRNKIR 246

Query: 203  TTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXXXXXXXXX 262
            TTKYTPLTF PKNI  QF N AN+YFL+LII+G FQIFGV NPG + VPL          
Sbjct: 247  TTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVIVVLTSFK 306

Query: 263  XXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWRRFKKANSRIIASFVQVCRET 322
               EDSRRT+LD+EVNN  TH+L G+EN NVS D +SLWR+FKKAN+R++  F+ +C+E 
Sbjct: 307  DAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKANTRVLFRFIHLCQEL 366

Query: 323  LTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNRMSRDVRPSMDFRPSTDINGYQQ 382
             T++G+ ++AQRKR   ++K    +  RNSL+S  S       R SM+     D+    +
Sbjct: 367  FTEEGKKQRAQRKRHEMHNKIRQTQTPRNSLDSVGS------YRNSMESEFGGDLTERGK 420

Query: 383  NEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVET 442
            ++  L++ +LP   + +F+KDYWK+V VGDIVR+HNN+EIPADIILLS+SDSDGACYVET
Sbjct: 421  DDLCLLDPSLPVLPDCKFAKDYWKSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVET 480

Query: 443  KNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQL 502
            KNLDGETNLKVRQS+KC+  IR+S +I RT+F +ESEGPH+NLYSYQGN +W   E    
Sbjct: 481  KNLDGETNLKVRQSLKCSHMIRNSRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLE 540

Query: 503  KNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLF 562
            KNEPVNINNLLLRGCTLRNTKWAMG+V FTG DTKIMLNAGVTPTK SRIS+ELNLSV  
Sbjct: 541  KNEPVNINNLLLRGCTLRNTKWAMGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFM 600

Query: 563  NFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPI 622
            NFALLFVLCF AG+ NG+Y+     SR+                   WVA+ILYQS+VPI
Sbjct: 601  NFALLFVLCFAAGIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPI 660

Query: 623  SLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN 682
            SLYIS+EIIKTAQA+FIY DV +YNE+LDYPCTPKSW ISDDLGQIEYIFSDKTGTLTQN
Sbjct: 661  SLYISIEIIKTAQALFIYGDVALYNERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQN 720

Query: 683  VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAK 742
            VMEFKKCTINGVSYGRAYTEALAGLRKRQG+DV  E  +EKEGI +D+E M+  L+ L +
Sbjct: 721  VMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGE 780

Query: 743  NSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIK 802
            NSQ   + VTFVSKEFV D  G +G  Q+K  ++FMLALALCH+VL E +K+DP  ++ K
Sbjct: 781  NSQLRPENVTFVSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFK 840

Query: 803  AQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKI 862
            AQSPDEAALV TARDMGFSF+ +TK G+++++QG++KE+++LN+LEFNS+RKRMSCI+KI
Sbjct: 841  AQSPDEAALVGTARDMGFSFVGRTKNGVIVDIQGVQKEYRLLNVLEFNSTRKRMSCILKI 900

Query: 863  PGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQR 922
            P ++ N +P+ALLICKGADS+IYSRL K   N+E LLEKTALHLEQYATEGLRTLC+AQR
Sbjct: 901  PSENPNEEPRALLICKGADSIIYSRLSKN--NDEKLLEKTALHLEQYATEGLRTLCIAQR 958

Query: 923  ELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIA 982
            ELSW+EY+ WN+K++IAAAA+VDRE+E+EKV+D IER L LLGGTAIEDRLQDGVPDSIA
Sbjct: 959  ELSWKEYQEWNEKHEIAAAALVDREDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIA 1018

Query: 983  LLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTL 1042
             LGEAGIKLWVLTGDKVETAINIGFSCNLLNN+MELLVIK +G DV+  G+ P +IV  L
Sbjct: 1019 TLGEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNL 1078

Query: 1043 ISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKN 1102
            I +YL +KF M+GS EEL++AK  H+ P G F VIIDG+ALK AL  +D+KR+FLLLCK 
Sbjct: 1079 ILKYLQEKFQMSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKR 1138

Query: 1103 CKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAV 1162
            CK+VLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSA+IGVGIAGEEGRQAV
Sbjct: 1139 CKAVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAV 1198

Query: 1163 MSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYL 1222
            MSSDYAIGQFRYLTRL+LVHG+W YKR+AEMIP FFYKN+IFTL+LFW+G+YN+YDGSYL
Sbjct: 1199 MSSDYAIGQFRYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYL 1258

Query: 1223 FEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLD 1282
            FEYTYLT +NLAFTS+PVI LGI DQDV+D +S+V PQLYRVGILR EW+QTKF  YM D
Sbjct: 1259 FEYTYLTLFNLAFTSLPVIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFD 1318

Query: 1283 GLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDV 1342
             +YQSVI FF PYL Y +  IVT NG GLDHRY+VGV V  IA +SCN Y+L+ Q  WD 
Sbjct: 1319 AMYQSVICFFLPYLCYYKTGIVTQNGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDW 1378

Query: 1343 FCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTL 1402
            F S F+ +S +  F WTGIWSS + S EFY  AA ++G P FWA++F GI+FCLLPRF  
Sbjct: 1379 FSSLFIALSCLCIFAWTGIWSSFTSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAA 1438

Query: 1403 DVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVHKIAMSDIRVFSGAXXXXXXXX 1462
            D F R + PKDIDIIRE W RGDFD +P+ YDPTDP+  K+  + +              
Sbjct: 1439 DTFLRTYMPKDIDIIRECWKRGDFDHYPEGYDPTDPDRPKVKNAFV-------------- 1484

Query: 1463 XXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESGVGDEILKYYLGKDSNRNTILTDNQ 1522
                             +E+ +   DS +  E      DE+       +S+  +  +   
Sbjct: 1485 -------------YNKDIEMAQSSTDSIQTEEIPM---DELF------NSSATSPRSYPH 1522

Query: 1523 KRLSTYSRASNRTSLDRTREDMLATNQLDTRF 1554
             R   + R+S R SL+ TR +M  +NQLD R+
Sbjct: 1523 NR---HQRSSGRPSLEITRAEMRNSNQLDNRY 1551

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score = 1790 bits (4635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 909/1580 (57%), Positives = 1122/1580 (71%), Gaps = 133/1580 (8%)

Query: 15   EPISSPFDDSNRFQ------------DVEMVPMEEDVKDTNTTVYDEFGDGPYKEEXXXX 62
            +P  SPF D  +F+              E  P  +  K    T   E  DG   E     
Sbjct: 37   QPAESPFSDEFQFEVGGREGRQPSILKAERQPQRQGGKLAFATGTGEHVDGANSE----- 91

Query: 63   XXYSMEPTPI-VGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQ 121
              +SM  TP  VG+  +   +D                  GK RE +S  ++K LRWGTQ
Sbjct: 92   --FSMTLTPTRVGQPQSVPLSD------------------GKRRELRSAKEMKILRWGTQ 131

Query: 122  RRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEATDE-TGMRNKADELRNIYFNQP 180
            R R       +GR++TL+W KKN  D L E  G+    TD     +++A E R +YFN P
Sbjct: 132  RHRTG---RPVGRARTLRWGKKNY-DNLPEDRGSGGSDTDAGVAGKSRAAEKRAVYFNMP 187

Query: 181  LPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIF 240
            LP ++  E+ +P+ NYPRNKIRTTKYTPL+FLPKN+  QF N ANIYFL+L+ L    IF
Sbjct: 188  LPPELTGENGRPVVNYPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIF 247

Query: 241  GVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL 300
            GVTNP  +A+PL             EDSRRT+LDLEVNN ++H+L G+EN NVSAD++SL
Sbjct: 248  GVTNPALAAIPLIAIVVITGLKDAFEDSRRTILDLEVNNMRSHILHGVENNNVSADNVSL 307

Query: 301  WRRFKKANSRIIASFVQVCRETLTKKGRLEKAQRK---RQMANHKKNLNRKFRNSLNSYR 357
            WR+FKK N+R++ + V+  RE+ T+ GR  +AQR     QMA                  
Sbjct: 308  WRKFKKLNTRLLIATVRFFRESFTEAGRRRRAQRAREESQMA------------------ 349

Query: 358  SNRMSRDVRPSMD----FRPSTDINGYQQ----NEDTLINKTLPTDMEWRFSKDYWKNVK 409
            ++R+  D R S+D    +RPS D +   Q    ++ +++N+ LP   + RF K +WK+++
Sbjct: 350  ASRLGSDPRMSLDSMGSYRPSLDFDNIGQLVSSDQVSVLNRNLPPVPDCRFGKSHWKDIR 409

Query: 410  VGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSIDI 469
            VGDIVRIHNN+EIPADIILLSTSD+DGACYVETKNLDGETNLKVRQS+KC+  IR+S DI
Sbjct: 410  VGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRNSKDI 469

Query: 470  ARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVV 529
            +R +FW+ESEGPHANLYSYQGNF+W   E   + NEPVNINN+LLRGC+LRNTKWAMG+V
Sbjct: 470  SRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWAMGIV 529

Query: 530  AFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSR 589
             FTG DTKIMLNAGVTPTK+SRIS+ELN SV+ NF  LFVLC  AGL NGIY+ +   SR
Sbjct: 530  MFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNGIYYRRDATSR 589

Query: 590  DXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEK 649
                                +VA+ILYQSLVPISLYIS+EIIKTAQA FIY DV++YN K
Sbjct: 590  TFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYGDVLLYNPK 649

Query: 650  LDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 709
            LDYPCTP++WNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK
Sbjct: 650  LDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRK 709

Query: 710  RQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSV 769
            RQGVD+  E   E+  I+ D+++M+  L  L KNSQ     VTFVSKE V DL G +   
Sbjct: 710  RQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQDLGGANSQE 769

Query: 770  QQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEG 829
            Q+++ +HFML+LALCHSV+ E +K +P KL+IKAQSPDEAALV TARDMGFSF+ +TK G
Sbjct: 770  QKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFSFVGRTKNG 829

Query: 830  MVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD 889
            +++E+QG++KEF+ILN+LEFNS+RKRMSCIVKIP  D N KPKALL+CKGADSVIYSRLD
Sbjct: 830  VIIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKGADSVIYSRLD 889

Query: 890  KTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEE 949
            ++  N+  LLE+TALHLEQ+ATEGLRTLC+AQRE+ W+EY  WN++ ++AAA++ +REE 
Sbjct: 890  RS-RNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAAASLDNREEA 948

Query: 950  LEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSC 1009
            LE+V+D IER L+LLGGTAIEDRLQDGVPDSI++L +AGIKLWVLTGDKVETAINIGFSC
Sbjct: 949  LERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKVETAINIGFSC 1008

Query: 1010 NLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDI 1069
            NLL +DMELLVIK++G DVE LG    D+V  LI +YL   F M GS EEL  A+ +H  
Sbjct: 1009 NLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEELAAARKDHTP 1068

Query: 1070 PRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDV 1129
            P+  F V+IDG+ALK AL  ED++RKFLLLCKNCK+VLCCRVSP+QKAAVVKLVK +LDV
Sbjct: 1069 PQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAVVKLVKESLDV 1128

Query: 1130 MTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKR 1189
            +TLAIGDGSNDVAMIQ+A++G+GIAGEEGRQAVMS+DYAIGQFRYLTRL+LVHG+W YKR
Sbjct: 1129 VTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLVLVHGRWSYKR 1188

Query: 1190 LAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQD 1249
            LAEMIPQFFYKN+ FTLALFWFGI ++YDGSYLFEYTYL FYNLAFTS+PVI LGI DQD
Sbjct: 1189 LAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLPVIFLGIMDQD 1248

Query: 1250 VSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGL 1309
             SD +S+V PQLY+VGILR EW+Q KF WY  DG+YQS+I FFFPYL Y R  ++T N  
Sbjct: 1249 ASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYYRTGLITKNAY 1308

Query: 1310 GLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSN 1369
            GLDHRY  GV VT+IA +SCNLY+LI Q  WD F + F+ +S  I F WTG+WSSA+ S 
Sbjct: 1309 GLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGILFFWTGVWSSATYSG 1368

Query: 1370 EFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSF 1429
            EFY  A R++  P FWAVLFVG++FCLLPRFT D  ++ F+P+DIDI+RE W RGDFD +
Sbjct: 1369 EFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFPRDIDIVRECWWRGDFDMY 1428

Query: 1430 PKKYDPTDPEVHKIAMSDIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDS 1489
            P+ YDPTDP   +I +S   V                                 +  +D 
Sbjct: 1429 PEDYDPTDPNRPRINVSHTGV--------------------------------DRASDDE 1456

Query: 1490 GKKSEYESGVGDEILKYYLGKDSNRNTILTDNQK-----RLSTYSRA----------SNR 1534
              ++  + GV              R T+++++       + + +SRA          S R
Sbjct: 1457 RSRTGSDLGV-------------TRTTVISEDIPMGLIDKTAPHSRADPTTPLGSEDSAR 1503

Query: 1535 TSLDRTREDMLATNQLDTRF 1554
             SL+ TR +ML T+QLD+R+
Sbjct: 1504 YSLEVTRREMLQTHQLDSRY 1523

>Kwal_26.7070
          Length = 1315

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1046 (38%), Positives = 603/1046 (57%), Gaps = 109/1046 (10%)

Query: 400  FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459
            F+   W N+ VGDI+++++ E IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352

Query: 460  TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519
            TS      D+A  R  + SE P+++LY+Y+G    N       KN  ++   ++LRG TL
Sbjct: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNG------KNISLSPEQMVLRGATL 406

Query: 520  RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579
            RNT W  G+V FTG +TK+M NA  TP K++ + + +N+ ++  F +L VL  I+ + N 
Sbjct: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466

Query: 580  IYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFI 639
            I                             +   IL+ +LVPISL+++VE+IK  QA  I
Sbjct: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW--ILFSNLVPISLFVTVEMIKYYQAYMI 524

Query: 640  YLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA 699
              D+ +Y+E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y   
Sbjct: 525  ASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIET 584

Query: 700  YTEALAGLRKRQGVDVAHESKIEKEGIKR--DREEMINKLQNLAKNSQFYEDEVTFVSKE 757
              E  A   +  G+++         G ++    +E +N  Q+   +S    D        
Sbjct: 585  IPEDKAATTE-DGIEI---------GFRKFDSMKETLNDTQD--PDSHIIND-------- 624

Query: 758  FVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARD 817
                               F+  LA CH+V+  P  ++   ++ +A SPDE ALV  A  
Sbjct: 625  -------------------FLTLLATCHTVI--PEFQEDGSIKYQAASPDEGALVEGAAS 663

Query: 818  MGFSFL--KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALL 875
            +G+ F+  K     +++E  G E+E+Q+LNI EFNS+RKRMS I ++P    NG+ K  L
Sbjct: 664  LGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP----NGEIK--L 717

Query: 876  ICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKK 935
             CKGAD+VI  RL K G  E   +E T  HLE YA EGLRTLCLA R ++  EY  W   
Sbjct: 718  FCKGADTVILERL-KAG--ENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774

Query: 936  YDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLT 995
            YD A+  + DR ++L+  ++ IE+ L LLG TAIED+LQDGVP++I  L +AGIK+WVLT
Sbjct: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834

Query: 996  GDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAG 1055
            GD+ ETA+NIG SC LL+ DM LL+I       ED  AT K++ + L             
Sbjct: 835  GDRQETAVNIGMSCRLLSEDMNLLIINE-----EDKEATRKNLTEKL------------- 876

Query: 1056 SEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVS 1112
                  KA ++H I + +    A++IDG++L +AL   D++   L + K CK+V+CCRVS
Sbjct: 877  ------KAISDHQISQQDMNSLALVIDGKSLGFALEA-DLEDYLLAIGKLCKAVICCRVS 929

Query: 1113 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQF 1172
            P QKA VVK+VK   D + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D+AI QF
Sbjct: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989

Query: 1173 RYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYN 1232
            +YL +LLLVHG W Y+R+++ I   FYKN+   +  FW+   N Y G  + E   +TFYN
Sbjct: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049

Query: 1233 LAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLW-YMLDGLYQSVIAF 1291
            + FT +P  ++G+FDQ VS  +   +PQLY++G  R ++   +  W ++++G Y S + F
Sbjct: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTF 1108

Query: 1292 FFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQ-----KHWDVFCSF 1346
                L YR   ++ S+G   DH  +       ++  +C++ I+I +       W  F +F
Sbjct: 1109 IGSTLFYRNGNVLNSHGETADHWAW------GVSIYTCSVIIVIGKAALVTNQWTKFTAF 1162

Query: 1347 FVGVSIMIFFTWTGIWSS----ASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTL 1402
             +  S++ +  +  I++S    A+ S E+Y   + V+G+ TFW +  V   F L+     
Sbjct: 1163 AIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVW 1222

Query: 1403 DVFKRYFYPKDIDIIREM--WSRGDF 1426
              +KR + P+   +++EM  ++ GD+
Sbjct: 1223 KYYKRTYTPESYHVVQEMQKYNIGDY 1248

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%), Gaps = 8/114 (7%)

Query: 173 RNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILI 232
           R IY N        D++      +  N I TTKY   TF+PK +  +F  +AN++FL   
Sbjct: 182 RQIYIN--------DKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTS 233

Query: 233 ILGAFQIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLT 286
            +        TN   +   L             ED +R   D E+N+++  V +
Sbjct: 234 AIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFS 287

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1053 (39%), Positives = 598/1053 (56%), Gaps = 97/1053 (9%)

Query: 395  DMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVR 454
            + E  F +  W ++KVGDI+R+++ E IPADII+LS+S+ +G CY+ET NLDGETNLK++
Sbjct: 272  EAEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIK 331

Query: 455  QSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLL 514
            Q+   T+ I  S ++   +  I SE P+++LY+Y+G     +LE N  K  P++   ++L
Sbjct: 332  QARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEG-----TLEMNGTKI-PLSPEQMIL 385

Query: 515  RGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIA 574
            RG TLRNT W  G+V FTG +TK+M NA  TP K++ + K +N+ ++  F +L VL  I+
Sbjct: 386  RGATLRNTGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILIS 445

Query: 575  GLYNGIYHNKHPRSRDXXXXXXXXXXXXXXX-XXXXWVAVILYQSLVPISLYISVEIIKT 633
             + N I      +                       W   IL+ +LVPISL+++VE+IK 
Sbjct: 446  SIGNVIMSTADAKHLSYLYLQGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKY 502

Query: 634  AQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 693
             QA  I  D+ +Y E+ D P   K+ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G
Sbjct: 503  YQAFMIGSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAG 562

Query: 694  VSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTF 753
              Y     E  A   +  G++V + S    + +K+           L  NS         
Sbjct: 563  RCYAEHIPEDKAATFE-DGIEVGYRSF---DDLKK----------QLTTNS--------- 599

Query: 754  VSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVT 813
                  DD          K    F+  LA CH+V+  P  +    ++ +A SPDE ALV 
Sbjct: 600  ------DDC---------KIIDEFLTLLATCHTVI--PEFQADGSIKYQAASPDEGALVE 642

Query: 814  TARDMGFSFL-KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPK 872
                +G+ FL +K     +L  +  E+E+Q+LNI EFNS+RKRMS I + P D       
Sbjct: 643  GGALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPDDSIK---- 698

Query: 873  ALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERW 932
              L+CKGADSVI  RL +TG      ++ T  HLE YATEGLRTLCLA +++  +EY  W
Sbjct: 699  --LLCKGADSVILERLSETG---NFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAW 753

Query: 933  NKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLW 992
            NKKY  AA  +  R E+L+ V++EIE  L L+G TAIED+LQ+GVPD+I  L EAGIK+W
Sbjct: 754  NKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIW 813

Query: 993  VLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFG 1052
            VLTGDK ETAINIG SC LL+ DM LL+I       E   AT +++ + L + + H    
Sbjct: 814  VLTGDKQETAINIGMSCRLLSEDMNLLIISE-----ETKEATRRNMEEKLAALHEH---- 864

Query: 1053 MAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVS 1112
                      + +EHD+     A++IDG +L +AL   D++  FL + K CK+V+CCRVS
Sbjct: 865  ----------SLSEHDM--NTLALVIDGHSLSFALEA-DLEDYFLAIGKMCKAVICCRVS 911

Query: 1113 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQF 1172
            P QKA VVK+VK   + + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D ++GQF
Sbjct: 912  PLQKALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQF 971

Query: 1173 RYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYN 1232
            R+L +LLLVHG W Y+R++  I   FYKN    +  FW+   N + G  + E   ++ YN
Sbjct: 972  RFLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYN 1031

Query: 1233 LAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFF 1292
            + FT +P  ++G+FDQ V+  +   +PQLY++G   + +S + F  ++++G Y S + F 
Sbjct: 1032 VFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFV 1091

Query: 1293 FPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI 1352
               L YR    +  +G   DH  + G+ +   + I       +    W  F  F +  S+
Sbjct: 1092 GTILFYRYGFALRKHGETADHWSW-GIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSL 1150

Query: 1353 ---MIFFTWTG-IWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRY 1408
               +IFF   G I+  A  S E++      +G+ TFW  L V   F L   F    +KR 
Sbjct: 1151 FFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRM 1210

Query: 1409 FYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVH 1441
            + P+   +I+EM          +KY+ +D   H
Sbjct: 1211 YAPESYHLIQEM----------QKYNVSDYRPH 1233

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 45/106 (42%)

Query: 179 QPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQ 238
           +P    + D ++     Y  N I TTKY   TFLPK +  +F  +AN++FL    +    
Sbjct: 164 EPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVP 223

Query: 239 IFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHV 284
               TN   +   L             ED +R   D E+NN+K  +
Sbjct: 224 HVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEI 269

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1052 (38%), Positives = 595/1052 (56%), Gaps = 95/1052 (9%)

Query: 381  QQNEDTLINKTLPTDMEWR---FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGA 437
            + N D  +N +L   ++ R   F +  W ++ VGDI+R+ + E IPAD+I+LS+S+ +G 
Sbjct: 276  RSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGL 335

Query: 438  CYVETKNLDGETNLKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSL 497
            CY+ET NLDGETNLK++Q+ + T++      + +    ++SE P+++LY+Y+G    N  
Sbjct: 336  CYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNG- 394

Query: 498  EDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELN 557
                    P++ + +LLRG TLRNT W  G++ FTG +TK+M NA  TP K++ + + +N
Sbjct: 395  -----STFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVIN 449

Query: 558  LSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQ 617
            + +L  F +L VL  I+   N I   +   S                         IL+ 
Sbjct: 450  MQILALFGVLIVLALISSTGNVIMTKRD--SAHLGYLYIEGTNKAGLFFKDILTFWILFS 507

Query: 618  SLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTG 677
            +LVPISL+++VE+IK  QA  I  D+ +Y+E+ D P   ++ ++ ++LGQIEYIFSDKTG
Sbjct: 508  NLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTG 567

Query: 678  TLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKL 737
            TLT+NVMEFK  +I G    R Y E +   R+         + +E +GI           
Sbjct: 568  TLTRNVMEFKSVSIAG----RCYIETIPEDRR---------ATVE-DGI----------- 602

Query: 738  QNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPA 797
                        E+ F S E + D        +      F+  LA CH+V+  P  +   
Sbjct: 603  ------------EIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATCHTVI--PETQSDG 648

Query: 798  KLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEK-EFQILNILEFNSSRKRM 856
             ++ +A SPDE ALV  A D+GF F  +    + +     E+ E+Q+LNI EFNS+RKRM
Sbjct: 649  TIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRM 708

Query: 857  SCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRT 916
            S I ++P    +G  K  L CKGAD+VI  RLD         ++ T  HLE YA EGLRT
Sbjct: 709  SAIFRMP----DGSIK--LFCKGADTVILERLDS---EFNPYVQSTLRHLEDYAAEGLRT 759

Query: 917  LCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDG 976
            LC+A R +  +EYE W+K Y+ A+  + DR EEL++ ++ IE  L  LG TAIED+LQ+G
Sbjct: 760  LCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKLQEG 819

Query: 977  VPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPK 1036
            VP++I  L EAG+K+WVLTGD+ ETAINIG SC LL+ DM LL++            T +
Sbjct: 820  VPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNE---------ETKE 870

Query: 1037 DIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTEDMK 1093
            D    L S+                 A   H I + +    A++IDG++L YAL  ED++
Sbjct: 871  DTRTNLQSKL---------------NAIESHQISQQDMNSLALVIDGKSLGYALE-EDLE 914

Query: 1094 RKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGI 1153
             +FL + K CK+V+CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A++GVGI
Sbjct: 915  DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGI 974

Query: 1154 AGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGI 1213
            +G EG QA  S+D+AIGQFR+L +LL+VHG W Y+R++  I   FYKNM   +  FW+  
Sbjct: 975  SGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVF 1034

Query: 1214 YNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQ 1273
             N + G  + E   LTFYN+ FT +P  ++GIFDQ V+  +   +PQLY++G   + +S 
Sbjct: 1035 ANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSV 1094

Query: 1274 TKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYY-VGVPVTAIACISCNLY 1332
            T F  ++L+G Y S + F    L YR    +   G   DH  + VG+  T+I  +     
Sbjct: 1095 TIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAA 1154

Query: 1333 ILIQQKHWDVFCSFFVGVSIMI---FFT-WTGIWSSASRSNEFYHGAARVFGTPTFWAVL 1388
            ++  Q  W  F    +  S++I   FF  ++ ++   + S E+Y     V+G+ TFW + 
Sbjct: 1155 LITSQ--WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMC 1212

Query: 1389 FVGIMFCLLPRFTLDVFKRYFYPKDIDIIREM 1420
             V  +F LL  F    +KR + P+   +++EM
Sbjct: 1213 IVLPVFALLRDFVWKYYKRTYSPESYHVVQEM 1244

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 49/118 (41%), Gaps = 8/118 (6%)

Query: 168 KADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIY 227
           K+DE R I  N        D        Y  N I TTKY   TFLPK +  +F  +AN++
Sbjct: 182 KSDEPRTILLN--------DSSANSRFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLF 233

Query: 228 FLILIILGAFQIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
           FL   I+        TN   +   L             ED +R+  D E+N++   VL
Sbjct: 234 FLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRSNADKELNHSLCDVL 291

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1038 (38%), Positives = 585/1038 (56%), Gaps = 87/1038 (8%)

Query: 400  FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459
            F +  W +++VGDI+R+ + E IPAD I+LS+S+ +G CY+ET NLDGETNLK++QS   
Sbjct: 294  FVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVE 353

Query: 460  TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519
            T+       +      + SE P+++LY+Y+G     +L D Q+   P++ + ++LRG TL
Sbjct: 354  TAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTM---TLNDRQI---PLSPDQMILRGATL 407

Query: 520  RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579
            RNT W  G+V FTG +TK++ NA  TP K++ + K +N  ++  F +L VL  I+ + N 
Sbjct: 408  RNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNV 467

Query: 580  IYHNKHPRSRDXXXXXXXXXX-XXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIF 638
            I      +                       W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 468  IMSTADAKHLSYLYLEGTNKAGLFFKDFLTFW---ILFSNLVPISLFVTVELIKYYQAFM 524

Query: 639  IYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698
            I  D+ +Y EK D P   ++ ++ ++LGQIEYIFSDKTGTLT+N+MEFK C+I G  Y  
Sbjct: 525  IGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYID 584

Query: 699  AYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEF 758
               E      +  G++V +                  K  +L K      DE        
Sbjct: 585  KIPEDKTATVE-DGIEVGYR-----------------KFDDLKKKLNDPSDE----DSPI 622

Query: 759  VDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDM 818
            ++D               F+  LA CH+V+  P  +    ++ +A SPDE ALV    D+
Sbjct: 623  IND---------------FLTLLATCHTVI--PEFQSDGSIKYQAASPDEGALVQGGADL 665

Query: 819  GFSFL--KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLI 876
            G+ F+  K     ++LE  G EKE+Q+LNI EFNS+RKRMS I + P    +G  K  L 
Sbjct: 666  GYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFP----DGSIK--LF 719

Query: 877  CKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKY 936
            CKGAD+VI  RLD         +E T  HLE YA+EGLRTLCLA R++S  EYE WN  Y
Sbjct: 720  CKGADTVILERLDDEA---NQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIY 776

Query: 937  DIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTG 996
            + AA  + +R E+L++ ++ IE++LIL+G TAIED+LQDGVP++I  L EAGIK+WVLTG
Sbjct: 777  NEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTG 836

Query: 997  DKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGS 1056
            D+ ETAINIG SC LL+ DM LL+I     D      T +++++ +           A +
Sbjct: 837  DRQETAINIGMSCRLLSEDMNLLIINEETRD-----DTERNLLEKI----------NALN 881

Query: 1057 EEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQK 1116
            E +L    + HD+     A++IDG++L +AL  E ++   L + K CK+V+CCRVSP QK
Sbjct: 882  EHQL----STHDMK--SLALVIDGKSLGFALEPE-LEDYLLTVAKLCKAVICCRVSPLQK 934

Query: 1117 AAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLT 1176
            A VVK+VK     + LAI  G+NDV+MIQ+A++GVGI+G EG QA  S+D A+GQF++L 
Sbjct: 935  ALVVKMVKRKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLK 994

Query: 1177 RLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFT 1236
            +LLLVHG W Y+R++  I   FYKN    +  FW+   N + G  + E   ++FYNL FT
Sbjct: 995  KLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFT 1054

Query: 1237 SIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYL 1296
              P  ++G+FDQ VS  +   +PQLY++G   + +S   F  ++++G + S I F    L
Sbjct: 1055 VWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTIL 1114

Query: 1297 LYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI---M 1353
            +YR    +  +G   DH  + GV V   + I       +    W  F    +  S+   +
Sbjct: 1115 IYRYGFALNMHGELADHWSW-GVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWL 1173

Query: 1354 IFF-TWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPK 1412
            IFF  +  I+  A+ S E+Y      +G+  FW  L V  +F L+  F    +KR + P+
Sbjct: 1174 IFFPIYASIFPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPE 1233

Query: 1413 DIDIIREMWSRGDFDSFP 1430
               +I+EM      DS P
Sbjct: 1234 TYHVIQEMQKYNISDSRP 1251

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 43/101 (42%), Gaps = 4/101 (3%)

Query: 190 NKPLAN----YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNP 245
           N  LAN    Y  N I TTKY   TFLPK +  +F  +AN++FL    +        TN 
Sbjct: 188 NDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNR 247

Query: 246 GFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLT 286
             +   L             ED +R   D E+NN+   + +
Sbjct: 248 YTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFS 288

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1055 (36%), Positives = 587/1055 (55%), Gaps = 105/1055 (9%)

Query: 394  TDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKV 453
            +D   +F    W ++ VGDI+R+ + E IPAD+I+LS+S+ +G CY+ET NLDGETNLK+
Sbjct: 284  SDEMGQFISKKWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKI 343

Query: 454  RQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLL 513
            +Q+   TS I    +++  R  I SE P+ +LY+Y+G      L +N++   P++ + +L
Sbjct: 344  KQARPETSKILDVRELSAMRGKILSEQPNTSLYTYEGTM---ILHNNRI---PLSPDQIL 397

Query: 514  LRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFI 573
            LRG TLRNT W  G+V FTG +TK+  NA  TP K++ + + +NL ++  F +L  L  I
Sbjct: 398  LRGATLRNTVWIFGIVIFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLI 457

Query: 574  AGLYNGI-YHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIK 632
            +   N I  +N+                         W   IL+ +LVPISL+++VE+IK
Sbjct: 458  SSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNILTFW---ILFSNLVPISLFVTVEMIK 514

Query: 633  TAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTIN 692
              QA  I  D+ +++E+ + P   ++ ++ ++LGQIEYIFSDKTGTLTQNVMEFK C+I 
Sbjct: 515  YYQAYMIASDLDLFHEESNMPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIA 574

Query: 693  GVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVT 752
            G    R Y +++      +  D A +     EGI                       EV 
Sbjct: 575  G----RCYIQSIP-----EDKDAAFD-----EGI-----------------------EVG 597

Query: 753  FVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALV 812
            + + + + +L    GS        F+  L++CH+V+  P  ++   ++ +A SPDE ALV
Sbjct: 598  YRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVI--PEFQENGSIKYQAASPDEGALV 655

Query: 813  TTARDMGFSFLKKTKEGMVLEVQGIEKE--FQILNILEFNSSRKRMSCIVKIPGDDANGK 870
              A D+G+ F+ +    + +  + I +E  +++LNI EFNS+RKRMS I + P +     
Sbjct: 656  QGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR-- 713

Query: 871  PKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYE 930
                L+CKGAD+VI  RL  T       +  T  HLE YA EGLRTLC+A R +   EYE
Sbjct: 714  ----LLCKGADTVILERLAATS---NPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYE 766

Query: 931  RWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIK 990
             W+K YD AA  + +R EEL+KV++ IE+ L+LLG TAIED+LQDGVP++I  L +AGIK
Sbjct: 767  EWSKLYDAAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIK 826

Query: 991  LWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDK 1050
            +WVLTGD+ ETAINIG SC LL+ DM LL++     +     +T  +++D L        
Sbjct: 827  VWVLTGDRQETAINIGMSCKLLSEDMNLLIVNEDTKE-----STRNNLIDKL-------- 873

Query: 1051 FGMAGSEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVL 1107
                       +A  +H I + +    A++IDG++L +AL   D++   L + K C++V+
Sbjct: 874  -----------RAINDHQISQQDMNTLALVIDGKSLGFALEP-DLEEFLLAIGKMCRAVI 921

Query: 1108 CCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDY 1167
            CCRVSP QKA VVK+VK     + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D+
Sbjct: 922  CCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADF 981

Query: 1168 AIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTY 1227
            A+GQF+YL +LLLVHG W Y+R+++ I   FYKN+   +  FW+ +YN + G  + E   
Sbjct: 982  ALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVLYNAFSGQSIMESWT 1041

Query: 1228 LTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQS 1287
            LTFYN   T+ P       DQ     +     Q   VG   + W  T F    ++G Y +
Sbjct: 1042 LTFYNWGGTAAPPGPPKRRDQFERSGLLNRDAQSCTVGQKGQFWPATIFRGSAINGNYHN 1101

Query: 1288 VIAFFFPYLLYRRHMIVTSNGLGLDHRYY-VGVPVTAIACISCNLYILIQQKHWDVFCSF 1346
             I      + YR       +G   DH  + V +  T+I  +     ++  Q  W  F   
Sbjct: 1102 WITIDGWIMDYRYGAAGAMHGETADHWVWGVAIQPTSIIFVLGKAALITNQ--WTKFTVL 1159

Query: 1347 FVGVSIMIFFTWTGIWS----SASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTL 1402
             +  S++ +  +  I++      + S E+Y   + V+G+ TFWA+ +V  +  LL     
Sbjct: 1160 AIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVSHVYGSFTFWAMCYVLPVLALLRDLLW 1219

Query: 1403 DVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTD 1437
              +KR + P+   +++EM          +KYD +D
Sbjct: 1220 KYYKRTYTPESYHVVQEM----------QKYDISD 1244

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 54/128 (42%), Gaps = 12/128 (9%)

Query: 159 ATDETGMRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILL 218
           A  +TG    A E R IY N+      +         Y  N I TTKY   TFLPK +  
Sbjct: 169 AAADTG----AGEPRVIYINERRANGAM--------GYGDNHISTTKYNAATFLPKFLFQ 216

Query: 219 QFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVN 278
           +F  +AN++FL   I+        TN   +   L             ED +R+  D E+N
Sbjct: 217 EFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELN 276

Query: 279 NTKTHVLT 286
           +++  V +
Sbjct: 277 HSRADVYS 284

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  343 bits (879), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 279/1018 (27%), Positives = 490/1018 (48%), Gaps = 175/1018 (17%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGD++++H  + IPAD++LL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 268  KDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSE 327

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
            +  I   R  I +  P  +++ + G   +     N     P++++N L     L ++ + 
Sbjct: 328  NDLI--NRISITASAPEKSIHKFLGKVTYKDSTSN-----PLSVDNTLWANTVLASSGFC 380

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELN----LSVLFNFALLFVLCFIAGLYNGIY 581
            +  V +TG DT+  +N      K   +  E+N    +     FAL  +L   AG +N  +
Sbjct: 381  IACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDW 440

Query: 582  HNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 641
            +    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 441  YIDILR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 476

Query: 642  DVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA-- 699
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 477  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 530

Query: 700  -----YTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFV 754
                 Y ++L   +     D  + SK+    +   R++M  +++++              
Sbjct: 531  DIVSDYVQSLVSSKN----DSLNNSKV---ALSTTRKDMSFRVRDM-------------- 569

Query: 755  SKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTT 814
                                   +L LA+CH+V   P+ ED  +L  +A SPDE A+V  
Sbjct: 570  -----------------------ILTLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKF 603

Query: 815  ARDMGFSFLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPK 872
               +G S  K+ +  + L  E  G    ++IL +  FNS  KRM  IV+    D     +
Sbjct: 604  TESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLD-----E 658

Query: 873  ALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERW 932
               + KGAD+V    + K   + + L E+T       A EGLRTL + +++L+ + YE++
Sbjct: 659  YWFMQKGADTV----MSKIVESNDWLEEETG----NMAREGLRTLVIGRKKLNKKIYEQF 710

Query: 933  NKKYDIAAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKL 991
             K+Y+ A+ ++++R++++ +V +  +E  L LLG T +ED+LQ  V  SI LL  AGIK+
Sbjct: 711  QKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 770

Query: 992  WVLTGDKVETAINIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDK 1050
            W+LTGDKVETA  +  S  L++    +  I K T P+                       
Sbjct: 771  WMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPE----------------------- 807

Query: 1051 FGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCR 1110
                G+  +L+  K   +       ++IDGE+L   L  +  +++F  +  +  +V+ CR
Sbjct: 808  ----GAFNQLEYLKINRNA-----CLLIDGESLGMFL--KHYEQEFFDVVVHLPTVIACR 856

Query: 1111 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIG 1170
             +P QKA V  +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I 
Sbjct: 857  CTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT 916

Query: 1171 QFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTF 1230
            QF +LT LLL HG+  YKR A++     ++ +I  +    + I + ++   L++   +  
Sbjct: 917  QFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVG 976

Query: 1231 YNLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289
            Y   +T  PV  L + D D+ ++++ ++P+LY+     K  S +T F+W +L     SVI
Sbjct: 977  YATCYTMAPVFSLTL-DHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVI 1035

Query: 1290 AFF---FPYLL---YRRHMIVTSNGLGLDHRYYVGVP---------VTAIACISCNLYIL 1334
              F   F  LL   + R + ++   L ++    V +          VT IA +    YI+
Sbjct: 1036 QLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLL--FYIV 1093

Query: 1335 IQQKHWDVF-------CSFFVGVSIMIFFTWTGIWSSAS---RSNEFYHGAARVFGTP 1382
                  D F        +++ G+ +++  +   +W++ +   R +   +   + F TP
Sbjct: 1094 SVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIYRRLHPPSYAKVQEFATP 1151

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           Y  N++   KY  +TF+P  +  QF  F N+YFL++ +  A     +       VPL   
Sbjct: 170 YVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFV 229

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISL 300
                     +D +R   D E NN   HV+T   N ++ + D+ +
Sbjct: 230 LTVTMAKEAIDDIQRRRRDRESNNELYHVIT--RNRSIPSKDLKV 272

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  340 bits (872), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 262/893 (29%), Positives = 437/893 (48%), Gaps = 136/893 (15%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGD+++I     +PAD+ILL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 262  KDLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNE 321

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
              D    +  I +  P  +++S+ G   +     + L      I+N L     L ++ + 
Sbjct: 322  --DDLLEKITITASAPEKSIHSFLGRVTYKDTNTSGL-----TIDNTLWANTVLASSGFC 374

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELN----LSVLFNFALLFVLCFIAGLYNGIY 581
            +G V +TG DT+  +N      K   +  E+N    +     F L  +L   AGL+N  +
Sbjct: 375  IGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDW 434

Query: 582  HNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 641
            +    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 435  YVDIMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 470

Query: 642  DVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701
            D      K       ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 471  D------KTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSY----- 519

Query: 702  EALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDD 761
                             + I  + I+   E   + + NL   S   +D  T V    +D 
Sbjct: 520  -------------TTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHV----IDL 562

Query: 762  LTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFS 821
            +T                 LA+CH+V   P+ ED  +L  +A SPDE A+V     +G S
Sbjct: 563  IT----------------TLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKFTESVGLS 603

Query: 822  FLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKG 879
              K+ +  M L  E  G    + +L +  FNS  KRM  IV         K +   + KG
Sbjct: 604  LFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVY-----DKQKDQYWFLQKG 658

Query: 880  ADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIA 939
            AD+V    +++   N + L E+T       A EGLRTL + +++L+ + YE++ K+Y+  
Sbjct: 659  ADTV----MNRIVANNDWLEEETG----NMAREGLRTLVIGRKKLTKKIYEQFKKEYEEV 710

Query: 940  AAAVVDREEELEK-VSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDK 998
            +A++ +RE+E+   +S  +E  L LLG T +ED+LQ  V  SI LL  AGIK+W+LTGDK
Sbjct: 711  SASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDK 770

Query: 999  VETAINIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSE 1057
            VETA  +  S  L++    + V+ K + P+                           G+ 
Sbjct: 771  VETARCVSISAKLISRGQYVHVVTKLSKPE---------------------------GAF 803

Query: 1058 EELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKA 1117
             +L+  K   +       ++IDGE+L   L  +  +++F  +  +  +V+ CR +P QKA
Sbjct: 804  NQLEYLKVNKNA-----CLLIDGESLGMFL--KYYRQEFFDVVVHLPTVIACRCTPQQKA 856

Query: 1118 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1177
             V  +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I QF +LT 
Sbjct: 857  DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTE 916

Query: 1178 LLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTS 1237
            LLL HG+  YKR A++     ++ +I  +    F + + ++   L++   +  Y   +T 
Sbjct: 917  LLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTM 976

Query: 1238 IPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289
             PV  L + D D+ ++++ ++P+LY+     K  S +T F+W  L   YQ ++
Sbjct: 977  APVFSLTL-DHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVAL-SFYQGLV 1027

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPL 252
           +P N++   KY  +TFLP  +  QF  F N+YFL++ +  A     +       VPL
Sbjct: 164 FPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPL 220

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  340 bits (871), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 256/895 (28%), Positives = 446/895 (49%), Gaps = 149/895 (16%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGD+++IH    IPAD++LL +S+  G  +++T  LDGET+ K+R +   T ++  
Sbjct: 264  KDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNL-- 321

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
            S D    +  I +  P  +++ + G   +     N L     +++N +     L +    
Sbjct: 322  STDDLLNKISITASSPEKSIHRFLGKLTYKDSSSNAL-----SVDNTMWANTVLASVGSC 376

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585
            +G V +TG DT+  +N  ++  K   +  E+N       A +FVL  +   + G + NK 
Sbjct: 377  IGCVVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAG-FGNKD 435

Query: 586  PRSRDXXXXXXXXXXXXXXXXXXXWVA-----VILYQSLVPISLYISVEIIKTAQAIFIY 640
                                    W       +IL+ +++P+SL +++++ K+  A  I 
Sbjct: 436  ------------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIE 471

Query: 641  LDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 700
             D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 472  HDATIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDT 525

Query: 701  TEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVD 760
             + +    + + V  +  + + +   K+D   + N++++L                    
Sbjct: 526  MDIVTDYVQ-ELVSSSTTTPMPQSTAKKD---LPNRVRDL-------------------- 561

Query: 761  DLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGF 820
                             ++ LA+CH+V   P+ ED  +L  +A SPDE A+V     +G 
Sbjct: 562  -----------------VVTLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGL 601

Query: 821  SFLKKTKEGMVLEVQ--GIEKEFQILNILEFNSSRKRMSCIV--KIPGDDANGKPKALLI 876
            S  K+ +  + L  Q      E+ IL +  FNS  KRM  IV  K+ G+          +
Sbjct: 602  SLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKGEH-------WFM 654

Query: 877  CKGADSVIYSRLDKTG--LNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNK 934
             KGAD+V+ +R+ ++   L+EE         +   A EGLRTL + +++LS + YE++ K
Sbjct: 655  QKGADTVM-ARIVQSNDWLDEE---------VGNMAREGLRTLVIGRKKLSPKSYEQFRK 704

Query: 935  KYDIAAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWV 993
            +Y  A+ ++++R+E +  V    +E +L LLG T +ED+LQ+ V  SI LL  AG+K+W+
Sbjct: 705  EYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWM 764

Query: 994  LTGDKVETAINIGFSCNLLNNDMEL-LVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFG 1052
            LTGDKVETA  +  S  L++    +  V K + P+                        G
Sbjct: 765  LTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE------------------------G 800

Query: 1053 MAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVS 1112
               + E LK  K+          ++IDGE+L   L+    K++F  +  +  +V+ CR +
Sbjct: 801  ALNALEYLKINKSS--------CLLIDGESLGMFLTY--YKQEFFDIVVDLPAVIACRCT 850

Query: 1113 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQF 1172
            P QKA V  L++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D+++ QF
Sbjct: 851  PQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQF 910

Query: 1173 RYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYN 1232
             +LT+LLL HG+  YKR A++     ++ +I ++    + + + ++   L++   +  Y 
Sbjct: 911  CHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYA 970

Query: 1233 LAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQ 1286
              +T  PV  L + D D+ ++++ ++P+LY+        S +T F+W +L  L+Q
Sbjct: 971  TCYTMAPVFSLTL-DHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVIL-SLFQ 1023

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 189 DNKPLAN---YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNP 245
           D  P+ +   YP N I   KY P+TF+P  +  QF  F N+YFL++ +  A     +   
Sbjct: 156 DTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYL 215

Query: 246 GFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
               VPL             +D +R   D E NN    VL
Sbjct: 216 SSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVL 255

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  339 bits (870), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 255/898 (28%), Positives = 435/898 (48%), Gaps = 141/898 (15%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            KN++VGD+V++H +  IPAD+ILL +S+  G  +V+T  LDGET+ K+R +   T ++  
Sbjct: 286  KNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQ 345

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
              D   T+  I +  P  +++ + G   +         + P++++N L     L ++   
Sbjct: 346  --DEMLTKVHITASAPEKSIHMFTGKLTYKG------SSAPLSVDNTLWANTVLASSGTC 397

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELN----LSVLFNFALLFVLCFIAGLYNGIY 581
            +  V +TG DT+  +N   +  K   +  E+N    +  +  F L  +L  I GL +  +
Sbjct: 398  VACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKW 457

Query: 582  HNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 641
            +    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 458  YVDIMR------------------------YLILFSTIIPVSLRVNLDLGKSVYARQIES 493

Query: 642  DVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701
            D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ +K  +  VSY     
Sbjct: 494  DKSIPDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSY----- 542

Query: 702  EALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDD 761
                               +E   +  D  + +    N+                     
Sbjct: 543  ------------------TMETMDMVTDYIQTLTSPANMGAAGV---------------A 569

Query: 762  LTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFS 821
            +TG    V Q+  +  ++ LA CH+V   P+ ED  +L  +A SPDE A+V     +G S
Sbjct: 570  VTGSRKEVSQR-VRDLVVTLATCHNV--TPNFED-NELAYQAASPDEIAIVKFTERVGLS 625

Query: 822  FLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKG 879
              K+ +  + L  E  G+  ++ IL++  F S  KRM  IV+        K +   + KG
Sbjct: 626  LFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR-----DRTKNEIWFLQKG 680

Query: 880  ADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIA 939
            AD+V+   +      EE         +   A EGLRTL +A+++LS   YE+++K+Y  A
Sbjct: 681  ADTVMSKIVQSNDWLEE--------EVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDA 732

Query: 940  AAAVVDREEEL-EKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDK 998
            + ++++R+E + E V   +E +L LLG T +ED+LQ  V  SI LL  AG+K+W+LTGDK
Sbjct: 733  SLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDK 792

Query: 999  VETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA---G 1055
            VETA  +  S  L++                               QY+H    +    G
Sbjct: 793  VETARCVCVSAKLISR-----------------------------GQYVHTITKLTRRDG 823

Query: 1056 SEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQ 1115
            +   L+  KA  +       ++IDG++L  A+     + +F  +      V+ CR +P Q
Sbjct: 824  ALSRLEYLKANRN-----SCLLIDGDSL--AIYMSHYRAEFFEIVICLPVVIACRCTPQQ 876

Query: 1116 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYL 1175
            KA V  L++         IGDG NDV+MIQ A++GVGI G+EG+QA +++DY+I QF +L
Sbjct: 877  KADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHL 936

Query: 1176 TRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAF 1235
            T+LLL HG+  YKR A++     ++ ++ ++    + I ++     L++   +  Y   +
Sbjct: 937  TKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCY 996

Query: 1236 TSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVIAFF 1292
            T  PV  L + D D+ ++++  +P+LY+     +  S +T F+W +L     +VI  F
Sbjct: 997  TMAPVFSLTL-DHDIDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGF 1053

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 60/132 (45%), Gaps = 15/132 (11%)

Query: 100 QPGKNRESKSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEA 159
           QP  +++S    Q+KRLR G    + S++R    +S  L  AK         L+G     
Sbjct: 107 QPLISQDSWDYGQVKRLRSGWLGPQSSWQRL---KSWVLPGAKAG-----APLLG----- 153

Query: 160 TDETGMRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQ 219
              T     + EL + + ++ +  D     +K    YP N I   KY  +TFLP  +  Q
Sbjct: 154 VTATYSSTHSIELTDQHVDREIHLDTTPIYDK--RKYPTNAISNAKYNAITFLPIVLYEQ 211

Query: 220 FHNFANIYFLIL 231
           F  F N+YFL++
Sbjct: 212 FKFFFNLYFLLV 223

>Scas_704.38
          Length = 1161

 Score =  334 bits (857), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 261/896 (29%), Positives = 446/896 (49%), Gaps = 141/896 (15%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGD+++I   + +PAD++LL +S+  G  +++T  LDGET+ K+R +   T ++ +
Sbjct: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
              D+   +  I +  P   ++++ G   +     N     P++I+N L     L +T + 
Sbjct: 337  EPDLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390

Query: 526  MGVVAFTGDDTKIMLNA-------GVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYN 578
            +G V +TG DT+  +N        G+   + + ISK L  SV   FAL  +L   AG +N
Sbjct: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASV---FALSIILVVFAGFHN 447

Query: 579  GIYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIF 638
              ++    R                         +IL+ +++P+SL +++++ K+     
Sbjct: 448  SDWYLDVMR------------------------YLILFSTIIPVSLRVNLDLAKS----- 478

Query: 639  IYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698
            +Y   + +++ +       S  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY  
Sbjct: 479  VYAHQIEHDDTIPETIVRTS-TIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY-- 535

Query: 699  AYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEF 758
                        + +D+                + ++ L N + ++      V   S++ 
Sbjct: 536  ----------TSETLDIV--------------SDYVDALVNSSNSANPSGKSVPSTSRK- 570

Query: 759  VDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDM 818
              DL+           +  ++ LA+CH+V   P+ ED  +L  +A SPDE A+V     +
Sbjct: 571  --DLSA--------RVRDMVVTLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKFTESV 617

Query: 819  GFSFLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLI 876
            G S  K+ +  + L     G    ++IL +  FNS  KRM  IV         K +   +
Sbjct: 618  GLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIVH-----DEQKDEYWFM 672

Query: 877  CKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKY 936
             KGAD+V+   ++    N + L E+T       A EGLRTL + +++LS   Y+++ K Y
Sbjct: 673  QKGADTVMARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDY 724

Query: 937  DIAAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLT 995
            D A+ ++V+R++++  V +  +E  L LLG T +ED+LQ+ V  SI LL  AGIK+W+LT
Sbjct: 725  DDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLT 784

Query: 996  GDKVETAINIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA 1054
            GDKVETA  +  S  L++    + +I K T P+                        G  
Sbjct: 785  GDKVETARCVSISAKLISRGQYVHIITKLTKPE------------------------GAL 820

Query: 1055 GSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPA 1114
               E LK  K           ++IDGE+L   L     KR+F  +     +V+ CR +P 
Sbjct: 821  NQLEYLKVNKGA--------CLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCTPQ 870

Query: 1115 QKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRY 1174
            QKA V  +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I +F +
Sbjct: 871  QKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCH 930

Query: 1175 LTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLA 1234
            LT LLL HG+  YKR A++     ++ ++  +    + I + ++   L++   +  Y   
Sbjct: 931  LTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATC 990

Query: 1235 FTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289
            +T  PV  + + D D+ ++++ ++P+LY+     K  S +T F+W  L  L+Q  +
Sbjct: 991  YTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCAL-SLFQGCV 1044

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 39/90 (43%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           YP N+I   KY   TF+P  +  QF  F N+YFL++ +  A     +       VPL   
Sbjct: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
                     +D +R   D E N+   HVL
Sbjct: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269

>Kwal_23.5789
          Length = 1133

 Score =  325 bits (832), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 251/898 (27%), Positives = 424/898 (47%), Gaps = 150/898 (16%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R +   T  +  
Sbjct: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHL-- 311

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
            S D    R  I +  P  ++ ++ G   +      +++++P++++N +       +   A
Sbjct: 312  SQDDLLYRISITASVPEKSINNFLGKLTFG-----EIQSQPLSVDNTMWANTVFASAGTA 366

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585
            +  V +TG DT+  +N  ++  K   +  E+N       A +F+L      + G  +N  
Sbjct: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNND- 425

Query: 586  PRSRDXXXXXXXXXXXXXXXXXXXWVA-----VILYQSLVPISLYISVEIIKTAQAIFIY 640
                                    W       +IL+ +++P+SL +++++ K+  A  I 
Sbjct: 426  ------------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIE 461

Query: 641  LDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 700
             D  +    +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY    
Sbjct: 462  HDSTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDT 515

Query: 701  TEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVD 760
             + +    +                               A +       V   SK+   
Sbjct: 516  MDIVTDYVR-------------------------------AMSDNLNSSAVPSASKK--- 541

Query: 761  DLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGF 820
            DL G          +  +L LALCH V   P+ ED  +L  +A SPDE A+V     +G 
Sbjct: 542  DLPG--------RVRDLVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGL 590

Query: 821  SFLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICK 878
            +  ++ +  + L  +  G   E+ IL++  FNS  KRM  ++         K +   + K
Sbjct: 591  TLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIF-----DKQKDEYWFLQK 645

Query: 879  GADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDI 938
            GAD V+   + K    EE             A EGLRTL + ++ LS +  + + K Y+ 
Sbjct: 646  GADVVMSKIVQKNDWLEE--------ETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYED 697

Query: 939  AAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGD 997
            A+  +++RE  +  V S  +E  L +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGD
Sbjct: 698  ASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGD 757

Query: 998  KVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLH-----DKFG 1052
            KVETA  +  S  L++                               QY+H     +K  
Sbjct: 758  KVETARCVSISAKLVSR-----------------------------GQYVHTVTKVNKPE 788

Query: 1053 MAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVS 1112
             A +  EL K             ++IDGE+L   L  E  +++F  +  N  +V+ CR +
Sbjct: 789  GALTHLELLKINTNS-------CLLIDGESL--GLYLEYYRQQFFEIVVNLPAVIACRCT 839

Query: 1113 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQF 1172
            P QKA V   ++         IGDG NDV+MIQSA++GVGI G+EG+QA +++D++I QF
Sbjct: 840  PQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899

Query: 1173 RYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYN 1232
             +L++LLL HG+  YKR A++     ++ ++ ++    + I + ++   L++   +  Y 
Sbjct: 900  CHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYA 959

Query: 1233 LAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289
              +T  PV  L + D D+ ++++  +P+LY+     K  S +T F+W +L  L+Q  +
Sbjct: 960  TCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVL-SLFQGCV 1015

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPL 252
           Y  N I   KY P+TF+PK +  QF  F N+YFL++ +  A     +       VPL
Sbjct: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPL 212

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  318 bits (816), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 255/933 (27%), Positives = 445/933 (47%), Gaps = 150/933 (16%)

Query: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465
            K++KVGDI+++     +PAD+++L T++ +G  +++T  LDGET+ K+R +   T  +  
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTE 330

Query: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525
            + D+      I +  P  +++++ G   +   +D+   + P++++N +     L ++   
Sbjct: 331  N-DLLN-NITITASAPEHSIHNFLGKITY---KDS--TSSPLSVDNTMWENTVLASSAAC 383

Query: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585
            +  + +TG +T+  LN   +  K   +  E+N       A +F+L  +   + G  +N  
Sbjct: 384  ICCIVYTGRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNND- 442

Query: 586  PRSRDXXXXXXXXXXXXXXXXXXXWVA-----VILYQSLVPISLYISVEIIKTAQAIFIY 640
                                    W       +IL+ +++P+SL +++++ K+  A  I 
Sbjct: 443  ------------------------WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIE 478

Query: 641  LDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 700
             D  + +  +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 479  HDKQIEDTIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY---- 528

Query: 701  TEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVD 760
                      + +D+                + I  + +   NS         +S   +D
Sbjct: 529  --------TNETMDIV--------------TDFIQSMNSRTSNSTPTTTRKN-ISDRVID 565

Query: 761  DLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGF 820
             +T                 LA+CH+V   P+ ED  +L  +A SPDE A+V     +G 
Sbjct: 566  LVT----------------TLAICHNV--TPTFED-GELTYQAASPDEIAIVKFTESVGL 606

Query: 821  SFLKKTKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIV--KIPGDDANGKPKALLI 876
            S  ++ +  + L  +  G++ E+ I  +  FNS  KRM  I+  K+       K +   +
Sbjct: 607  SLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKL-------KQEYWFL 659

Query: 877  CKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKY 936
             KGAD+V+ S + +    EE             ATEGLRTL + +++LS   +E++ K+Y
Sbjct: 660  QKGADTVMSSIVVRNDWLEE--------ETSNMATEGLRTLVIGRKKLSTNLFEQFEKEY 711

Query: 937  DIAAAAVVDREEELEKVSDE-IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLT 995
              A+  ++DRE  ++ V  + +E  L LLG T +ED+LQ  V  SI LL  AGIK+W+LT
Sbjct: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771

Query: 996  GDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAG 1055
            GDKVETA  +  S  L++                               QY+H    +  
Sbjct: 772  GDKVETARCVSISAKLISR-----------------------------GQYVHTVTKVNK 802

Query: 1056 SEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQ 1115
             E  L     E+        ++IDGE+L   L  +    +F  +  N  +V+ CR +P Q
Sbjct: 803  PEGALHHL--EYLQVNQNSCLLIDGESL--GLYLQYFPDEFFDIVVNLPTVVACRCTPQQ 858

Query: 1116 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYL 1175
            KA V   ++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I QF +L
Sbjct: 859  KADVAVFIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL 918

Query: 1176 TRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAF 1235
            T+LLL HG+  YK  A++     ++ +I ++    + I + ++   L++   +  Y   +
Sbjct: 919  TKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCY 978

Query: 1236 TSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVIAF--- 1291
            T  PV  L + D D+ ++++ ++P+LY+   L K  S +T F+W  L      VI     
Sbjct: 979  TMAPVFSLTL-DHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQ 1037

Query: 1292 FFPYLL---YRRHMIVTSNGLGLDHRYYVGVPV 1321
            FF  L    + + + ++   L L+    VG+ +
Sbjct: 1038 FFTSLNDSDFTKMVAISFTALVLNELIMVGLEI 1070

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 35/84 (41%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           YP N I   KY P TF+P  +  QF  F N+YFLI+ +  A     +       VPL   
Sbjct: 173 YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNN 279
                     +D  R   D E NN
Sbjct: 233 LTVTMSKEAMDDINRRKRDREANN 256

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  318 bits (815), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 194/539 (35%), Positives = 298/539 (55%), Gaps = 39/539 (7%)

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            NEE +LEKT   +E ++TEGLRTL  A + +S E++E+W  +Y  A  ++ +R++++++V
Sbjct: 953  NEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV 1012

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
              +IE  L LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 1013 GAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH 1072

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
             D   +VI TT  +              +IS+       M    +E+      H +    
Sbjct: 1073 -DYSTVVILTTSDE-------------NIISK-------MNAISQEVDSGNVAHCV---- 1107

Query: 1074 FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT-LDVMTL 1132
              ++IDG  L        +   F  LC    SV+CCR SPAQKA +V  ++NT   ++TL
Sbjct: 1108 --IVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTL 1165

Query: 1133 AIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAE 1192
            AIGDG+ND+AMIQSA+IGVGIAG+EG QA  S+DY+IGQFR++ +LLLVHG++ Y R A+
Sbjct: 1166 AIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAK 1225

Query: 1193 MIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSD 1252
             I   FYK + F L    +  Y  + G+ L+E   L+ YN  FTS+PV+ +G+F++D+  
Sbjct: 1226 FILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKP 1285

Query: 1253 TISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLD 1312
               L  P+LY +G L K ++ + F  ++  G   ++I  F   + +    +  +    L 
Sbjct: 1286 VTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANALIITFLNIVAWGETSLSDNTLYPLG 1345

Query: 1313 HRYYVGVPVTAIACISCNL-YILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEF 1371
               +V    T +A I+    +I ++ ++W  F S  V +S   +  W       +RS+  
Sbjct: 1346 ---FVNFSAT-VALINVKAQFIEMRNRNWLAFTS--VILSCGGWLVWCCALPILNRSDGI 1399

Query: 1372 Y---HGAARVFGTP-TFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDF 1426
            Y   +G    FG   TFW    +  +  ++       FK    P D DI  E+  + + 
Sbjct: 1400 YDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQKSEI 1458

 Score =  234 bits (596), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 175/574 (30%), Positives = 291/574 (50%), Gaps = 72/574 (12%)

Query: 373 PSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTS 432
           P +  N Y  N D L  K        R  +  WK+++VGD V +  ++ +PADI++L++ 
Sbjct: 236 PESISNLYFNNFDLLAKK-----YNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSD 290

Query: 433 DSDGACYVETKNLDGETNLKVRQSMKCTSDI-RSSIDIARTRFWIESEGPHANLYSYQGN 491
             +   ++ET  LDGETNLK +      + + +S+  +A     +  E P+ +LY+++GN
Sbjct: 291 GDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGN 350

Query: 492 FRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTP-TKKS 550
              NS   ++ K  P+  +N++ RG  +RNT+  +G+V FTG+++KI +NA   P TK  
Sbjct: 351 LELNSGSSSK-KKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAP 409

Query: 551 RISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXXXXXXXXW 610
           ++ +++N+ V+F   ++  +   + L + I   ++  +                      
Sbjct: 410 KLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTAPTIMSF-- 467

Query: 611 VAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
             +I+Y +++P+SLY+++E+IK AQ+  +  D+ MY+ + D PC  ++  I ++LGQ+ Y
Sbjct: 468 --IIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSY 525

Query: 671 IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAL-----AGLRKRQGVDVAH---ESKIE 722
           IFSDKTGTLT N M F+K +  G S+    T+ +     A L  +  +DV     +S + 
Sbjct: 526 IFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQLSNKNDIDVISIDDQSFLS 585

Query: 723 KEGI------KR--------DREEMIN----------------------KLQNLAKNSQF 746
           K G       KR        DR   +                       K +  A NSQ 
Sbjct: 586 KLGYTSQSNPKRYMDINDFPDRRTSVEYKGNATVKYTGRPSMRSLYVPPKKETNASNSQD 645

Query: 747 YED--EVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVL---TEPSKEDPAKLEI 801
             D  E    + E +  +     S+  K  + F+L+LA+CH  L   TE   ++   +E 
Sbjct: 646 ASDIPEDIKSTFELIYYIQSNPKSLFAKKAKMFILSLAICHICLPKRTEEGNDEDDIIEY 705

Query: 802 KAQSPDEAALVTTARDMGFSFLKKTKEGMVLEV--QGIE-----KEFQILNILEFNSSRK 854
           ++ SPDE ALVT ARDMG+    +    + L+    G +     + F+IL +++FNS RK
Sbjct: 706 QSSSPDELALVTAARDMGYIVYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRK 765

Query: 855 RMSCIVKIPGDDANGKPKALLICKGADSVIYSRL 888
           RMS IV++P +    K + LL CKGAD+VI  RL
Sbjct: 766 RMSVIVRVPEE----KDRVLLFCKGADNVILERL 795

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 43/90 (47%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           Y  N I +++YT ++F P+ +  QF   AN+YF I+ IL     +  T    + VPL   
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
                     +D RR  LD E NN  T VL
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVL 212

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  317 bits (813), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 193/541 (35%), Positives = 293/541 (54%), Gaps = 43/541 (7%)

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            NEE +LEKT   +++++TEGLRTL  + + +  EEY+ W  KY  A  ++ +R  ++ +V
Sbjct: 932  NEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQIAEV 991

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
               IE  L LLG TAIED+LQ+GVP++I  +  AGIK+W+LTGDK ETAINIG++C L+ 
Sbjct: 992  GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYACKLIY 1051

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
            +   ++++K                 D LIS+       M    EEL   K  H +    
Sbjct: 1052 DYSTVVILKKND--------------DNLISK-------MTALGEELDTGKIAHCV---- 1086

Query: 1074 FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVK-NTLDVMTL 1132
              ++IDG +L    +   M   F+ LC    SV+CCR SP+QKA +V  ++    D++TL
Sbjct: 1087 --LVIDGASLAVFENNPTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTL 1144

Query: 1133 AIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAE 1192
            AIGDG+ND+AMIQSA+IGVGI G+EG QA  SSDY+I QFRYL +LL VHG++ Y R ++
Sbjct: 1145 AIGDGANDIAMIQSADIGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSK 1204

Query: 1193 MIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSD 1252
             +   FYK ++F L    +     + G+ L+E   L+ +N  FTS+PVI +G+F++D+  
Sbjct: 1205 FVLCTFYKEVLFYLTQMIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKP 1264

Query: 1253 TISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLD 1312
               L  P+LY +G   + ++   FL +ML     SV+  F  + ++      + N +   
Sbjct: 1265 MTLLAVPELYTMGQKCQAFNLKIFLVWMLTAAGISVLITFLNFEIW-GFTAQSDNSI--- 1320

Query: 1313 HRYYVGVPVTAIACISCNL---YILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSN 1369
              Y +GV      C   N+   +I  + ++W  F S    +S + +  W  +       N
Sbjct: 1321 --YPIGVINFTSICFLINVKCQFIETRNRNWLAFASLL--ISCIGWILWCCLLPGIYGEN 1376

Query: 1370 EFYH---GAARVFGTP-TFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGD 1425
              Y    G    FG   T+WA   + IMF ++       F+   +P D DI  E+  + D
Sbjct: 1377 AIYDVLIGLYHQFGRDITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKDD 1436

Query: 1426 F 1426
             
Sbjct: 1437 I 1437

 Score =  266 bits (680), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 231/784 (29%), Positives = 358/784 (45%), Gaps = 136/784 (17%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           Y  N I +++YT  +FLP+ +  QF   AN YFL++ IL     +  T    + VPL   
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVLT-GIENYNVSADDI-SLWRRFKKANSRIIA 313
                     +D +R  LD E NN  T VLT G ++  + +D I SL     ++   I++
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAILS 235

Query: 314 SFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNRMSRDVRPSMDFRP 373
            F                        N   NLN     S   + +N              
Sbjct: 236 DF------------------------NSMHNLNDVTEPSYTDHFTNL------------- 258

Query: 374 STDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSD 433
                             L +  +    K  WK++KVG+ V +++++ +PADI+LLST  
Sbjct: 259 ----------------NLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPADILLLSTDG 302

Query: 434 SDGACYVETKNLDGETNLKVRQSM-----KCTSDIRSSIDIARTRFWIESEGPHANLYSY 488
            +   +VET  LDGETNLK +  +     + TS    S+  A T      E P+ +LY++
Sbjct: 303 ENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTL----EDPNNDLYNF 358

Query: 489 QGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTP-T 547
           +G        D +L   P+  +N++ RG  LRNT+  +G+V FTG++TKI +NA   P T
Sbjct: 359 EGTVEI----DGELY--PLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRT 412

Query: 548 KKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXXXXXX 607
           K  ++  ++NL VLF   ++FV+  +A      Y  +H   ++                 
Sbjct: 413 KAPKLQGKINLIVLF---MVFVVAAMAMFS---YLGQHILKKNYVDNNRAWYLFQEDAGT 466

Query: 608 XXWVA--VILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDL 665
              +   +I+Y +L+P+SLY++ EIIK  Q+  +  D+ MY+ + D PC  ++  I ++L
Sbjct: 467 APTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEEL 526

Query: 666 GQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEA-------------------LAG 706
           GQ+ YIFSDKTGTLT N M F+K +I G S+     E                    L  
Sbjct: 527 GQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHEIDEDLIDPIDDDIDVISIEDRSFLNE 586

Query: 707 LRKRQGVDVAHESKIEKEG-------------IKRDREEMINKLQNLAKNSQFYEDEVTF 753
              R        + IE +G             ++  R+E+   L     NS    +E   
Sbjct: 587 FDLRSTHSKNPRTSIEYKGNSGAVYSGRPSMALQIQRQELAEDLNTTRTNSSRSSEEKNG 646

Query: 754 VSKEFVDDLTGGSGSVQQKSCQHF-------MLALALCHSVLTEPSKEDPAKLEIKAQSP 806
           + K  VD L      +Q+     F       +L+LALCH+ L + + +    +  ++ SP
Sbjct: 647 L-KTTVDLLL----YIQKHPNTEFSIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSP 701

Query: 807 DEAALVTTARDMGFSFLKKTKEGMVLEV-------QGIEKEFQILNILEFNSSRKRMSCI 859
           DE ALVT ARDMGF    +    + +         Q I +++++L  + F+S RKRMS  
Sbjct: 702 DELALVTAARDMGFVVTNRNSSTLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVA 761

Query: 860 VKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCL 919
           VK+P DD     + LLICKGAD+VI  RL  + L +  +LE+  L +EQ   E    + L
Sbjct: 762 VKMPNDD----DRVLLICKGADNVILERLRNSELAQNKVLEQQNL-IEQRKLEEAE-MIL 815

Query: 920 AQRE 923
            QR+
Sbjct: 816 HQRK 819

>Kwal_23.3556
          Length = 1597

 Score =  315 bits (807), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 192/538 (35%), Positives = 293/538 (54%), Gaps = 49/538 (9%)

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            NEE +LE+T   +E ++T GLRTL  + + +  E+YE+W+KKY  A  ++ +R+E++  V
Sbjct: 952  NEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKMHSV 1011

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
             + +E  L LLG TAIED+LQ+GV D+I  +  AGIK+W+LTGDK ETAINIG+SCNL++
Sbjct: 1012 GELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSCNLIH 1071

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
             D   +VI         L A  ++I   L +                       +I RG 
Sbjct: 1072 -DYSTVVI---------LSAKDENISSKLTA--------------------VSQEIERGN 1101

Query: 1074 FA---VIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT-LDV 1129
             A   V+IDG  L    S   +   F+ LC    SV+CCR SP+QKA +V  ++NT   +
Sbjct: 1102 IAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKL 1161

Query: 1130 MTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKR 1189
            +TLAIGDG+ND+AMIQSA+IGVGIAG+EG QA  SSDY+I QFR+L +LLLVHG++ Y R
Sbjct: 1162 VTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVR 1221

Query: 1190 LAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQD 1249
              + +   FYK ++F L    +  +  + G+ L+E   L+ +N  FTS+PV+ +G+F++D
Sbjct: 1222 TTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKD 1281

Query: 1250 VSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGL 1309
            +     L  P+LY +G L + ++   FL++M      S+I  F  + ++        + L
Sbjct: 1282 LKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIW------AVSSL 1335

Query: 1310 GLDHRYYVGV----PVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFT--WTGIWS 1363
              +  Y +GV     +  +  + C L +    ++    CS  + V   + +     GI+S
Sbjct: 1336 SDNTVYPIGVINFTAIITLVNVKCQL-LETHNRNVLAICSLVISVGGWLLWCCLLPGIYS 1394

Query: 1364 SASRSNEFYHGAARVFGTP-TFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREM 1420
                  +   G    FG   TFW    V ++  L+        K   +P D +I  E+
Sbjct: 1395 EDGMY-DVLTGLYFQFGNDITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMEL 1451

 Score =  258 bits (660), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 177/564 (31%), Positives = 293/564 (51%), Gaps = 60/564 (10%)

Query: 405 WKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDI- 463
           WK++KVGD V +  +E +PAD+++L+ SD    C+VET  LDGETNLK +Q +   S++ 
Sbjct: 267 WKDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVM 326

Query: 464 RSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTK 523
           +++  +   +  +  E P+ +L++++GN      E+ +L   P   ++++ RG  +RNT 
Sbjct: 327 KTAAGLTEFKAKVTVEDPNIDLHNFEGNLELLG-ENRKLTIGP---DHIIYRGSIIRNTS 382

Query: 524 WAMGVVAFTGDDTKIMLNAGVTP-TKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYH 582
            A+G+V FTG++TKI +NA   P  K  ++ + +NL VLF   ++  +   + L   I  
Sbjct: 383 NAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIK 442

Query: 583 NKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLD 642
            K+  +                        +I+Y +L+P+SLY+++EIIK  Q+  +  D
Sbjct: 443 KKYVDNNRAWYLFNSDAGLAPTVMSF----IIMYNTLIPLSLYVTMEIIKAMQSKLMEWD 498

Query: 643 VMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTE 702
           + MY+ + + PC  ++  I ++LGQ+ YIFSDKTGTLT N M F+  ++ G S+   +  
Sbjct: 499 IDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFDP 558

Query: 703 ALAGLRKRQGVDVA--------------------------HESKIEKEG----IKRDREE 732
           A   L K +  D                            H++ I+ +G    I   R  
Sbjct: 559 AAEKLTKSESSDSNTVEVVSVDDRSFLQNFGAADRKVPSNHKTSIDYKGNSSAIYTGRPS 618

Query: 733 MINKLQNLAKNSQFYEDEVTF-----VSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSV 787
           M +++    KN +  E E +       S E +  +     +   K    F+L+LALCH+ 
Sbjct: 619 MASRICEEDKNPKKIEPEKSSKTGLRSSTELIRYIQQNPNTHFAKKVSFFILSLALCHAC 678

Query: 788 LTEPSK--EDPAKLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEV--QGIEKE--- 840
           L + S   E    +E +A SPDE ALVT ARDMG++ + +  + + ++    G + E   
Sbjct: 679 LPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVLTIKTYPNGFDAEPHL 738

Query: 841 --FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESL 898
             ++ILN +EF+S RKRMS +V++P ++     + LLICKGAD+VI  RL  + L  + +
Sbjct: 739 DKYEILNNIEFSSHRKRMSVLVRLPHEEN----RILLICKGADNVILERLHNSDLANQKI 794

Query: 899 LEKTALHLEQYATEGLRTLCLAQR 922
           +E      E+ A E    L L QR
Sbjct: 795 VELQETTSERKAAEA--DLVLKQR 816

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 41/90 (45%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           Y  N I +++YT  TFLP+ +  QF   AN YF ++ +L     +  T    + VPL   
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
                     +D RR  LD E N+    VL
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVL 197

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  311 bits (796), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 195/550 (35%), Positives = 297/550 (54%), Gaps = 48/550 (8%)

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            NEE ++E+T   ++ + TEGLRTL  + + +  +EYE WN +Y  A AA+V+R E+++ V
Sbjct: 933  NEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV 992

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
             + IER L LLG   IED+LQ+GVPD+I  L  AGIK+W+LTGDK ETAINIG+SC L++
Sbjct: 993  GEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH 1052

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
            +   ++++    P+ E++ +    I                   +E++     H +    
Sbjct: 1053 DYSTVIIL---APNDENMASKITTIT------------------QEIEAGNVAHCV---- 1087

Query: 1074 FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVV-KLVKNTLDVMTL 1132
              V+IDG  L        +   F+ LC    SV+CCR SP+QKA +V K+ K    ++TL
Sbjct: 1088 --VVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTL 1145

Query: 1133 AIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAE 1192
            AIGDG+ND+AMIQSA+IGV I G+EG QA  SSDY+I QFRYL +LLLVHG++ Y R ++
Sbjct: 1146 AIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSK 1205

Query: 1193 MIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSD 1252
             +   FYK  +F L    F I   + G+  +E   LT +N  FTS+PV+ +G+F++D+  
Sbjct: 1206 FVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKS 1265

Query: 1253 TISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLD 1312
               L  P+LY  G   + ++   FL +M      SVI  F  +  +   +   S+    +
Sbjct: 1266 VTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCW--SLTAQSD----N 1319

Query: 1313 HRYYVGV----PVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRS 1368
              Y +G+     V  +  + C L + +  ++W  F SFF  +S+  +  W  +  +  + 
Sbjct: 1320 TLYPIGLINYTAVVVLVNVKCQL-LEMANRNWLAFASFF--ISVCGWLCWCLLLPAIYKE 1376

Query: 1369 NEFY---HGAARVFGTP-TFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRG 1424
               Y    G    FG   TFWA   V ++  ++        K   YP D +I  E+  R 
Sbjct: 1377 TLVYDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQR- 1435

Query: 1425 DFDSFPKKYD 1434
              D+  KK +
Sbjct: 1436 --DAVRKKLE 1443

 Score =  244 bits (624), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 176/611 (28%), Positives = 307/611 (50%), Gaps = 71/611 (11%)

Query: 350 RNSLNSYRSNRMSRDVRPSMD--FRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKN 407
           R+ L+   +N++ + +  + D  F  + DI+   +       +TL  +      +  WK+
Sbjct: 184 RHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQANHGVAVVEKQWKD 243

Query: 408 VKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSM-KCTSDIRSS 466
           V+VG+ V ++ ++ +PAD+ LL+T   +  CYVET  LDGETNLK +  + K  S  R++
Sbjct: 244 VEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHVLPKIASQTRTA 303

Query: 467 IDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAM 526
             +A  R     E P+ +LY+++G     + +  + +   + ++N+L RG  +RNT+  +
Sbjct: 304 SGLATFRGMTTVEDPNIDLYNFEGKIEVET-DSGEQQAYSIGLDNVLFRGSIIRNTQTVV 362

Query: 527 GVVAFTGDDTKIMLNAGVTPTKKS-RISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585
           G+V FTG++TKI +NA   P  KS ++  ++NL VLF   ++ +  F++      + N+ 
Sbjct: 363 GMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSFGLQRFFKNRE 422

Query: 586 PRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645
             S                        +I+Y +L+P+SLY+++EIIK  Q+  +  D+ M
Sbjct: 423 VDSDRAWYLMKVDAGLAPTIMSF----IIMYNTLIPLSLYVTMEIIKDMQSRLMEWDIDM 478

Query: 646 YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY----GRAYT 701
           Y+ + +  CT ++  I ++LGQ+ YIFSDKTGTLT N M F+K +  G ++     R   
Sbjct: 479 YHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAWEHDVARKDQ 538

Query: 702 EALAGLRKRQGVDVAHES----------------KIEKEGIKR----------DREEMIN 735
           E      K+    ++ ES                 +E +G+             + E++ 
Sbjct: 539 ETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEYKGLASATYTGRPSIASQIELMK 598

Query: 736 KLQNLAKNSQFYEDEVTFV-------------SKEFVDDLTGGSGSVQQKSCQHFMLALA 782
             QN A  ++    +++ +             S + +  +     +V  +  + F+LALA
Sbjct: 599 LQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLIMHIQLNPNTVFSQRAKFFILALA 658

Query: 783 LCHSVLTEPSKEDPA------KLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVL---- 832
           LCH+ L  P K   A       +E ++ SPDE ALVT ARDMG+  L +  + + +    
Sbjct: 659 LCHTCL--PKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTIKTYP 716

Query: 833 ---EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD 889
              E   + +++++LN ++F+S RKRMS +V++         K LLICKGAD+VI  RL 
Sbjct: 717 DGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRM----HQHPEKVLLICKGADNVILERLH 772

Query: 890 KTGLNEESLLE 900
            + L ++ L E
Sbjct: 773 NSDLAQQKLNE 783

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 39/90 (43%)

Query: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXXX 255
           Y  N I +++Y+  +FLP+ +  QF    N YF  + IL     +  T    + VPL   
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 256 XXXXXXXXXXEDSRRTVLDLEVNNTKTHVL 285
                     ED RR  LD E NN    VL
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVL 199

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  310 bits (793), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 193/550 (35%), Positives = 304/550 (55%), Gaps = 51/550 (9%)

Query: 889  DKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREE 948
            D+  LNEE ++E+T   +++++TEGLRTL  A + +   +YE WNK+Y  A  ++ DR+ 
Sbjct: 1008 DELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKI 1067

Query: 949  ELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFS 1008
            ++++   EIE  L LLG TAIED+LQDGV ++I  +  AGIK+W+LTGDK ETAINIG+S
Sbjct: 1068 KVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYS 1127

Query: 1009 CNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHD 1068
            C L+ +   ++++ TT  ++              IS+       M    +E+      H 
Sbjct: 1128 CMLIKDYSTVVILTTTDENI--------------ISK-------MNAVSQEVDSGNIAHC 1166

Query: 1069 IPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT-L 1127
            +      V+IDG  +            F+ LC    SV+CCR SP+QKA +V  ++NT  
Sbjct: 1167 V------VVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDP 1220

Query: 1128 DVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCY 1187
            +++TLAIGDG+ND+AMIQSA+IGVGIAG+EG QA   SDY+IGQFR+L +LL VHG++ Y
Sbjct: 1221 NLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNY 1280

Query: 1188 KRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFD 1247
             R ++ +   FYK + F      +  Y  + GS L+E   L+ +N  FTS+PV+ +G+F+
Sbjct: 1281 IRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFE 1340

Query: 1248 QDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSN 1307
            +D+     L  P+LY  G L + ++   F+ +++     S+I  F   +++        +
Sbjct: 1341 KDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMW------GMS 1394

Query: 1308 GLGLDHRYYVG-VPVTAIACI--SCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSS 1364
             L  +  Y +G +  TAI  +    + ++ +  ++W  F S  V +S   +  W      
Sbjct: 1395 SLSDNTMYPLGLINFTAIVALINVKSQFVEMHNRNWLAFTS--VVLSCGGWLVWCCALPI 1452

Query: 1365 ASRSNEFY---HGAARVFGTP-TFWAVLFVGIMFCLLPRFTLDV----FKRYFYPKDIDI 1416
             + +++ Y   +G    FG   TFW      ++  LLP  TLD+    FK   +P D DI
Sbjct: 1453 LNNTDQIYDVAYGFYNHFGKDITFWC---TSLVLALLP-ITLDIVYKTFKVMIWPSDSDI 1508

Query: 1417 IREMWSRGDF 1426
              E+  + D 
Sbjct: 1509 FAELEQKSDI 1518

 Score =  218 bits (554), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 210/847 (24%), Positives = 370/847 (43%), Gaps = 161/847 (19%)

Query: 185 MLDED-NKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVT 243
           ++DE  NKP   Y  N+I +++YT  +FLP+ +  QF   AN YF I+ +L         
Sbjct: 129 LIDERFNKP---YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMI------ 179

Query: 244 NPGFSAVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWRR 303
            PG+S                   +  T++ L        V  GI     + DD    R 
Sbjct: 180 -PGWSTT----------------GTYTTIIPL-------CVFMGISMTREAWDDFRRHRL 215

Query: 304 FKKANSRIIASFVQVCRETLTKKGRLEKAQRKRQMANHKKNLNRKFRNSLNSYRSNRMSR 363
            K+ N++ +          L K G    AQ    + +   +       S  +  +  ++ 
Sbjct: 216 DKEENNKPVG--------VLVKDGN-NDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLND 266

Query: 364 DVRPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIP 423
           D   S      T  N ++          L         +  W+ ++VGD V +  ++ +P
Sbjct: 267 DRNSSQGHFLDTHFNNFE---------LLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVP 317

Query: 424 ADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDI-RSSIDIARTRFWIESEGPH 482
           AD++LL+    +  C+VET  LDGETNLK +Q     + + +++  +A     +  E P+
Sbjct: 318 ADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPN 377

Query: 483 ANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNA 542
            +LY+++GN    +  ++ +   P+  +N++ RG  LRNT+  +G+V F+G++TKI +NA
Sbjct: 378 IDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNA 437

Query: 543 GVTP-TKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXX 601
              P TK  ++ +++N+ ++F   ++FV+  I+ L++ + H  H +              
Sbjct: 438 LKNPRTKAPKLQRKINMIIVF---MVFVVATIS-LFSYLGHVLHKKKYIDQNKAWYLFQA 493

Query: 602 XXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPK---- 657
                      +I+Y +++P+SLY+++EIIK  Q+  +  D+ MY+ + + PC  +    
Sbjct: 494 DAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATI 553

Query: 658 ---------------------------------SWNISDDLGQIEYIFSDK---TGTLTQ 681
                                            SW  + DLG  E  F D    T +L  
Sbjct: 554 LEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSWLHNVDLGNSEDNFEDNRDNTNSLRL 613

Query: 682 NVMEFKKCTINGVSYGR-------AYTEALAGLRKRQGVDVAHESK--IEKEG----IKR 728
                   +I+ VS G         +++A      R  +D   +S+  IE +G    I  
Sbjct: 614 PPKAHNGSSIDVVSIGDQNVLDRLGFSDAPIEKGHRPSLDNFPKSRNSIEYKGNSSAIYT 673

Query: 729 DREEMINKL----QNLAKNSQFYEDEVTFV-----SKEFVDDLTGGSGSVQQKSCQHFML 779
            R  M +       +L+K +       TF      S + +  +     ++  +  + F L
Sbjct: 674 GRPSMRSLFGKDNSHLSKQASVISPSETFSENIKSSFDLIQFIQRYPTALFSQKAKFFFL 733

Query: 780 ALALCHSVLTEPSKEDPA---KLEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEV-- 834
           +LALCHS L + +  +      +E ++ SPDE ALVT ARD+G+  L +  + + ++   
Sbjct: 734 SLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFP 793

Query: 835 QGIEKE-----FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLD 889
            G + E     ++ILN ++FNS RKRMS +V++P    N   + LLICKGAD+VI  R  
Sbjct: 794 DGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMP----NQPNQVLLICKGADNVIMER-- 847

Query: 890 KTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEE 949
                         LH  + A + +  +C + +E           + D  A  V+ + + 
Sbjct: 848 --------------LHDRELAAKKMADICTSTKE-----------RKDAEAELVLQQRKS 882

Query: 950 LEKVSDE 956
           LE++ DE
Sbjct: 883 LERMVDE 889

>Scas_669.3
          Length = 1638

 Score =  290 bits (742), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 187/535 (34%), Positives = 294/535 (54%), Gaps = 49/535 (9%)

Query: 893  LNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEK 952
            LN+  ++EKT   +++++TEGLRTL  + + +  +EY++W  +Y  A  ++ +R+ ++ +
Sbjct: 986  LNDGYVIEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAE 1045

Query: 953  VSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLL 1012
            V +EIE+ L LLG TAIED+LQ+GV ++I  +  AGIK+W+LTGDK ETAINIG+SC L+
Sbjct: 1046 VGEEIEQDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLI 1105

Query: 1013 NNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRG 1072
              D   +VI   G +              +IS+       M    +E+      H +   
Sbjct: 1106 Y-DYSTVVILAKGDE-------------NIISK-------MNAISQEVDSGNVAHCV--- 1141

Query: 1073 EFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT-LDVMT 1131
               +IIDG  L        +   F+ LC    SV+CCR SP+QK+ +V  ++N+  +++T
Sbjct: 1142 ---IIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQKSLMVTNIRNSNKNLVT 1198

Query: 1132 LAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLA 1191
            LAIGDG+ND+AMIQSA+IG+GI G+EG QA  ++DY+I QFR++ +LLLVHG++ Y R A
Sbjct: 1199 LAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFILKLLLVHGRYNYIRTA 1258

Query: 1192 EMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVS 1251
            + I   F+K + F L    F  Y  + GS L+E   L+ +N  FTS+PV+ +G+F++D+ 
Sbjct: 1259 KFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLK 1318

Query: 1252 DTISLVFPQLYRVGILRKEWSQTKF-LWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLG 1310
                L  P+LY +G L + ++   F  W +    Y  +I F         ++I+      
Sbjct: 1319 PMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFL--------NIIIWGETAL 1370

Query: 1311 LDHRYY-VGV----PVTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSA 1365
             DH  Y +GV     + A+  + C  +I +  ++W VF S  V +S   +  W       
Sbjct: 1371 SDHTMYPLGVINFTAIVALVNVKCQ-FIEMNNRNWVVFTS--VILSCGGWLVWCCALPIL 1427

Query: 1366 SRSNEFY---HGAARVFGTP-TFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDI 1416
            +RS+  Y   +G    FG   T+W   FV  +  +        FK   +P D DI
Sbjct: 1428 NRSDVIYDVPYGFFYHFGKDITWWCSCFVLAVLPITIDIVYQTFKTMIWPSDADI 1482

 Score =  191 bits (486), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 143/513 (27%), Positives = 240/513 (46%), Gaps = 76/513 (14%)

Query: 189 DNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFS 248
           D +  + Y  N I +++YT  +F PK +  QF   AN+YF    ++   Q+     PG+S
Sbjct: 133 DERTSSVYCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFF---VVAILQMI----PGWS 185

Query: 249 AVPLXXXXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLTGIENYNVSADDISLWRRFKKAN 308
                              +  T++ L        +  GI     + DD    R  K+ N
Sbjct: 186 TT----------------GTYTTIVPL-------CIFMGISMAREAWDDFRRHRLDKEEN 222

Query: 309 SRIIASFV-QVCRETLTKKGRLEKAQRKRQMANHKKN--LNRKFRNSLNSYRSNRMSRDV 365
           ++  +    +   + +    +L   Q    ++N      LN KF N              
Sbjct: 223 NKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNTDYLNTKFNNF------------- 269

Query: 366 RPSMDFRPSTDINGYQQNEDTLINKTLPTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPAD 425
            P ++ R     +G +  E T                  W N+ VGD V +  +  +PAD
Sbjct: 270 -PFLEER-----HGVRIQETT------------------WSNLHVGDFVLLKQDNWVPAD 305

Query: 426 IILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSSID-IARTRFWIESEGPHAN 484
           I++L++   +  C+VET  LDGETNLKV+Q     + +  S   +A     I  E P+++
Sbjct: 306 ILVLTSDGDNNECFVETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSD 365

Query: 485 LYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGV 544
           LY+++GN       +N LK  PV  +N+  RG  +RNT   +G+V +TG +TKI +NA  
Sbjct: 366 LYNFEGNLELTDNNNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALN 425

Query: 545 TP-TKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKHPRSRDXXXXXXXXXXXXX 603
            P TK  ++ K +N+ + F   ++FV+  I+ L++ + H    +                
Sbjct: 426 NPRTKAPKLQKNINIIITF---MVFVVAVIS-LFSYLGHVLQNKKAIDENQAWYLLTKDA 481

Query: 604 XXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISD 663
                    +I+Y +++P+SLY+++EIIK  Q+  +  D+ MY+ + + PC  ++  I +
Sbjct: 482 GAAPTIMSFIIMYNTIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILE 541

Query: 664 DLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSY 696
           +LGQ+ Y+FSDKTGTLT N M F+K +I G S+
Sbjct: 542 ELGQVSYMFSDKTGTLTDNKMIFRKFSICGSSW 574

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 80/129 (62%), Gaps = 18/129 (13%)

Query: 772 KSCQHFMLALALCHSVLTEPSK-----EDPAKLEIKAQSPDEAALVTTARDMGFSFLKKT 826
           K  + F+L+LALCH+ L + S      ED   +E ++ SPDE ALVT ARD+G+  L K 
Sbjct: 697 KKAKFFILSLALCHTCLPKKSNFPEGGED--VIEYQSSSPDELALVTAARDLGYVVLNKN 754

Query: 827 KEGMVLEV--QGIEKE-----FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKG 879
            + + ++    G E E     +QILN ++FNS RKRMS +VK P D+ N   K LLICKG
Sbjct: 755 ADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTP-DEPN---KVLLICKG 810

Query: 880 ADSVIYSRL 888
           AD++I  RL
Sbjct: 811 ADNMILERL 819

>Kwal_56.23467
          Length = 280

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 126/288 (43%), Positives = 178/288 (61%), Gaps = 31/288 (10%)

Query: 1267 LRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIAC 1326
            +R EW+ TKF  YM+DGLYQSVI+FFFP+L Y +  +V+ NGLGLDHRY+VG+ V +IA 
Sbjct: 1    MRSEWNLTKFWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYWVGILVGSIAS 60

Query: 1327 ISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARVFGTPTFWA 1386
            +SCNLYILI Q  WD F + F+ +S ++ + WTGIWS+ + S EFY  AA V+G+P +WA
Sbjct: 61   VSCNLYILIHQFRWDWFSTLFIALSCLVVYGWTGIWSTFTTSGEFYKSAAHVYGSPIYWA 120

Query: 1387 VLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPTDPEVHKIAMS 1446
            + FVG++FCLLPRFT DVF++ F+PKDIDIIRE W +G FD +P+ YDPTDP   +IA +
Sbjct: 121  IFFVGVLFCLLPRFTFDVFQKMFFPKDIDIIREFWVQGHFDQYPEDYDPTDPNRPQIAKA 180

Query: 1447 DIRVFSGAXXXXXXXXXXXXXXXXXXXXXXXIPLELGKGMNDSGKKSEYESGVGDEILKY 1506
            D ++                            P  + +G + +   +    G  D +   
Sbjct: 181  DTKLH---------------------------PRYVEEGSDYAHAITTANHGSRDTVYT- 212

Query: 1507 YLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDTRF 1554
               ++     +  D+      + R++ RTSLDRTR  M A+N+LD R+
Sbjct: 213  ---EEIPMTFMEADDNNPEPFHPRSNIRTSLDRTRMQMRASNELDGRY 257

>Scas_505.4
          Length = 1025

 Score =  255 bits (651), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 213/366 (58%), Gaps = 11/366 (3%)

Query: 1063 AKAEHDIPRGE---FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAV 1119
            A  EH + + E    A++IDG++L YAL + D++   L L K CK+V+CCRVSP QKA V
Sbjct: 544  ALKEHKLSQHEMNTLALVIDGKSLSYALES-DLEDYLLALGKICKAVVCCRVSPLQKALV 602

Query: 1120 VKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLL 1179
            VK+VK     + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D A+GQFR+L +LL
Sbjct: 603  VKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLL 662

Query: 1180 LVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIP 1239
            LVHG W Y+R++  I   FYKN    +  FWF   N + G  + E   +++YN+ FT  P
Sbjct: 663  LVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFP 722

Query: 1240 VILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYR 1299
              ++G+FDQ VS  +   +PQLY++G   K +S   F  ++++G Y S + +    L YR
Sbjct: 723  PFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYR 782

Query: 1300 RHMIVTSNGLGLDH-RYYVGVPVTAIACISCNLYILIQQKHWDVFCSFFVGVSI---MIF 1355
              M +  +G   DH  + + V  ++I  +     ++  Q  W  F  F +  S    MIF
Sbjct: 783  YGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ--WTKFTLFAIPGSFIFWMIF 840

Query: 1356 F-TWTGIWSSASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDI 1414
            F  +  ++  A+ S E++      +G+ TFW  L V  +F L+  F    ++R + P+  
Sbjct: 841  FPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESY 900

Query: 1415 DIIREM 1420
             +++EM
Sbjct: 901  HLVQEM 906

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 119/181 (65%), Gaps = 6/181 (3%)

Query: 400 FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459
           F +  W +++ GD++R+ + E IPAD+I++S+S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 333 FIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPE 392

Query: 460 TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519
           T+++  S  +   +  + SE P+++LY+Y+G   +N+      +  P++   ++LRG TL
Sbjct: 393 TAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN------RKIPLSPEQMILRGATL 446

Query: 520 RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579
           RNT W  G+V FTG +TK+M NA  TP K++ + + +NL ++  F +L VL  I+ L N 
Sbjct: 447 RNTSWMFGLVIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLGNA 506

Query: 580 I 580
           I
Sbjct: 507 I 507

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 42/92 (45%)

Query: 195 NYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLXX 254
           NY  N I TTKY   TFLPK +  +F  +AN++FL    +        TN   +   L  
Sbjct: 236 NYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMV 295

Query: 255 XXXXXXXXXXXEDSRRTVLDLEVNNTKTHVLT 286
                      ED +R   D E+NN+KT + +
Sbjct: 296 VLIVSAFKESIEDIKRANSDKELNNSKTEIYS 327

>Scas_89.1
          Length = 271

 Score =  155 bits (391), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 157/281 (55%), Gaps = 36/281 (12%)

Query: 929  YERWNKKYDIAAAAVVDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEA 987
            Y+++ K+Y  A+ ++++ +E +  V    +E +L LLG T +ED+LQ+ V  SI LL  A
Sbjct: 2    YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 988  GIKLWVLTGDKVETAINIGFSCNLLNNDMEL-LVIKTTGPDVEDLGATPKDIVDTLISQY 1046
            G+K+W+LTGDKVETA  +  S  L++    +  V K + P+                   
Sbjct: 62   GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPE------------------- 102

Query: 1047 LHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSV 1106
                 G   + E LK  K+          ++IDGE+L   L+    K++F  +  +  +V
Sbjct: 103  -----GALNALEYLKINKSS--------CLLIDGESLGMFLTY--YKQEFFDIVVDLPAV 147

Query: 1107 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSD 1166
            + CR +P QKA V  L++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D
Sbjct: 148  IACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAAD 207

Query: 1167 YAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLA 1207
            +++ QF +LT+LLL HG+  YKR A++     ++ +I ++ 
Sbjct: 208  FSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVC 248

>Kwal_26.9207
          Length = 1469

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 139/321 (43%), Gaps = 47/321 (14%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGL--NEESLLE 900
            ++   EF S  +RMS IVK  G++           KGA  VI    +K+ L  N E +L+
Sbjct: 934  VIRSFEFVSELRRMSVIVKPYGENVFWG-----FTKGAPEVISEICNKSTLPANYEQILQ 988

Query: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960
                   QY   G R +  A + L    + R+ +K        V REE        +E +
Sbjct: 989  -------QYTHNGYRVIACAGKTLPKRTW-RFAQK--------VSREE--------VESN 1024

Query: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020
            +  LG    E++L+     ++A L +AGI+  + TGD V TAI++G    L+      + 
Sbjct: 1025 MEFLGFVVFENKLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFV- 1083

Query: 1021 IKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDG 1080
                 P + D    P +  D +I + + D       +  L     E      ++ + + G
Sbjct: 1084 -----PQIND-NMDPNE--DLIIWRDVDD------CDLILDGVTLEPMNGSSDYTIAVTG 1129

Query: 1081 EALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSND 1140
            +  +      ++  +  +     KS +  R+SP +K  +V  ++  LD +    GDG+ND
Sbjct: 1130 DVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQG-LDYVVGFCGDGAND 1188

Query: 1141 VAMIQSANIGVGIAGEEGRQA 1161
               +++A++GV ++  E   A
Sbjct: 1189 CGALKAADVGVSLSEAEASVA 1209

>Scas_665.30
          Length = 1439

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 86/330 (26%), Positives = 136/330 (41%), Gaps = 62/330 (18%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGL--NEESLLE 900
            I+   EF S  +RMS IVK   +D           KGA  VI    +K  L  N E +L 
Sbjct: 704  IIRSFEFLSELRRMSVIVKPSNEDVYWA-----FTKGAPEVITQICNKATLPANFEEMLN 758

Query: 901  KTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERH 960
                    Y  +G R +  A R L    +    K         V REE        +E +
Sbjct: 759  -------YYTHKGYRVIACAGRVLPRNTWLYSQK---------VSREE--------VESN 794

Query: 961  LILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLV 1020
            +  LG    E++L+     ++  L EA I+  + TGD V TAI++G  CNL+ +      
Sbjct: 795  MEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLIKSK----- 849

Query: 1021 IKTTGPDVEDLGATPKDIV---------DTLISQYLHDKFGMAGSEEELKKAKAEHDIPR 1071
             K   P +E++ +T +  +         DTL S+ L     +  S           DI  
Sbjct: 850  -KVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTL---LPINNSSSTSYTLAITGDI-- 903

Query: 1072 GEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMT 1131
              F +I   E    +   ED     LL     K  +  R+SP +K  +++ ++  L+   
Sbjct: 904  --FRIIFGDENNSIS---EDYINTVLL-----KGTIYARMSPDEKHELMEQLQR-LNYTV 952

Query: 1132 LAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161
               GDG+ND   +++A++G+ ++  E   A
Sbjct: 953  GFCGDGANDCGALKAADVGISLSEAEASVA 982

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 132/322 (40%), Gaps = 48/322 (14%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902
            I+   EF S  +RMS IVK      N +       KGA  VI         N  +L    
Sbjct: 916  IIRSFEFLSELRRMSVIVK-----PNNENVYWAYTKGAPEVIIDIC-----NPATLPSDY 965

Query: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962
               L  Y   G R +  A + L    +    K         V REE        +E ++ 
Sbjct: 966  DDILNFYTHSGYRVIACAGKTLPKNTWLYSQK---------VRREE--------VESNME 1008

Query: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022
             LG    +++L+D    +++ L  A I+  + TGD V TAI++G  C L+  D      +
Sbjct: 1009 FLGFIIFQNKLKDATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITED------R 1062

Query: 1023 TTGPDVEDLGATPKDIV---DTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
               P V     T + ++   +   ++++ D F +   ++             G + + I 
Sbjct: 1063 VYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTLQPIDDY-----------SGPYTLAIT 1111

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139
            GE  +   S +D   +  +     K  +  R+SP +K  +V+ ++  +D      GDG+N
Sbjct: 1112 GEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPDEKHELVEQLQK-MDYTVGFCGDGAN 1170

Query: 1140 DVAMIQSANIGVGIAGEEGRQA 1161
            D   +++A++G+ ++  E   A
Sbjct: 1171 DCGALKAADVGISLSEAEASVA 1192

>Kwal_47.17547
          Length = 1240

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 141/639 (22%), Positives = 249/639 (38%), Gaps = 102/639 (15%)

Query: 407  NVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRSS 466
            ++ VGDI+ +   + +PAD IL+      G+C  +   L GE+      ++K     +++
Sbjct: 203  DILVGDILSLQTGDVVPADCILVK-----GSCECDESALTGES-----ATIK-----KAA 247

Query: 467  IDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWAM 526
            ID+   ++   S    A      G  +           +P+ I+   L     R    ++
Sbjct: 248  IDVCYEKYKQLSATDAAIDIGTPGAEKVP---------DPMLISGSKLLSGLGRAVVTSV 298

Query: 527  GVVAFTGDD-TKIMLNAGVTPTKKSRISKELNLSVLFNFA--LLFVLCFIAGLYN----G 579
            GV +  G     + + A  TP ++   S   ++SV  + A  LLF + F+  L N    G
Sbjct: 299  GVNSMHGRTLMALKVEAETTPLQERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGG 358

Query: 580  IYHNKHPRSRDXXXXXXXXXXXXXXXXXXXWVAVILYQSLVPISLYISVEIIKTAQAIFI 639
              H+  P  +                     V + +    VP  L ++V +     A+  
Sbjct: 359  ELHDLTPAQKGSRFMNIFI------------VGITVIVVAVPEGLPLAVTL-----ALAF 401

Query: 640  YLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRA 699
                M  +  L      +     + +G    + SDKTGTLT+N M   K  +    +  A
Sbjct: 402  ATTRMAKDGNL-----VRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEA 456

Query: 700  YTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFV 759
              E++        VD+A  ++  +E +K+D       L N+  NS  +E+      KE  
Sbjct: 457  --ESVGPSDSETDVDLAIANECSEE-LKKDV------LTNITLNSTAFEN------KENE 501

Query: 760  DDLTGGSGSVQQKSCQHFMLAL------ALCHSVLTEPSKEDPAKLEIKAQSPDEAALVT 813
            +D         +     F  +             L E +  D  K        + A L  
Sbjct: 502  EDKVSNENPFHKPRKSLFPWSRNNKSKKPATAKELVENAAADQPKEPFLGSKTETALLAF 561

Query: 814  TARDMGFSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKA 873
              +++G   L   ++    +  GIEK   I+ I+ F SSRK    +VK      NG  + 
Sbjct: 562  AQKNLGMQNLHHYRDEP--DCLGIEK---IVQIIPFESSRKWGGIVVKY----KNGLHR- 611

Query: 874  LLICKGADSVIYSRL-------DKTGLNEESLLEKTALHLEQYATEGLRTLCLAQREL-- 924
                KGA  ++  R         K  L  +   ++ +  +   A E LR + LA R+   
Sbjct: 612  -FYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTITNLAAEALRAISLAHRDYPN 670

Query: 925  --SW------EEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDG 976
              +W      +E E      D+     V R + + + + E+   ++L G   I+D L+ G
Sbjct: 671  CPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQELVSPMVLDGIVGIQDPLRKG 730

Query: 977  VPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNND 1015
            V  S+    +AG+ + ++TGD + TA  I   C++L+ +
Sbjct: 731  VRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEE 769

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 141/319 (44%), Gaps = 41/319 (12%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902
            I+   EF S+ +RMS IVK   ++       +   KGA  VI+    K  L     L+  
Sbjct: 912  IVRSFEFLSNLRRMSVIVKPFSENV-----FMSFTKGAPEVIFELCSKQTLP----LDYE 962

Query: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962
            AL L  Y   G R +  A ++L+ + +    K         V REE        IE +L 
Sbjct: 963  AL-LHHYTHNGYRVIACAGKKLTRQSWLYSQK---------VSREE--------IESNLE 1004

Query: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022
             LG    E++L+    +++  L  A I+  + TGD V TAI++G    L+ +    + + 
Sbjct: 1005 FLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSV- 1063

Query: 1023 TTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEA 1082
                 + D+  + +   D +  Q + +      S   L+    + D    ++ + + GE 
Sbjct: 1064 -----INDIDTSQEG--DIITWQNVANSSDTLDS-VTLRPLSGDTD----DYTLAVTGEV 1111

Query: 1083 LKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVA 1142
             +    T+  + + ++     K+ +  R+SP +K  +V+ ++ ++       GDG+ND  
Sbjct: 1112 FRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ-SIGYQVGFCGDGANDCG 1170

Query: 1143 MIQSANIGVGIAGEEGRQA 1161
             +++A+IG+ ++  E   A
Sbjct: 1171 ALKAADIGISLSEAEASVA 1189

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
            cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 124/540 (22%), Positives = 214/540 (39%), Gaps = 135/540 (25%)

Query: 663  DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIE 722
            + +G    + SDKTGTLT+N+M   + T+     GRA  + +       G D +  + + 
Sbjct: 397  ETMGSATAVCSDKTGTLTENIMTVVRGTL-----GRAGFDDI-------GADPSKSNLVF 444

Query: 723  KEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALA 782
            K+        +I    N+  NS  +E+      K++ D       S+     +  +  + 
Sbjct: 445  KKKCSDLLRTVI--YDNIVLNSTAFEN------KDYKD--PNNYNSIDDSQPRRLIRRIT 494

Query: 783  LCHSVLTEPSKEDPAKLEIKA----QSP-----DEAALVTTAR-DMGFSFLKKTKEGMVL 832
                 L +   +D   L   A    Q P      E AL++ AR   G  F      G + 
Sbjct: 495  ---QTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKF------GALQ 545

Query: 833  EVQGIEKEF----QILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRL 888
              +G  ++      I+ I+ F SSRK  + +VK+  +  N   K  L  KGA  ++    
Sbjct: 546  SFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKAC 605

Query: 889  DKTGLNEESLLE---KTALHLEQ----YATEGLRTLCLAQREL---SWEEYERWNKKYDI 938
                +  E + E   K+   +E+     A + LR + LA  +     W   E  + +   
Sbjct: 606  TLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSH 665

Query: 939  AAAAVVDREEELEKVSDEIERHL---ILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLT 995
             A AV        K+ D  + HL    L     I+D L++ V +S+A   +AG+ + ++T
Sbjct: 666  EALAV--------KLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVT 717

Query: 996  GDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAG 1055
            GD + TA  I  +C +L+                              S+ L+D      
Sbjct: 718  GDNLLTAKAIARNCGILS------------------------------SKSLNDS----- 742

Query: 1056 SEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQ 1115
                               A  ++G A +      D +RK +L     K  +  R SP  
Sbjct: 743  -------------------ACAMEGPAFR---KLSDSERKRIL----PKLRVLARSSPED 776

Query: 1116 KAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIG--VGIAGEE-GRQA----VMSSDYA 1168
            K  +V+ +K   +V+ +  GDG+ND   ++ A++G  +GI G E  R+A    +M+ D++
Sbjct: 777  KKILVRALKEMGEVVAVT-GDGTNDAPALKLADVGFSMGITGTEVAREASDIILMTDDFS 835

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 5/44 (11%)

Query: 407 NVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETN 450
           N+ VGD++++   + +PAD +L+      G C  +   L GE+N
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVLVR-----GECETDESALTGESN 212

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 77/334 (23%), Positives = 134/334 (40%), Gaps = 72/334 (21%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902
            ++   EF S  +RMS IVK  G   N         KGA  VI    +   + ++      
Sbjct: 903  VIRSFEFLSELRRMSVIVK--GFKEN---TYWSFTKGAPEVIADICNPATIPKD------ 951

Query: 903  ALH--LEQYATEGLRTLCLAQREL---SWEEYERWNKKYDIAAAAVVDREEELEKVSDEI 957
              H  L  Y   G R +  A + L   SW   ++            V REE        +
Sbjct: 952  -FHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK------------VSREE--------V 990

Query: 958  ERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNL------ 1011
            E +L  LG    E++L+     ++  L  A I+  + TGD V TA+++G    L      
Sbjct: 991  EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTAVSVGRDSGLISSERV 1050

Query: 1012 ----LNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEH 1067
                LN+++E      +  DV++ G+    ++D +  + L+D                  
Sbjct: 1051 FIPFLNDNLEESRHLLSWRDVDEEGS----VLDAVTLKPLND------------------ 1088

Query: 1068 DIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTL 1127
              P   + + I G+  +     +++     +     K  +  R+SP +K  +V+ ++  L
Sbjct: 1089 --PEKSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHELVEQLQK-L 1145

Query: 1128 DVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161
            D      GDG+ND   +++ANIG+ ++  E   A
Sbjct: 1146 DYNVGFCGDGANDCGALKAANIGISLSEAEASVA 1179

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/331 (22%), Positives = 132/331 (39%), Gaps = 58/331 (17%)

Query: 843  ILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKT 902
            ++   EF S  +RMS IVK   DD           KGA  VI    +K+ L  +   E+ 
Sbjct: 928  VVRSFEFLSELRRMSVIVKTNNDDVYWS-----FTKGAPEVISEICNKSTLPAD--FEEV 980

Query: 903  ALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLI 962
               L  Y   G R +  A + L    +    K         V REE        +E +L 
Sbjct: 981  ---LRCYTHNGYRVIACAGKTLPKRTWLYSQK---------VSREE--------VESNLE 1020

Query: 963  LLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIK 1022
             LG    +++L+    +++  L +A I+  + TGD + TAI++G    L+         +
Sbjct: 1021 FLGFIIFQNKLKKETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCS------R 1074

Query: 1023 TTGPDVEDLGA------------TPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIP 1070
               P + D                P  I+DT   + +  K G   S E L++        
Sbjct: 1075 VYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPV--KLG-NNSVESLRECN------ 1125

Query: 1071 RGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVM 1130
               + + + G+  +     E+   +  L      S +  R+SP +K  ++  ++  LD  
Sbjct: 1126 ---YTLAVSGDVFRLLFRDENEIPEEYLNEILLNSSIYARMSPDEKHELMIQLQK-LDYT 1181

Query: 1131 TLAIGDGSNDVAMIQSANIGVGIAGEEGRQA 1161
                GDG+ND   +++A++G+ ++  E   A
Sbjct: 1182 VGFCGDGANDCGALKAADVGISLSEAEASVA 1212

>CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharomyces
            cerevisiae YEL031w SPF1 P-type ATPase, hypothetical start
          Length = 1214

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 135/327 (41%), Gaps = 59/327 (18%)

Query: 840  EFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLL 899
            +  IL   +F+S+ KR S +    G       K     KGA   I  RL     N + + 
Sbjct: 571  QVTILRRFQFSSALKRSSSVATHDG-------KLYSAVKGAPETIRERLFTIPANYDEIY 623

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            +        +   G R L LA ++L         +K   +     DRE          ER
Sbjct: 624  K-------SFTRSGSRVLALASKKL---------EKMSQSQIEDADREH--------FER 659

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L   G       L+    ++I +L E+  +  ++TGD   TA+++     ++  +  ++
Sbjct: 660  DLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIV 719

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYL--HDKFGMAGSEEELKKAKAEHDIPRGEFAVI 1077
             +   G D + +    +++ +TL  +++   D F   G  ++   A   H +        
Sbjct: 720  DMVDNGNDDKLVF---RNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGHAL-------- 768

Query: 1078 IDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDG 1137
               EALK     +D+ R          + +  RVSPAQK  ++  +K+ +   TL  GDG
Sbjct: 769  ---EALKGHHQLQDLIRH---------AWIYARVSPAQKEFILNNLKD-MGYQTLMCGDG 815

Query: 1138 SNDVAMIQSANIGVGI--AGEEGRQAV 1162
            +NDV  ++ A++GV +    EEG + V
Sbjct: 816  TNDVGALKQAHVGVALLNGTEEGLKKV 842

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 91/376 (24%), Positives = 155/376 (41%), Gaps = 48/376 (12%)

Query: 663  DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIE 722
            + +G    + SDKTGTLT+NVM   +       +  + +  ++  RK     V  E+   
Sbjct: 434  ETMGSATAVCSDKTGTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENC-- 491

Query: 723  KEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALA 782
               ++ D       L N+  NS  +E+      +++  +    +GS        F+    
Sbjct: 492  SSSLRNDL------LANIVLNSTAFEN------RDYKKNDKNTNGSKNMSKNLSFLDKCK 539

Query: 783  LCHSVLTEPSKEDPAKLEIK-----AQSPDEAALVTTARDMGFSFLKKTKEGMV--LEVQ 835
               S   + ++ED      K      Q P   +   TA           + G +  L  Q
Sbjct: 540  SRLSFFKKGNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQ 599

Query: 836  GIEKEFQILNILE---FNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVI-----YSR 887
             +EK F I  +++   F SSRK    +VK   +  N KP      KGA  ++     Y R
Sbjct: 600  PMEK-FNIEKVVQTIPFESSRKWAGLVVKYK-EGKNKKPFYRFFIKGAAEIVSKNCSYKR 657

Query: 888  LDKTGLNE--ESLLEKTALHLEQYATEGLRTLCLAQREL----SW-EEYERWNKKYDIAA 940
                 L E  E   ++T   ++  A++ LR + +A ++     SW  E  R     +IAA
Sbjct: 658  NSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAA 717

Query: 941  AAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVE 1000
              ++             ++ LIL G   I+D L+ GV +S+     AG+ + ++TGD + 
Sbjct: 718  LDLLFNS----------QKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNIL 767

Query: 1001 TAINIGFSCNLLNNDM 1016
            TA  I  +C +L+ D+
Sbjct: 768  TAKAIARNCAILSTDI 783

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 1107 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIG--VGIAGEE-GRQA-- 1161
            +  R SP  K  +V+ +K   DV+ +  GDG+ND   ++ A++G  +GI+G E  R+A  
Sbjct: 813  VLARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 871

Query: 1162 --VMSSDYA 1168
              +M+ D++
Sbjct: 872  IILMTDDFS 880

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query: 407 NVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETN 450
           +V VGD++ +   + +PAD +++S     G C  +  ++ GE+N
Sbjct: 209 HVLVGDVISLQTGDVVPADCVMIS-----GKCEADESSITGESN 247

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
            (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 136/321 (42%), Gaps = 55/321 (17%)

Query: 840  EFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLL 899
            +  IL   +F+S+ KR S I       A    +     KGA   I  RL +   + + + 
Sbjct: 574  DISILRRFQFSSALKRSSTI-------AVHNKQHYSAVKGAPETIRERLSQVPTDYDQVY 626

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            +        +   G R L LA ++L                +  + + E+LE+  + +E 
Sbjct: 627  KS-------FTRAGSRVLALASKKLP---------------SMSIKQIEKLER--EAVES 662

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L   G       L+D   ++I +L E+  +  ++TGD   TA+++     ++  + E L
Sbjct: 663  DLEFKGFLVFHCPLKDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIV--ERETL 720

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
            ++       E +  +   +V   I + + + F       E  K  A++DI        + 
Sbjct: 721  ILD------EPIDGSSHALVFRNIEETIVNPFNPEKDTFEHSKLFAKYDIA-------VT 767

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139
            G AL+  LS      + +       + +  RVSPAQK  ++  +K+ +   TL  GDG+N
Sbjct: 768  GHALQL-LSGHSQLNELIR-----HTWVYARVSPAQKEFIMNSLKD-MGYQTLMCGDGTN 820

Query: 1140 DVAMIQSANIGVGI--AGEEG 1158
            DV  ++ A++G+ +    EEG
Sbjct: 821  DVGALKQAHVGIALLNGTEEG 841

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
            Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
            start by similarity
          Length = 1206

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 135/312 (43%), Gaps = 53/312 (16%)

Query: 842  QILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEK 901
            +IL   +F+SS KR + I       A+   +     KGA   I  RL+    + + + + 
Sbjct: 573  RILRRFQFSSSLKRSASI-------ASQSNRFFAAVKGAPETIRERLNSVPSDYDDIYK- 624

Query: 902  TALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHL 961
                   +   G R L LA ++L     +  N + D      +DR        DEIE  L
Sbjct: 625  ------SFTRSGSRVLALAYKDLP----KMSNSQID-----NIDR--------DEIETGL 661

Query: 962  ILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVI 1021
                       L+D   ++I +L E+  +  ++TGD   TA+++     ++  D E L++
Sbjct: 662  TFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETLIL 719

Query: 1022 KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGE 1081
                 D        +D+ +T++  +  D    A + +E K+   ++D+        + G 
Sbjct: 720  DEP-IDGSSHALVMRDVNETIVKPFNPD----ADTFDE-KEIFQKYDLA-------VTGH 766

Query: 1082 ALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDV 1141
            ALK     + ++           + +  RVSP+QK  ++  +K+ +   TL  GDG+NDV
Sbjct: 767  ALKLLQGHKQLRDVIR------HTWIYARVSPSQKEFILITLKD-MGYQTLMCGDGTNDV 819

Query: 1142 AMIQSANIGVGI 1153
              ++ A++G+ +
Sbjct: 820  GALKQAHVGIAL 831

>Scas_583.14*
          Length = 875

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 80/334 (23%), Positives = 132/334 (39%), Gaps = 70/334 (20%)

Query: 840  EFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLL 899
            + QIL   +F+S+ KR S +       A+ K K     KGA   I  RL     N + + 
Sbjct: 227  KLQILRRFQFSSALKRSSSV-------ASHKDKLFTAVKGAPETIRERLAVVPKNYDEIY 279

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            +        +   G R L LA + L     ++ +          +DR        DEIE 
Sbjct: 280  K-------SFTRSGSRVLALASKSLPNLSSKQLDD---------LDR--------DEIET 315

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L   G       L+    ++I +L E+  +  ++TGD   TA+++     ++  +  +L
Sbjct: 316  GLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGETLIL 375

Query: 1020 VIKTTGPD-------VEDLGATPKDIV-DTLISQYLHDKFGMAGSEEELKKAKAEHDIPR 1071
                T  D       VE+    P D   D    + L DK+ +A +   L           
Sbjct: 376  DKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALN---------- 425

Query: 1072 GEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMT 1131
                ++ D   LK      D+ R          + +  RVSP+QK  ++  +K  +   T
Sbjct: 426  ----LLEDHSQLK------DLIR---------HTWVYARVSPSQKEFILNNLKE-MGYQT 465

Query: 1132 LAIGDGSNDVAMIQSANIGVGIA-GEEGRQAVMS 1164
            L  GDG+NDV  ++ A++GV +  G E     M+
Sbjct: 466  LMCGDGTNDVGALKQAHVGVALLNGTEESMTAMA 499

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 88/379 (23%), Positives = 156/379 (41%), Gaps = 69/379 (18%)

Query: 663  DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKI- 721
            + +G    + SDKTGTLTQN M   K  +    +                 D++ +S   
Sbjct: 419  ETMGSATTVCSDKTGTLTQNKMVVVKGFLGSSHFD----------------DISEDSNCA 462

Query: 722  EKEGIKRDREE--MINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFML 779
            + + +++D  +  + + L N+A NS  +E+      K+  D        V  ++  H   
Sbjct: 463  QSDALRQDMSQHTLNDILANIALNSTAFEN------KQVAD-------PVITENPYHKPR 509

Query: 780  ALALCHSVLTEPSKEDPAKLEIKAQ-----SPDEAALVTTAR-DMGFSFLKKTKEGMVLE 833
                  S   +P    P    +++      S  EAAL++ A+  +G   L+  ++     
Sbjct: 510  RSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDP--H 567

Query: 834  VQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIY-------- 885
              GI     I+ ++ F SSRK    +V++   D N +       KGA   I+        
Sbjct: 568  HIGIA---SIVQMIPFESSRKWAGLVVRLV--DGNYR----FFIKGASETIFKSCHYMRS 618

Query: 886  SRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQREL----SWEEYE-RWNKKYDIAA 940
            S  D   L+ +   E   L +   A++ LRT+ LA ++     SW   E R       A+
Sbjct: 619  SNDDVIKLSPQKHGEIFGL-INNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTAS 677

Query: 941  AAVVDREEELEKVSDEIE------RHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVL 994
              ++  +E +   +D           LIL G   I D L+ GV +S+    ++G+ + ++
Sbjct: 678  PDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMI 737

Query: 995  TGDKVETAINIGFSCNLLN 1013
            TGD + T   I  +C +L+
Sbjct: 738  TGDNITTGRAIARACGILS 756

>Kwal_23.3160
          Length = 1100

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 137/623 (21%), Positives = 230/623 (36%), Gaps = 145/623 (23%)

Query: 612  AVILYQSLVPISLYISVEIIKTAQA-IFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            A+ +  S++P SL + + I  +  A I    +V++   KLD           + LG +  
Sbjct: 323  AICVAVSMIPSSLVVVLTITMSVGAKIMATRNVVV--RKLDS---------LEALGAVND 371

Query: 671  IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDR 730
            + SDKTGTLTQ  M  K+  +   S+G       +         +    +      K D 
Sbjct: 372  VCSDKTGTLTQGKMIVKQAWVP--SFGTITVSNSSNPFDPTDGGIELIPRFSPHQYKHDS 429

Query: 731  EEMINKLQNLAKNSQFYEDEVT--FVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVL 788
             E +  + +    ++FY D++     SK F++ L                 ALA    V 
Sbjct: 430  TEDVGIITSF--KNKFYNDKLPAGLNSKLFLNWLKTA--------------ALANIAHVY 473

Query: 789  TEPSKE------DPAKLEIK--AQSPDEAALVTTARDMGFSFLKKTKEGMVL--EVQGIE 838
             +P  E      DP ++ I+  A   D      TA D   S   ++ E   L  +   +E
Sbjct: 474  QDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDS---ESDEDAALGEKTSSVE 530

Query: 839  KEFQILNILEFNSSRKRMSCI-VKIPGDDANGKPKALLICKGADSVIYSRLDK---TGLN 894
              ++ +    F+SS KRMS + V +  D+A+      +  KGA   +     K    G N
Sbjct: 531  PHYKHIAEFPFDSSIKRMSAVYVSLDEDNAH-----RVFTKGAFERVLDCCTKWLPDGCN 585

Query: 895  E-------ESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDRE 947
            E       E   E+   ++E  ++EGLR L  A +  +  +               +   
Sbjct: 586  ESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQ--------------ALKVS 631

Query: 948  EELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGF 1007
            E+L K  D +E  LI  G   I D  +     ++    +AGI + +LTGD   TA  I  
Sbjct: 632  EDLRKNRDFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ 691

Query: 1008 SCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEH 1067
               +L                 +L   PK++VD+++                     A+ 
Sbjct: 692  EVGILP---------------RNLYHYPKEVVDSMV------------------MTAAQF 718

Query: 1068 DIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLV--KN 1125
            D                  L+ E++    LL       ++  R +P  K  ++  +  + 
Sbjct: 719  D-----------------QLTDEEIDNLLLL------PLVIARCAPQTKVRMIDALHRRE 755

Query: 1126 TLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVH--- 1182
                MT   GDG ND   ++ AN+G+ +       A  +SD  +    + + L  V    
Sbjct: 756  KFCAMT---GDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR 812

Query: 1183 ------GKWCYKRLAEMIPQFFY 1199
                   K+  + LAE + Q  Y
Sbjct: 813  RMSDNIQKFVLQLLAENVAQALY 835

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transporting
            ATPase, member of the P-type ATPase superfamily of
            membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 129/334 (38%), Gaps = 81/334 (24%)

Query: 840  EFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLL 899
            +  I+   +F+S+ KR + I       A+         KGA   I  RL     N + + 
Sbjct: 573  KLDIIRRFQFSSALKRSASI-------ASHNDALFAAVKGAPETIRERLSDIPKNYDEIY 625

Query: 900  EKTALHLEQYATEGLRTLCLAQREL---SWEEYERWNKKYDIAAAAVVDREEELEKVSDE 956
            +        +   G R L LA + L   S  + +  N+                    D+
Sbjct: 626  K-------SFTRSGSRVLALASKSLPKMSQSKIDDLNR--------------------DD 658

Query: 957  IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1016
            +E  L   G       L+D   ++I +L E+  +  ++TGD   TA+++     ++    
Sbjct: 659  VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVFG-- 716

Query: 1017 ELLVIKTTGP---------DVEDLGATPKDIV-DTLISQYLHDKFGMAGSEEELKKAKAE 1066
            E L++   G          DVE+  + P D   DT     L D++ +A            
Sbjct: 717  ETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDHSKLFDRYDIA------------ 764

Query: 1067 HDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNT 1126
                       + G AL  AL      R  L       + +  RVSP+QK  ++  +K+ 
Sbjct: 765  -----------VTGYALN-ALEGHSQLRDLLR-----HTWVYARVSPSQKEFLLNTLKD- 806

Query: 1127 LDVMTLAIGDGSNDVAMIQSANIGVGI--AGEEG 1158
            +   TL  GDG+NDV  ++ A++G+ +    EEG
Sbjct: 807  MGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEG 840

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
            involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 144/662 (21%), Positives = 254/662 (38%), Gaps = 138/662 (20%)

Query: 612  AVILYQSLVPISLYISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYI 671
            A+ +  S++P SL + + I  +A A  +    ++   KLD           + LG +  I
Sbjct: 317  AICVALSMIPSSLVVVLTITMSAGAKVMATRHVII-RKLDS---------LEALGAVNDI 366

Query: 672  FSDKTGTLTQNVMEFKKC------TINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEG 725
             SDKTGTLTQ  M  K+       TIN  +    +   +         ++    K     
Sbjct: 367  CSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIG--------EIQLIPKFSPYQ 418

Query: 726  IKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCH 785
             K D EE +  + +    S++Y DE+             G  +V   +   +   LA   
Sbjct: 419  YKHDDEEDVGMITDF--KSKYYADEL-------------GPLNVSLFTQWLYTATLANIA 463

Query: 786  SVLTEPSKEDPAKLEIKAQS-PDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKEFQIL 844
            +V  +P  +D      KA   P E A+   A  M       T E    E + I  +    
Sbjct: 464  TVFRDPETQD-----WKAHGDPTEIAIQVFATRMDLPRRVLTGEDNDDE-KNIHNDITFE 517

Query: 845  NILE--FNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVI-------YSRLDKT--GL 893
            ++ E  F+SS KRMS I K    +    P   +  KGA   +       Y+  D +   L
Sbjct: 518  HVAEYPFDSSVKRMSAIYK--NVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPL 575

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
             EE  LE    +++  ++EGLR L  A++  +  ++                 +++L K 
Sbjct: 576  TEED-LETVQKNVDTLSSEGLRVLAFAKKTFNESQF--------------TINKDKLLKE 620

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLN 1013
             D +E +L  LG   I D  +     ++     AGI + +LTGD   TA +I     +L 
Sbjct: 621  RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILP 680

Query: 1014 NDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGE 1073
            +               +L   PK++V+ ++         M  ++ +              
Sbjct: 681  H---------------NLYHYPKEVVNFMV---------MTATDFD-------------- 702

Query: 1074 FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLV--KNTLDVMT 1131
                        ALS +++    +L       ++  R +P  K  +++ +  +N    MT
Sbjct: 703  ------------ALSDKEIDELPVL------PLVIARCAPQTKVRMIEALHRRNRFCAMT 744

Query: 1132 LAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLV-HGKWCYKRL 1190
               GDG ND   ++ AN+G+ +       A  +SD  +    + + L  V  G+     +
Sbjct: 745  ---GDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNI 801

Query: 1191 AEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL-TFYNLAFTS-IPVILLGIFDQ 1248
             + + Q   +N+   L L     + D +G  +F  + +   + +  TS  P + LG+   
Sbjct: 802  QKFVLQLLAENVAQALYLMVGLCFLDEEGFSVFPLSPVEVLWVIVVTSCFPAMGLGLEKA 861

Query: 1249 DV 1250
            +V
Sbjct: 862  NV 863

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 96/192 (50%), Gaps = 25/192 (13%)

Query: 836  GIEKEFQILNILEFNSSRKRMSCIVKIPGDD-----ANGKPKALL-IC---KGADSVIYS 886
            GI+K   ++ ++ F SSRK  +  V++  +      A G  + LL +C   + +D+ I  
Sbjct: 628  GIDK---VVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVP 684

Query: 887  RLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAA---V 943
                  +N++ L +++   ++  A+  LRT+ L  R+      + +    D + A+   V
Sbjct: 685  ------MNQD-LYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLV 737

Query: 944  VDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAI 1003
            +  E + + +S E    + L     ++D L++GV +S+     AG+ + ++TGD + TA 
Sbjct: 738  MGHELDHKNLSSE---GMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTAR 794

Query: 1004 NIGFSCNLLNND 1015
             I  +CN+L+ +
Sbjct: 795  AISRNCNILSEE 806

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 8/68 (11%)

Query: 1107 LCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIG--VGIAGEE-GRQA-- 1161
            +  R SP  K  +V+ +K   +V+ +  GDG+ND   ++ A++G  +GI+G E  R+A  
Sbjct: 837  VLARSSPEDKRILVETLKKMGEVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASD 895

Query: 1162 --VMSSDY 1167
              +M+ D+
Sbjct: 896  IILMTDDF 903

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 410 VGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMK 458
           VGD++ +   + +PAD +L+S     G+C  +   L GE++   + ++K
Sbjct: 259 VGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALK 302

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
            Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 951

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 80/184 (43%), Gaps = 41/184 (22%)

Query: 833  EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTG 892
            E+  +  E+  +  L FNS RK M+  ++      + + K  L  KGA   I   LDK+ 
Sbjct: 464  ELADVRSEYTKVKELSFNSKRKMMATKIQ------DNEKKTTLFIKGAFERI---LDKSS 514

Query: 893  --LNEESLLEK-TALHLEQ-------YATEGLRTLCLAQRELSWEEYERWNKKYDIAAAA 942
              L E+  +EK TA H E         A+EGLR L  A+R                   A
Sbjct: 515  SYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKR-------------------A 555

Query: 943  VVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETA 1002
            + D   +L  V D+I   L+  G   + D  +  V  +I    + GI + ++TGD   TA
Sbjct: 556  MTDSSSKL--VEDDIS-DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA 612

Query: 1003 INIG 1006
            +NI 
Sbjct: 613  VNIA 616

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 388 INKTLPTDMEW----RFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETK 443
           +NK +P +       R S     N+  GD+VR    + IPADI ++  +D      ++  
Sbjct: 153 LNKLVPQECHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECND----LTIDES 208

Query: 444 NLDGETNLKVRQSMKCTS 461
           NL GET+  V +S K  S
Sbjct: 209 NLTGETD-PVHKSYKALS 225

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 1109 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIA 1154
             R +P  K  +V+ ++   DV+ +  GDG ND   ++ A+IGV + 
Sbjct: 655  ARATPEHKLNIVRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMG 699

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 40/170 (23%)

Query: 847  LEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSR----------LDKTGLNEE 896
            L FNS RK M+  V  P +      K ++  KGA   I  R          ++K   + +
Sbjct: 483  LTFNSKRKYMAVKVDSPANSG----KHIIYVKGAFERILERSASFIGGAGKVEKLSDSHK 538

Query: 897  SLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDE 956
            SL+   A  L   A+EGLRTL  AQ E S  +                        ++D 
Sbjct: 539  SLINDCAKSL---ASEGLRTLAFAQLECSTNK-----------------------PMNDS 572

Query: 957  IERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006
              ++L  +G   ++D  +  V  +I  L + G+ + ++TGD   TA+NI 
Sbjct: 573  TIQNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHVIMITGDAENTAVNIA 622

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 134/678 (19%), Positives = 246/678 (36%), Gaps = 169/678 (24%)

Query: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVND 365

Query: 671  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR---------QGV 713
            I SDKTGTLTQ  M         F   TI+         E    L  R         +  
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425

Query: 714  DVAHESKIEKEGIKRDREEMIN--------KLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765
            DV      +    ++D  E I+        +   LA  +  ++D+ T        D    
Sbjct: 426  DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDAT--------DCWKA 477

Query: 766  SGSVQQKSCQHFMLALALCHSVLT------EPSKEDPAKLEIKAQSPDEAALVTTARDMG 819
             G   + + Q F   + L H+ LT      + ++ D + L    + P  A          
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA---------- 527

Query: 820  FSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDD-----ANGKPKAL 874
                                +F+ +    F+S+ KRMS +     ++       G  +++
Sbjct: 528  --------------------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESI 567

Query: 875  LIC----KGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYE 930
            + C     G D V  + L  T  + E++ +    ++   + EGLR L  A +  + ++  
Sbjct: 568  ISCCSSWYGKDGVKITPL--TDCDVETIRK----NVYSLSNEGLRVLGFASKSFTKDQVN 621

Query: 931  RWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIK 990
                          D+ + +       E  L+ LG   I D  ++    ++    +AGI 
Sbjct: 622  D-------------DQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668

Query: 991  LWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDK 1050
            + +LTGD V TA  I                       +++G  P ++     SQ + D 
Sbjct: 669  VHMLTGDFVGTAKAIA----------------------QEVGILPTNLYH--YSQEIVDS 704

Query: 1051 FGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCR 1110
              M GS+                     DG      LS E++    +L       ++  R
Sbjct: 705  MVMTGSQ--------------------FDG------LSEEEVDDLPVL------PLVIAR 732

Query: 1111 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIG 1170
             SP  K  +++ +       T+  GDG ND   ++ AN+G+ +       +  +SD  + 
Sbjct: 733  CSPQTKVRMIEALHRRKKFCTMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 1171 QFRYLTRLLLV-HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL- 1228
               + + L  V  G+     + + + Q   +N+   L L    ++ D +G  +F  + + 
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 1229 TFYNLAFTS-IPVILLGI 1245
              + +  TS  P + LG+
Sbjct: 852  VLWIIVVTSCFPAMGLGL 869

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
            cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
            efflux, start by similarity
          Length = 1082

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 142/651 (21%), Positives = 246/651 (37%), Gaps = 126/651 (19%)

Query: 612  AVILYQSLVPISLYISVEIIKTAQA-IFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            A+ +  S++P SL + + I  +A A +    +V++   KLD           + LG +  
Sbjct: 317  AICVAISMIPSSLVVVLTITMSAGAKVMATRNVIV--RKLDS---------LEALGAVND 365

Query: 671  IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDR 730
            I SDKTGTLTQ  M  K+  I    +G    +           ++    K      K D 
Sbjct: 366  ICSDKTGTLTQGKMIAKQVWIP--QFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDD 423

Query: 731  EEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTE 790
            EE +  + +             F SK    +L  G  +V       +   LA   +V  +
Sbjct: 424  EEDVGIIPD-------------FKSKYLAGEL--GPLNVSLFDQWLYTATLANIATVFQD 468

Query: 791  PSKEDPAKLEIKAQS-PDEAALVTTARDMGFSFLKKTKEGMVLEVQG-IEKEFQILNILE 848
               +D      KA   P E A+   A  M       T E    E        F+ +    
Sbjct: 469  SETQD-----WKAHGDPTEIAIQVFATRMDLPRHVLTGEDKDDEKDARANSSFEHVAEFP 523

Query: 849  FNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDK---------TGLNEESLL 899
            F+SS KRMS I K   D A   P   +  KGA   +    D          + L++E L 
Sbjct: 524  FDSSVKRMSAIYKNTEDPAT--PIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDL- 580

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            E    +++  ++EGLR L  A++  +  E+                 +++L K  D +E 
Sbjct: 581  ETIQKNVDTLSSEGLRVLAFAKKSFNESEFNA--------------NKDKLLKERDFVEC 626

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L  LG   I D  +     ++    +AGI + +LTGD   TA +I     +L +     
Sbjct: 627  KLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPH----- 681

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
                      +L   PK++V+ ++         MA ++ +                    
Sbjct: 682  ----------NLYHYPKEVVNFMV---------MAATDFD-------------------- 702

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLV--KNTLDVMTLAIGDG 1137
                  ALS +++    +L       ++  R +P  K  +++ +  ++    MT   GDG
Sbjct: 703  ------ALSDQEIDDLRVL------PLVIARCAPQTKVRMIEALHRRSKFCAMT---GDG 747

Query: 1138 SNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLV-HGKWCYKRLAEMIPQ 1196
             ND   ++ AN+G+ +       A  +SD  +    + + L  V  G+     + + + Q
Sbjct: 748  VNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQ 807

Query: 1197 FFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL-TFYNLAFTS-IPVILLGI 1245
               +N+   L L     + D +G  +F  + +   + +  TS  P + LG+
Sbjct: 808  LLAENVAQALYLMVGLCFVDKEGFSVFPLSPVEVLWIIVVTSCFPAMGLGL 858

>Scas_227.0d
          Length = 307

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 126/305 (41%), Gaps = 62/305 (20%)

Query: 666 GQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEK-- 723
           G    +  DKTGTLT+NVM   +  + G SY      AL          VA +S I+K  
Sbjct: 3   GSATAVCFDKTGTLTENVMSVVRGFV-GDSYFNDSDNALL-------TSVATDSHIKKSI 54

Query: 724 EGIKRDRE--EMINK--LQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFML 779
           E  K++ E  E + K  L N+  NS  +E+      K+FVD       S  ++       
Sbjct: 55  EIFKKNGECSENLEKDFLTNIVLNSTAFEN------KDFVDSANNLPFSTDERDPSQVKR 108

Query: 780 ALALC--HSVLT------EPSKEDPAKLEIKAQ------SPDEAALVTTAR---DMGFSF 822
           A      H+ ++        S +D  +  IK +      S  E AL+T A+   ++ F  
Sbjct: 109 AFEFVRTHTRISISRDDNSDSGDDLIQNAIKGRQEPYIGSKTETALLTLAKKSMNLRFGS 168

Query: 823 LKKTKEGMV--LEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKAL--LICK 878
           L+  +E  V   EV       +I  I+ F S+RK    IVK        K   L     K
Sbjct: 169 LRALRENPVDRFEVS------EIAQIIPFESTRKWGGIIVKY-------KESNLYRFFIK 215

Query: 879 GADSVIYSRLDKTGLNEESLL----EKTALHLEQYATEGLRTLCLAQREL----SWEEYE 930
           GA  ++ +       +++S++    ++    +E  A + LR L LA R+     SW   E
Sbjct: 216 GAAEIVSNNCHSKRNSDDSIVTLNKDQINKEIENLANDALRALSLAHRDFPNCTSWPPNE 275

Query: 931 RWNKK 935
             ++K
Sbjct: 276 IVDEK 280

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 133/678 (19%), Positives = 245/678 (36%), Gaps = 169/678 (24%)

Query: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVND 365

Query: 671  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR---------QGV 713
            I SDKTGTLTQ  M         F   TI+         E    L  R         +  
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425

Query: 714  DVAHESKIEKEGIKRDREEMIN--------KLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765
            DV      +    ++D  E I+        +   LA  +  ++D+ T        D    
Sbjct: 426  DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDAT--------DCWKA 477

Query: 766  SGSVQQKSCQHFMLALALCHSVLT------EPSKEDPAKLEIKAQSPDEAALVTTARDMG 819
             G   + + Q F   + L H+ LT      + ++ D + L    + P  A          
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA---------- 527

Query: 820  FSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDD-----ANGKPKAL 874
                                +F+ +    F+S+ KRMS +     ++       G  +++
Sbjct: 528  --------------------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESI 567

Query: 875  LIC----KGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYE 930
            + C     G D V  + L  T  + E++ +    ++   + EGLR L  A +  + ++  
Sbjct: 568  ISCCSSWYGKDGVKITPL--TDCDVETIRK----NVYSLSNEGLRVLGFASKSFTKDQVN 621

Query: 931  RWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIK 990
                          D+ + +       E  L+ LG   I D  ++    ++    +AGI 
Sbjct: 622  D-------------DQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668

Query: 991  LWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDK 1050
            + +LTGD V TA  I                       +++G  P ++     SQ + D 
Sbjct: 669  VHMLTGDFVGTAKAIA----------------------QEVGILPTNLYH--YSQEIVDS 704

Query: 1051 FGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCR 1110
              M GS+                     DG      LS E++    +L       ++  R
Sbjct: 705  MVMTGSQ--------------------FDG------LSEEEVDDLPVL------PLVIAR 732

Query: 1111 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIG 1170
             SP  K  +++ +        +  GDG ND   ++ AN+G+ +       +  +SD  + 
Sbjct: 733  CSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 1171 QFRYLTRLLLV-HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL- 1228
               + + L  V  G+     + + + Q   +N+   L L    ++ D +G  +F  + + 
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 1229 TFYNLAFTS-IPVILLGI 1245
              + +  TS  P + LG+
Sbjct: 852  VLWIIVVTSCFPAMGLGL 869

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 133/678 (19%), Positives = 245/678 (36%), Gaps = 169/678 (24%)

Query: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            A+ +  S++P SL + + I +    A+ +  +V++   KLD           + LG +  
Sbjct: 317  AICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIV--RKLDS---------LEALGAVND 365

Query: 671  IFSDKTGTLTQNVM--------EFKKCTINGVSYGRAYTEALAGLRKR---------QGV 713
            I SDKTGTLTQ  M         F   TI+         E    L  R         +  
Sbjct: 366  ICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG 425

Query: 714  DVAHESKIEKEGIKRDREEMIN--------KLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765
            DV      +    ++D  E I+        +   LA  +  ++D+ T        D    
Sbjct: 426  DVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDAT--------DCWKA 477

Query: 766  SGSVQQKSCQHFMLALALCHSVLT------EPSKEDPAKLEIKAQSPDEAALVTTARDMG 819
             G   + + Q F   + L H+ LT      + ++ D + L    + P  A          
Sbjct: 478  HGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA---------- 527

Query: 820  FSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDD-----ANGKPKAL 874
                                +F+ +    F+S+ KRMS +     ++       G  +++
Sbjct: 528  --------------------QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESI 567

Query: 875  LIC----KGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYE 930
            + C     G D V  + L  T  + E++ +    ++   + EGLR L  A +  + ++  
Sbjct: 568  ISCCSSWYGKDGVKITPL--TDCDVETIRK----NVYSLSNEGLRVLGFASKSFTKDQVN 621

Query: 931  RWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIK 990
                          D+ + +       E  L+ LG   I D  ++    ++    +AGI 
Sbjct: 622  D-------------DQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGIN 668

Query: 991  LWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDK 1050
            + +LTGD V TA  I                       +++G  P ++     SQ + D 
Sbjct: 669  VHMLTGDFVGTAKAIA----------------------QEVGILPTNLYH--YSQEIVDS 704

Query: 1051 FGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCR 1110
              M GS+                     DG      LS E++    +L       ++  R
Sbjct: 705  MVMTGSQ--------------------FDG------LSEEEVDDLPVL------PLVIAR 732

Query: 1111 VSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIG 1170
             SP  K  +++ +        +  GDG ND   ++ AN+G+ +       +  +SD  + 
Sbjct: 733  CSPQTKVRMIEALHRRKKFCAMT-GDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLS 791

Query: 1171 QFRYLTRLLLV-HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYL- 1228
               + + L  V  G+     + + + Q   +N+   L L    ++ D +G  +F  + + 
Sbjct: 792  DDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVE 851

Query: 1229 TFYNLAFTS-IPVILLGI 1245
              + +  TS  P + LG+
Sbjct: 852  VLWIIVVTSCFPAMGLGL 869

>Kwal_14.1498
          Length = 939

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 36/168 (21%)

Query: 847  LEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHL 906
            + FNS RK M+  VK    +ANGK   ++  KGA   I  +     +N E+ + K   +L
Sbjct: 465  ISFNSKRKFMAVKVK----EANGK--FVVHVKGAYEKILEK-STHFINAENKVVKLDSNL 517

Query: 907  EQ--------YATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIE 958
             Q         A++GLRTL  AQ ELS       N K                K++++  
Sbjct: 518  RQAITDSADALASDGLRTLAFAQLELS-----NGNSK----------------KLTEDDI 556

Query: 959  RHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006
              L   G   + D  +  V  ++  L E  + + ++TGD   TA++I 
Sbjct: 557  NGLTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTAVSIA 604

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 104/432 (24%), Positives = 177/432 (40%), Gaps = 80/432 (18%)

Query: 612  AVILYQSLVPISLYISVEI-IKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEY 670
            AV +  S++P SL + + I +    A+    +V++   KLD           + LG +  
Sbjct: 311  AVCVALSMIPSSLVVVLTITMSVGAAVMASRNVII--RKLDS---------LEALGAVND 359

Query: 671  IFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDR 730
            I SDKTGTLTQ  M  K+  +    +G   T  + G                 E +  ++
Sbjct: 360  ICSDKTGTLTQGKMIAKQIWVP--KFG---TLQVVG---------------SNEPLNPEK 399

Query: 731  EEMINKLQNLAKNSQFY-EDEVTFVSKEFVDDLTGGS--GSVQQKSCQHFM--LALALCH 785
             + IN + NL+     + E E   + + F D   G S  G+ Q +    ++   +LA   
Sbjct: 400  GD-INFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIA 458

Query: 786  SVLTEP-SKE-----DPAKLEIK--AQSPDEAALVTTAR--DMGFSFLKKTKEGMVLEVQ 835
            SV T+P +KE     DP ++ I+  A   D    V T    DM    +  +      +  
Sbjct: 459  SVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDAT 518

Query: 836  GIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGA-DSVI------YSRL 888
                +F+      F+S+ KRMS +      ++       +  KGA +SV+      Y R 
Sbjct: 519  AANAKFRHAAEFPFDSTIKRMSSVY-----ESRDYKTYEIYTKGAFESVLNCCTHWYGRD 573

Query: 889  DKTG-LNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDRE 947
              T  +  ++ ++    +++  ++EGLR L  A +            K D+        E
Sbjct: 574  PNTATVMTDADVDTIKENIDSMSSEGLRVLAFANKSY---------PKSDV-------NE 617

Query: 948  EELEKV---SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAIN 1004
            E+L+K+    D  E  L  LG   I D  ++    ++    +AGI + +LTGD   TA  
Sbjct: 618  EKLQKILKERDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKA 677

Query: 1005 IGFSCNLLNNDM 1016
            I     +L  ++
Sbjct: 678  IAQEVGILPTNL 689

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
            Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 78/173 (45%), Gaps = 39/173 (22%)

Query: 844  LNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGA------DSVIY----SRLDKTGL 893
            +N + FNS RK M+    +   DAN K   ++  KGA       S+ Y     ++ K   
Sbjct: 460  INEIPFNSKRKFMA----VKTIDANDK--VVVYVKGAFEKIVEKSINYIGRDGKVHKLKP 513

Query: 894  NEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKV 953
            N+++++   A+ L   A+EGLRTL  A+ E+S    ++                    + 
Sbjct: 514  NDKAIINDAAVAL---ASEGLRTLAFAELEVSATHGDK--------------------EF 550

Query: 954  SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIG 1006
            ++++   L   G  A+ D  +  V  +I  L +  + + ++TGD   TA++I 
Sbjct: 551  NEDMVEGLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIA 603

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKR 710
           + LG +  I SDKTGTLT N M   K    G    +    AL+ +++R
Sbjct: 355 ETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCLALSKVKER 402

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
            (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 73/177 (41%), Gaps = 27/177 (15%)

Query: 849  FNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYS-----RLDK-TGLNE---ESLL 899
            F+SS KRMS  V I   D N +    +  KGA   +       +LD  TG+     E  L
Sbjct: 531  FDSSIKRMSA-VYINLRDKNTRH---VFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDL 586

Query: 900  EKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
            E    +++  + EGLR L  A + +  EE E                 E L K  D +E 
Sbjct: 587  EIIQKNVDTLSNEGLRVLAFATKTIPAEEAESLG--------------ERLTKDRDFVES 632

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDM 1016
             LI  G   I D  +     ++     AGI + +LTGD   TA  I     +L +++
Sbjct: 633  DLIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNL 689

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
            Ca2+-transporting P-type ATPase of Golgi membrane
            involved in Ca2+ and Mn2+ import into Golgi [2853 bp, 950
            aa]
          Length = 950

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 71/182 (39%), Gaps = 35/182 (19%)

Query: 833  EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIY----SRL 888
            E+  I    Q +  L FNS RK M+  +  P D+     K  +  KGA   I     S L
Sbjct: 461  EMPDIRNTVQKVQELPFNSKRKLMATKILNPVDN-----KCTVYVKGAFERILEYSTSYL 515

Query: 889  DKTGLNEESLLEKTALHLEQ----YATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVV 944
               G   E L E     + +     A+EGLR    A+  LS                   
Sbjct: 516  KSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLS------------------- 556

Query: 945  DREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAIN 1004
               +    +++++ + L   G   + D  +  V  +I  L + G+ + ++TGD   TA+N
Sbjct: 557  ---DSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVN 613

Query: 1005 IG 1006
            I 
Sbjct: 614  IA 615

>Scas_297.1
          Length = 800

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 8/67 (11%)

Query: 1109 CRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIG--VGIAGEE-GRQA---- 1161
             R SP  K  +V+ +K   DV+ +  GDG+ND   ++ A++G  +GI+G E  R+A    
Sbjct: 53   ARSSPEDKRLLVETLKGMGDVVAVT-GDGTNDAPALKLADVGFSMGISGTEVAREASDII 111

Query: 1162 VMSSDYA 1168
            +M+ D+A
Sbjct: 112  LMTDDFA 118

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 5/44 (11%)

Query: 407 NVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETN 450
           N+ VGDI+ +   + IPAD +L+     +G C V+  ++ GE++
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD 653

>Scas_710.41
          Length = 904

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAATRKKKGLD 407

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 404

>Scas_688.1
          Length = 913

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTACLAASRKKKGLD 415

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKK-CTINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 396 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 449

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GVS      T  LA  RK++G+D
Sbjct: 367 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGLD 420

>CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharomyces
            cerevisiae YGL167c PMR1, hypothetical start
          Length = 946

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 118/325 (36%), Gaps = 103/325 (31%)

Query: 847  LEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSR----LDKTGLNEESLLEKT 902
            L FNS RK M+    I     +G+   +L  KGA   I  +    LDK G   E      
Sbjct: 474  LSFNSKRKYMA----IKSSKESGE--HVLYIKGAFERILDKSSYYLDKAGEVREFDEHSK 527

Query: 903  ALHLE---QYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIER 959
             + LE     A++GLRT+  A +    +                         +S++   
Sbjct: 528  VMVLEAAHSCASDGLRTIACAFKPTDSDNV-----------------------ISEDDIN 564

Query: 960  HLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELL 1019
             L   G   + D  +  V  SI  L   G+ + ++TGD V TA++I     L   D E  
Sbjct: 565  GLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESS 624

Query: 1020 VIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIID 1079
            V+  TG  V +L                        +E+EL K              +ID
Sbjct: 625  VM--TGDKVSEL------------------------TEDELSK--------------VID 644

Query: 1080 GEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSN 1139
                                    K  +  R +P  K  +VK ++   D++ +  GDG N
Sbjct: 645  ------------------------KVNIFARATPENKLNIVKALRKRGDIVAMT-GDGVN 679

Query: 1140 DVAMIQSANIGV--GIAGEEGRQAV 1162
            D   ++ A+IG+  GI+G +  + V
Sbjct: 680  DAPALKLADIGIAMGISGTDVAKEV 704

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEADDLMLTACLAASRKKKGLD 401

>Kwal_47.17522
          Length = 899

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSYGR-AYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVEPDDLMLTACLAASRKKKGLD 401

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 663 DDLGQIEYIFSDKTGTLTQNVMEFKKC-TINGVSY-GRAYTEALAGLRKRQGVD 714
           + L  +E + SDKTGTLT+N +   +  T+ GV       T  LA  RK++G+D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLAASRKKKGLD 401

>Scas_707.48*
          Length = 741

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (41%), Gaps = 35/181 (19%)

Query: 833  EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSVIYSR----L 888
            ++  I   F+ +  + FNS RK M+  VKI     N + K  L  KGA   + S+    L
Sbjct: 456  DLSDIRPTFKKVQEIPFNSKRKFMA--VKI----VNSEGKYSLCVKGAFEKVLSQCSHYL 509

Query: 889  DKTGLNEESLLEKTALHLE---QYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAVVD 945
            ++ G  E+    +  + +E     A+EGLR L  A+  L                     
Sbjct: 510  NQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLP-------------------- 549

Query: 946  REEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETAINI 1005
              +    +++E    LI  G   + D  +  V  +I  L + G+ + ++TGD   TA+NI
Sbjct: 550  --DSPTLLTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTAVNI 607

Query: 1006 G 1006
             
Sbjct: 608  A 608

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
            Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 59/146 (40%), Gaps = 34/146 (23%)

Query: 1279 YMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVT---AIACISCNLYILI 1335
            Y + GL ++   FFF Y +     ++ S  L +     V V V+   A A +  NL   +
Sbjct: 468  YFMFGLEKNASKFFFQYAVNLLAQLICS-ALAM-----VSVAVSRDFAKASLVGNLSFTL 521

Query: 1336 QQKHWDVFCSFFVGVSIM---------IFFTWTGIWS--SASRSNEFYHGA--------- 1375
                + + C FFV   +M         I FTW G  S  S + S+ + +G          
Sbjct: 522  ----FSMSCGFFVNAKLMPVYVRWTKYIAFTWYGFGSLLSNTFSDSYCNGGEGFECQGNQ 577

Query: 1376 -ARVFGTPTFWAVLFVGIMFCLLPRF 1400
              R +G P  W  L + I+FC    F
Sbjct: 578  VVRQYGFPLHWRTLPMWILFCWFVGF 603

>KLLA0E18117g join(complement(1608097..1608102), weakly similar to
           sp|Q10167 Schizosaccharomyces pombe hypothetical protein
          Length = 85

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 703 ALAGLRKRQGVDVAHESKIEKEGIKRDR---EEMINKLQNLAKNSQFYEDEVTFVSKEFV 759
            LAGLR+     VA+E    K  IKR     E + +KL N+A+ S ++  +  F   +F+
Sbjct: 19  VLAGLRRSNNYVVAYEMSDLKNYIKRYLDWGEYLFDKLANMAERSAYFRKQTPF--DKFL 76

Query: 760 DDL 762
           D +
Sbjct: 77  DHM 79

>YFL046W (YFL046W) [1638] chr6 (42815..43438) Mitochondrial membrane
           protein of unknown function, has high similarity to
           uncharacterized C. albicans Orf6.4003p [624 bp, 207 aa]
          Length = 207

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 24/117 (20%)

Query: 674 DKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVA--------------HES 719
           D+  T+ + + +  +  +N VS   A  E L  L  +Q VD A              H  
Sbjct: 49  DQATTIVEIMTDAIRGGVNHVSQDLAKREKLTQLSYQQRVDFAKLRDQLLSADRSEFHNI 108

Query: 720 KIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQH 776
           + E E +K D E++ NKL+          +E+T  +  F  DL+   G ++++S  H
Sbjct: 109 QNEYESVKNDLEKLRNKLR----------EEITKTNAGFKLDLSLEKGRIREESSHH 155

>Scas_676.7
          Length = 525

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 475 WIESEGPHANLYSYQGN-FRWNSLEDNQLKNEPVNIN---NLLLRGCTLRNTKWAMGVVA 530
           W E+ G H NL++  G+ FR     ++   N  +N N   + +++ C + ++K  +G+ A
Sbjct: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369

Query: 531 FTGDDTKIMLNAGV 544
           +  +   +    GV
Sbjct: 370 YGREFKHVKSRQGV 383

>Scas_670.31
          Length = 735

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 68  EPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPGKNRESKSGDQIKRLRWGTQRRRKSF 127
           E TP V  SD     D+       P +     +P K+R S++ + + +L+ GT  +R++ 
Sbjct: 179 ENTPTVNTSD-----DETTSFATAPSNQTAMLEPPKSRNSQNEEALIQLKKGTNLQRRAS 233

Query: 128 KRY 130
           KRY
Sbjct: 234 KRY 236

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
            complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 9/82 (10%)

Query: 1363 SSASRSNEFYHGAARVFGTPTFWAVL-----FVGIMFCLLPRFTLDVFKRYFYPKDIDII 1417
            +SA +SN   H   R+F T T W  L     F  +    L RF+ D   R+      D +
Sbjct: 587  ASACKSNNTSHAVVRIFSTHT-WLQLPPCPEFHNLTITRL-RFSKD--NRHLLSVSRDRM 642

Query: 1418 REMWSRGDFDSFPKKYDPTDPE 1439
              +W R D D+F  KY    P 
Sbjct: 643  WAVWYRNDDDTFTLKYSDQKPH 664

>Scas_675.4
          Length = 485

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 51/108 (47%), Gaps = 1/108 (0%)

Query: 744 SQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKA 803
           ++++++ V ++S     +LT     +  ++C + +      HS+L+ P  E    LE  +
Sbjct: 341 AKYHKNLVKYLSVVKPSNLTAIRNLIADENCFNLIKEDITTHSMLSMPYMEQMVLLEKLS 400

Query: 804 QSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIE-KEFQILNILEFN 850
           Q P     +     M  S L +   G V+E + +E +   + N+L+F+
Sbjct: 401 QYPYSVNFMIHCLPMIMSNLIENPNGEVIETETVELRRTTVENLLKFS 448

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 75/172 (43%), Gaps = 33/172 (19%)

Query: 889  DKTGLNEESLLEKTALHLEQYATEG-------LRTLCLAQRELSWEEYERWNKKYDIAAA 941
            DK  LNE  L     LH E+Y TEG       +  L   +RE+  EE ER+NK+ DI+  
Sbjct: 376  DKFKLNENDLKTYNCLH-EKYLTEGGSILEEKIAVLNNDKREI-QEELERFNKRADISKR 433

Query: 942  AVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVET 1001
             +    EEL    ++++  L         + L+  + +  AL  E   +L  L  D +E+
Sbjct: 434  RIT---EELSITGEKLDTQL---------NDLRVSLNEKNALHTERLHELKKLQSD-IES 480

Query: 1002 AINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGM 1053
            A N  +  N          ++ T   ++DL A  +   +T+  + L +   M
Sbjct: 481  ANNQEYDLN--------FKLRETLVKIDDLSANQR---ETMKERKLRENIAM 521

>KLLA0D04092g complement(344666..348124) some similarities with
            sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
            copper-transporting ATPase P16.2.f2.1, hypothetical start
          Length = 1152

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 1107 LCCRVSPAQKAAVVKLVK------NTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQ 1160
            +   V P +KAA VK ++      N    +   +GDG ND   + +A++G+ +A   G +
Sbjct: 972  VIAEVLPEEKAAKVKWIQHNNIGANGHHKVVAMVGDGINDAPALAAADVGIALA--SGSE 1029

Query: 1161 AVMSS 1165
              M+S
Sbjct: 1030 LAMTS 1034

>CAGL0J02816g 272944..274821 highly similar to sp|P40032
           Saccharomyces cerevisiae YER049w, start by similarity
          Length = 625

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 397 EWRF----SKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLD 446
           +WR+     K+  K +K  DI+   NNEE+P   +L  T   DG+  VE K +D
Sbjct: 404 KWRYMYIDGKNPRKLLKASDIMEALNNEELPNFELLRETLPKDGSVDVELKLID 457

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 51,006,597
Number of extensions: 2335546
Number of successful extensions: 7231
Number of sequences better than 10.0: 95
Number of HSP's gapped: 7238
Number of HSP's successfully gapped: 167
Length of query: 1554
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1439
Effective length of database: 12,615,039
Effective search space: 18153041121
Effective search space used: 18153041121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)