Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08063g1491477741e-107
Scas_636.15*1531477091e-97
YDR092W (UBC13)1531476994e-96
KLLA0C17622g1591476831e-93
Sklu_1838.21631396571e-89
AGR121C1541476535e-89
Kwal_56.234821491386473e-88
YDR059C (UBC5)1481453792e-47
AER173C1471423688e-46
KLLA0E12595g1481473671e-45
CAGL0E04752g1471423644e-45
YBR082C (UBC4)1481423601e-44
Scas_635.14*1481423574e-44
Kwal_27.124012361303515e-42
YDR177W (UBC1)2151473174e-37
ADR169C2111473155e-37
Sklu_1817.22151473131e-36
Kwal_23.64852151473061e-35
CAGL0E00671g2131473061e-35
Scas_682.102141473035e-35
KLLA0C18656g2281442966e-34
CAGL0I00352g1671282822e-32
Scas_563.81711282804e-32
AAR156C1701282779e-32
YGL058W (RAD6)1721282771e-31
KLLA0C05632g1641372742e-31
YOR339C (UBC11)1561322715e-31
Kwal_14.18281521162639e-30
Sklu_2299.51541162585e-29
Sklu_2410.41611422552e-28
Kwal_26.70091611372501e-27
KLLA0A11198g2021212521e-27
ABR059W1651512455e-27
AEL045W2111492479e-27
CAGL0M03399g2141212443e-26
CAGL0M07568g1651502403e-26
Kwal_34.161742131202426e-26
YEL012W (UBC8)2181202401e-25
YMR022W (QRI8)1651252352e-25
Scas_694.332311202374e-25
Kwal_26.82241651252317e-25
Scas_709.491651252309e-25
Sklu_2411.72331382271e-23
KLLA0E07711g1651252213e-23
Scas_621.41931132223e-23
CAGL0D06468g187922102e-21
YLR306W (UBC12)1881042083e-21
KLLA0C17248g184912084e-21
AER056C1571222012e-20
CAGL0D00814g1571432012e-20
KLLA0E04983g1571282012e-20
Kwal_23.42271221201973e-20
YDR054C (CDC34)2951092049e-20
Scas_635.182731091985e-19
AGL203C2701091951e-18
Kwal_27.104442781061961e-18
ADL035C200911921e-18
YDL064W (UBC9)1571431872e-18
Sklu_2136.52721061923e-18
CAGL0E04598g2951091933e-18
KLLA0D09196g2921101924e-18
Sklu_1826.31611021864e-18
Kwal_55.212461601011856e-18
KLLA0E20493g2511211741e-15
AFR314W1551071672e-15
CAGL0I10450g1621031664e-15
Scas_718.342581061705e-15
YER100W (UBC6)2501141662e-14
Scas_712.591711001603e-14
AGR372W2421141624e-14
Kwal_27.108372461121616e-14
Scas_599.162241141599e-14
Sklu_2425.62511141563e-13
YGR133W (PEX4)1831361534e-13
CAGL0I05478g2461141539e-13
KLLA0E03916g1581191446e-12
Scas_609.72401141451e-11
Kwal_27.11182101871127e-08
Scas_551.9153871132e-07
KLLA0E19217g139851007e-06
CAGL0H03157g139124991e-05
Scas_720.10*13484981e-05
YGL087C (MMS2)13783982e-05
AFL064W13887937e-05
Kwal_23.4090205035613.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08063g
         (147 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08063g 761662..762111 highly similar to sp|P52490 Saccharo...   302   e-107
Scas_636.15*                                                          277   1e-97
YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599) Ubiqu...   273   4e-96
KLLA0C17622g join(1555873..1555902,1556004..1556453) highly simi...   267   1e-93
Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement        257   1e-89
AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH] (977487..9...   256   5e-89
Kwal_56.23482                                                         253   3e-88
YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..5697...   150   2e-47
AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C (...   146   8e-46
KLLA0E12595g join(1117022..1117068,1117342..1117741) highly simi...   145   1e-45
CAGL0E04752g complement(455965..456408) highly similar to sp|P15...   144   4e-45
YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..4071...   143   1e-44
Scas_635.14*                                                          142   4e-44
Kwal_27.12401                                                         139   5e-42
YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugatin...   126   4e-37
ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH] (1000736.....   125   5e-37
Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement         125   1e-36
Kwal_23.6485                                                          122   1e-35
CAGL0E00671g complement(61460..62101) highly similar to sp|P2173...   122   1e-35
Scas_682.10                                                           121   5e-35
KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces...   118   6e-34
CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomy...   113   2e-32
Scas_563.8                                                            112   4e-32
AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH] (626372..626...   111   9e-32
YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugatin...   111   1e-31
KLLA0C05632g complement(503484..503978) highly similar to sp|P06...   110   2e-31
YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein ...   108   5e-31
Kwal_14.1828                                                          105   9e-30
Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement      103   5e-29
Sklu_2410.4 YOR339C, Contig c2410 15549-16034                         102   2e-28
Kwal_26.7009                                                          100   1e-27
KLLA0A11198g join(complement(974525..974529),complement(973755.....   101   1e-27
ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH] complement(5...    99   5e-27
AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH] complement(...   100   9e-27
CAGL0M03399g complement(389650..390294) highly similar to sp|P28...    99   3e-26
CAGL0M07568g complement(758110..758607) highly similar to sp|Q02...    97   3e-26
Kwal_34.16174                                                          98   6e-26
YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551) Ubiqu...    97   1e-25
YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugati...    95   2e-25
Scas_694.33                                                            96   4e-25
Kwal_26.8224                                                           94   7e-25
Scas_709.49                                                            93   9e-25
Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement       92   1e-23
KLLA0E07711g complement(693694..694191) highly similar to sp|Q02...    90   3e-23
Scas_621.4                                                             90   3e-23
CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces c...    86   2e-21
YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853) Rub...    85   3e-21
KLLA0C17248g complement(1509885..1510439) similar to sp|P52491 S...    85   4e-21
AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH] (741224..74...    82   2e-20
CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomy...    82   2e-20
KLLA0E04983g 443446..443919 highly similar to sp|P50623 Saccharo...    82   2e-20
Kwal_23.4227                                                           80   3e-20
YDR054C (CDC34) [905] chr4 complement(561436..562323) Ubiquitin-...    83   9e-20
Scas_635.18                                                            81   5e-19
AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH] (317749..3...    80   1e-18
Kwal_27.10444                                                          80   1e-18
ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH] (634059..6...    79   1e-18
YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070) Smt3p-...    77   2e-18
Sklu_2136.5 YDR054C, Contig c2136 7737-8555                            79   3e-18
CAGL0E04598g complement(444288..445175) highly similar to sp|P14...    79   3e-18
KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces c...    79   4e-18
Sklu_1826.3 YGR133W, Contig c1826 3548-4033                            76   4e-18
Kwal_55.21246                                                          76   6e-18
KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces...    72   1e-15
AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH] complement(...    69   2e-15
CAGL0I10450g complement(1024541..1025029) similar to sp|P29340 S...    69   4e-15
Scas_718.34                                                            70   5e-15
YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugatin...    69   2e-14
Scas_712.59                                                            66   3e-14
AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH] complement(...    67   4e-14
Kwal_27.10837                                                          67   6e-14
Scas_599.16                                                            66   9e-14
Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement         65   3e-13
YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugatin...    64   4e-13
CAGL0I05478g complement(518933..519673) highly similar to sp|P33...    64   9e-13
KLLA0E03916g complement(365119..365595) similar to sp|P29340 Sac...    60   6e-12
Scas_609.7                                                             60   1e-11
Kwal_27.11182                                                          48   7e-08
Scas_551.9                                                             48   2e-07
KLLA0E19217g join(complement(1703226..1703236), highly similar t...    43   7e-06
CAGL0H03157g join(complement(297881..297891),complement(297272.....    43   1e-05
Scas_720.10*                                                           42   1e-05
YGL087C (MMS2) [1895] chr7 complement(346407..346809,346895..346...    42   2e-05
AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH] complement(...    40   7e-05
Kwal_23.4090                                                           28   3.7  

>CAGL0G08063g 761662..762111 highly similar to sp|P52490
           Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 149

 Score =  302 bits (774), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE
Sbjct: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           LANDVAEDWIKDEAKAKQTAKEWTAQY
Sbjct: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147

>Scas_636.15*
          Length = 153

 Score =  277 bits (709), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 142/147 (96%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           MASLPKRIIKETERL+SDPVPGITAEPHEDNLRYF+VT+EGP+ SPYE GIF+LELYLP+
Sbjct: 1   MASLPKRIIKETERLISDPVPGITAEPHEDNLRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           LANDVAE+WI++EA AK TA+EWT +Y
Sbjct: 121 LANDVAEEWIQNEAGAKATAREWTQKY 147

>YDR092W (UBC13) [944] chr4 (629870..629899,630168..630599)
           Ubiquitin-conjugating (E2) enzyme involved in
           Rad6-dependent post-replicative repair pathway, required
           for non-proteolytic multi-ubiquitination of Pol30p
           (PCNA) [462 bp, 153 aa]
          Length = 153

 Score =  273 bits (699), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 132/147 (89%), Positives = 138/147 (93%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           MASLPKRIIKETE+LVSDPVPGITAEPH+DNLRYF VTIEGP QSPYE GIF+LELYLP+
Sbjct: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           LANDVAEDWIK+E  AK  A+EWT  Y
Sbjct: 121 LANDVAEDWIKNEQGAKAKAREWTKLY 147

>KLLA0C17622g join(1555873..1555902,1556004..1556453) highly similar
           to sp|P52490 Saccharomyces cerevisiae YDR092w UBC13 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 159

 Score =  267 bits (683), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 135/147 (91%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           MA+LPKRIIKETERLVSDPVPGITAEPHEDNLRYF VTIEGP QSPYE G+F+LEL+LP+
Sbjct: 1   MAALPKRIIKETERLVSDPVPGITAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLS+QALLASPNPNDP
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPNDP 120

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           LANDVAE+WIK E  A   AKEWT  Y
Sbjct: 121 LANDVAEEWIKHEDTAIAKAKEWTKLY 147

>Sklu_1838.2 YDR092W, Contig c1838 1546-2037 reverse complement
          Length = 163

 Score =  257 bits (657), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 130/139 (93%)

Query: 9   IKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPK 68
           ++ETERLVSDPVPGI+AEPH+DNLRYF VTIEGP QSPYE G+F+LEL+LPEDYPMEAPK
Sbjct: 19  LQETERLVSDPVPGISAEPHDDNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPK 78

Query: 69  VRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 128
           VRFLTKIYHPNIDRLGRICLDVLK NWSPALQIRTVLLSIQALLASPNPNDPLANDVAED
Sbjct: 79  VRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAED 138

Query: 129 WIKDEAKAKQTAKEWTAQY 147
           WIK+E  A  TAKEWT +Y
Sbjct: 139 WIKNEEGAIATAKEWTEKY 157

>AGR121C [4432] [Homologous to ScYDR092W (UBC13) - SH]
           (977487..977921,977971..978000) [465 bp, 154 aa]
          Length = 154

 Score =  256 bits (653), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 126/147 (85%), Positives = 136/147 (92%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           M  LPKRIIKETERLVSDPVPGI+AEPHEDNLRYFDV+IEGP QSPYE G+F+LEL+LP+
Sbjct: 1   MVPLPKRIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPD 60

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           +YPME PKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLA+PNPNDP
Sbjct: 61  EYPMEPPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPNDP 120

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           LANDVA+DWI DEA A   A+EWTA Y
Sbjct: 121 LANDVAKDWIADEAAATAKAREWTALY 147

>Kwal_56.23482
          Length = 149

 Score =  253 bits (647), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 120/138 (86%), Positives = 128/138 (92%)

Query: 10  KETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKV 69
           +ETERLVSDPVPGITAEPHE+NLRYF VTIEGP QSPYE G+FKLEL+LP+DYPMEAPKV
Sbjct: 10  QETERLVSDPVPGITAEPHEENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKV 69

Query: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW 129
           RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLS+QALLASPNPNDPLANDVAEDW
Sbjct: 70  RFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDW 129

Query: 130 IKDEAKAKQTAKEWTAQY 147
           IK+E  A   A+EWT  Y
Sbjct: 130 IKNEDGAIAKAREWTQLY 147

>YDR059C (UBC5) [910] chr4 complement(569230..569629,569720..569766)
           Ubiquitin-conjugating enzyme that with Ubc4p is
           responsible for most of ubiquitin-dependent protein
           degradation of short-lived and abnormal proteins [447
           bp, 148 aa]
          Length = 148

 Score =  150 bits (379), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 95/145 (65%)

Query: 3   SLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDY 62
           S  KRI KE   L  DP    +A P  D+L ++  +I GPS SPY  G+F L ++ P DY
Sbjct: 2   SSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDY 61

Query: 63  PMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLA 122
           P + PKV F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL 
Sbjct: 62  PFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLV 121

Query: 123 NDVAEDWIKDEAKAKQTAKEWTAQY 147
            ++A+ +  D+AK + TAKEWT +Y
Sbjct: 122 PEIAQIYKTDKAKYEATAKEWTKKY 146

>AER173C [2676] [Homologous to ScYBR082C (UBC4) - SH; ScYDR059C
           (UBC5) - SH] (960420..960863) [444 bp, 147 aa]
          Length = 147

 Score =  146 bits (368), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 72/142 (50%), Positives = 91/142 (64%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KRI KE   L  DP    +A P  D+L ++  +I GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRITKELNDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEDWIKDEAKAKQTAKEWTAQY 147
           A  +  D AK + TAKEWT +Y
Sbjct: 124 AHIYKTDRAKYEATAKEWTKKY 145

>KLLA0E12595g join(1117022..1117068,1117342..1117741) highly similar
           to sp|P15731 Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 148

 Score =  145 bits (367), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 73/147 (49%), Positives = 95/147 (64%), Gaps = 1/147 (0%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           M+SL KRI KE   L  DP    +A P  D++ ++  +I GP  SPY  G+F L ++ P 
Sbjct: 1   MSSL-KRITKELNDLGRDPPTSCSAGPVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           DYP + PK+ F TKIYHPNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DP
Sbjct: 60  DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDP 119

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
           L  ++A  +  D AK + TA+EWT +Y
Sbjct: 120 LVPEIAHLYKTDRAKYEATAREWTKKY 146

>CAGL0E04752g complement(455965..456408) highly similar to sp|P15731
           Saccharomyces cerevisiae YBR082c UBC4 E2
           ubiquitin-conjugating enzyme or sp|P15732 Saccharomyces
           cerevisiae YDR059c UBC5, start by similarity
          Length = 147

 Score =  144 bits (364), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KRI KE   L  DP    +A P  D+L ++  +I GP  SPY  G+F L ++ P DYP +
Sbjct: 4   KRIAKELSDLGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 63

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL  ++
Sbjct: 64  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 123

Query: 126 AEDWIKDEAKAKQTAKEWTAQY 147
           A  +  D AK + TA+EWT +Y
Sbjct: 124 AHIYKTDRAKYEATAREWTKKY 145

>YBR082C (UBC4) [271] chr2 complement(406585..406984,407080..407126)
           Ubiquitin-conjugating (E2) enzyme, together with Ubc5p
           is responsible for the majority of ubiquitin-dependent
           protein degradation of short-lived and abnormal proteins
           [447 bp, 148 aa]
          Length = 148

 Score =  143 bits (360), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 91/142 (64%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KRI KE   L  DP    +A P  D+L ++  +I GP+ SPY  G+F L ++ P DYP +
Sbjct: 5   KRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEDWIKDEAKAKQTAKEWTAQY 147
           A  +  D  K + TA+EWT +Y
Sbjct: 125 AHIYKTDRPKYEATAREWTKKY 146

>Scas_635.14*
          Length = 148

 Score =  142 bits (357), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 90/142 (63%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KRI KE   +  DP    +A P  D+L ++  +I GP  SPY  G+F L ++ P DYP +
Sbjct: 5   KRITKELSDMGRDPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFK 64

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            PK+ F TKIYHPNI+  G ICLD+LK  WSPAL +  VLLSI +LL   NP+DPL  ++
Sbjct: 65  PPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEI 124

Query: 126 AEDWIKDEAKAKQTAKEWTAQY 147
           A  +  D  K + TA+EWT +Y
Sbjct: 125 AHIYKTDRPKYEATAREWTKKY 146

>Kwal_27.12401
          Length = 236

 Score =  139 bits (351), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 85/130 (65%)

Query: 18  DPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYH 77
           DP    +A P  D+L ++  +I GP  SPY  G+F L ++ P DYP + PK+ F TKIYH
Sbjct: 105 DPPTSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYH 164

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAK 137
           PNI+  G ICLD+LK  WSPAL I  VLLSI +LL   NP+DPL  ++A  +  D AK +
Sbjct: 165 PNINANGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTDRAKYE 224

Query: 138 QTAKEWTAQY 147
            TAKEWT +Y
Sbjct: 225 ATAKEWTKKY 234

>YDR177W (UBC1) [1019] chr4 (816872..817519) Ubiquitin conjugating
           enzyme (E2) that plays a role early in spore
           germination, in degradation of mis-folded proteins in
           the ER, and degradation of Gal2p at the plasma membrane
           [648 bp, 215 aa]
          Length = 215

 Score =  126 bits (317), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 93/147 (63%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGITAE-PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KRI+KE + +  DP   IT E   E ++ +   T  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ +++D     +TA  WT  Y
Sbjct: 122 QDAEVAQHYLRDRESFNKTAALWTRLY 148

>ADR169C [1911] [Homologous to ScYDR177W (UBC1) - NSH]
           (1000736..1001371) [636 bp, 211 aa]
          Length = 211

 Score =  125 bits (315), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 93/147 (63%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGIT-AEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KR++KE + +  DP   I+ A   E ++ +   T  GP  +PY  G F +++ +P +
Sbjct: 2   SRAKRLMKEIQSVKDDPDANISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK +WSP L ++T L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ ++ D A   +TA  WT  Y
Sbjct: 122 QDAEVAKHYLSDRASFDRTAALWTKTY 148

>Sklu_1817.2 YDR177W, Contig c1817 904-1551 reverse complement
          Length = 215

 Score =  125 bits (313), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 94/147 (63%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGIT-AEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KRIIKE +    DP   IT +   E ++ +   +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIIKEIQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPLE 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ +I+D++   +TA  WT  Y
Sbjct: 122 QDAEVAQHFIRDKSSFDKTAALWTKLY 148

>Kwal_23.6485
          Length = 215

 Score =  122 bits (306), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 95/147 (64%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGITAE-PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KR++KE + +  DP   +  +  +E+++     +  GP  +PYE G + +++ +P +
Sbjct: 2   SRAKRVMKELQAIKDDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F TK+YHPN+  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFQTKVYHPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ +I+D+A   +TA  WT  Y
Sbjct: 122 QDAEVAQHYIRDKASFDKTAAFWTKTY 148

>CAGL0E00671g complement(61460..62101) highly similar to sp|P21734
           Saccharomyces cerevisiae YDR177w E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 213

 Score =  122 bits (306), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/147 (40%), Positives = 93/147 (63%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGITAE-PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KRI+KE + +  DP   I+ E   E ++ +   +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEANISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + PK++F +K+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPKMKFDSKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ +++D     +TA  WT  Y
Sbjct: 122 QDAEVAQHYLRDRQSFDKTAALWTKLY 148

>Scas_682.10
          Length = 214

 Score =  121 bits (303), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 92/147 (62%), Gaps = 2/147 (1%)

Query: 3   SLPKRIIKETERLVSDPVPGITAE-PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S  KRI+KE + +  DP   I  E  +E ++ +   +  GP  +PYE G F +++ +P +
Sbjct: 2   SRAKRIMKELQAVKDDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPME 61

Query: 62  YPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           YP + P ++F TK+YHPNI  + G ICLD+LK  WSP + +++ L+S+QALL SP PNDP
Sbjct: 62  YPFKPPMMKFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDP 121

Query: 121 LANDVAEDWIKDEAKAKQTAKEWTAQY 147
              +VA+ ++KD     +TA  WT  Y
Sbjct: 122 QDAEVAQHYLKDRESFNKTAALWTKLY 148

>KLLA0C18656g 1654787..1655473 similar to sp|P21734 Saccharomyces
           cerevisiae YDR177w UBC1 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 228

 Score =  118 bits (296), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 92/144 (63%), Gaps = 2/144 (1%)

Query: 6   KRIIKETERLVSDPVPGITAE-PHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KRI+KE + +  DP   I  +  +E ++ +   +  GPS +PYE G F +++ +P +YP 
Sbjct: 5   KRILKEIQAVKEDPEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPY 64

Query: 65  EAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLAN 123
           + P+++F TK+YHPN+  + G ICLD+LK  W+P + +++ L+S+QALL SP PNDP   
Sbjct: 65  KPPQMKFDTKVYHPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPNDPQDA 124

Query: 124 DVAEDWIKDEAKAKQTAKEWTAQY 147
            VA+ ++ D+    +TA  WT  Y
Sbjct: 125 QVAKHYLTDKKSFDETAALWTRTY 148

>CAGL0I00352g 26900..27403 highly similar to sp|P06104 Saccharomyces
           cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating, start
           by similarity
          Length = 167

 Score =  113 bits (282), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           +R++++ +R+  D  PG++A P  DN+  ++  I GP+ +PYE G F+L L   EDYP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKDE 133
           A    KD 
Sbjct: 126 AATLFKDH 133

>Scas_563.8
          Length = 171

 Score =  112 bits (280), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 82/128 (64%), Gaps = 1/128 (0%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           +R++++ +R+  D  PG++A P  DN+  ++  I GP+++PYE G F+L L   E+YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKDE 133
           A    KD 
Sbjct: 126 AATLFKDH 133

>AAR156C [344] [Homologous to ScYGL058W (RAD6) - SH]
           (626372..626884) [513 bp, 170 aa]
          Length = 170

 Score =  111 bits (277), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           +R++++ +R+  D  PG++A P  DN+  ++  I GP+ +PYE G F+L L   E+YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKDE 133
           A    KD 
Sbjct: 126 AATLFKDH 133

>YGL058W (RAD6) [1921] chr7 (393990..394508) Ubiquitin conjugating
           (E2) enzyme involved in error-prone and error-free
           DNA-damage recovery pathways, in the N-end rule protein
           degradation pathway, mediates methylation of histone H3
           lysines 4 and 79 by ubiquitination of histone H2B [519
           bp, 172 aa]
          Length = 172

 Score =  111 bits (277), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           +R++++ +R+  D  PG++A P  DN+  ++  I GP+ +PYE G F+L L   E+YP +
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVE 125

Query: 126 AEDWIKDE 133
           A    KD 
Sbjct: 126 AATLFKDH 133

>KLLA0C05632g complement(503484..503978) highly similar to sp|P06104
           Saccharomyces cerevisiae YGL058w RAD6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 164

 Score =  110 bits (274), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 85/137 (62%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           +R++++ +R+  D  PG++A P  DN+  ++  I GP+ +PYE G F+L L   E+YP +
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNK 66

Query: 66  APKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDV 125
            P V+FL++++HPN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P   + 
Sbjct: 67  PPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEA 126

Query: 126 AEDWIKDEAKAKQTAKE 142
           A  +   +++  +  KE
Sbjct: 127 ATLFQDHKSQYVKRVKE 143

>YOR339C (UBC11) [5118] chr15 complement(958357..958827) Protein
           with similarity to ubiquitin-conjugating enzymes [471
           bp, 156 aa]
          Length = 156

 Score =  108 bits (271), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 77/132 (58%), Gaps = 1/132 (0%)

Query: 2   ASLPKRIIKETERLVSDPVPGITAEPHEDN-LRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
             + KR+  E  +L+S     I+A P +DN L Y+   I GP  +PY    FK+ L  P+
Sbjct: 7   GCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120
           +YP   P ++FL+ ++HPN+D+ G ICLD+LK  WS    + T+LLS+Q+LL  PN   P
Sbjct: 67  NYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSP 126

Query: 121 LANDVAEDWIKD 132
           L    AE W  D
Sbjct: 127 LNAVAAELWDAD 138

>Kwal_14.1828
          Length = 152

 Score =  105 bits (263), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 73/116 (62%), Gaps = 1/116 (0%)

Query: 18  DPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  ++  I GP+++PYE G F+L L   E+YP + P V+FL++I+H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDE 133
           PN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  A    KD 
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVEAATLFKDH 118

>Sklu_2299.5 YGL058W, Contig c2299 10055-10519 reverse complement
          Length = 154

 Score =  103 bits (258), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 18  DPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYH 77
           D  PG++A P  DN+  ++  I GP+ +PYE G F+L L   E+YP + P V+FL++++H
Sbjct: 4   DAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFH 63

Query: 78  PNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDE 133
           PN+   G ICLD+L+  W+P   + ++L SIQ+L   PNP  P AN  A    KD 
Sbjct: 64  PNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP-ANVEAATLFKDH 118

>Sklu_2410.4 YOR339C, Contig c2410 15549-16034
          Length = 161

 Score =  102 bits (255), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 3/142 (2%)

Query: 3   SLPKRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S+ KR+  E  +L+  P PG++A P +ED+L  +   I GP  +PYE   FK+ L  P+ 
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQS 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPL 121
           YP  AP+V F++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPRVTFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEDWIKD--EAKAKQTAK 141
               AE W K+  E K K  A+
Sbjct: 134 NAVAAELWDKNMEEYKRKLMAR 155

>Kwal_26.7009
          Length = 161

 Score =  100 bits (250), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 1/137 (0%)

Query: 3   SLPKRIIKETERLVSDPVPGITAEPH-EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPED 61
           S+ KR+  E  +L+  P PG++A P  ED+L  +   I GP  +PYE   FK+ L   + 
Sbjct: 14  SVTKRLQSELVQLMMSPSPGLSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQT 73

Query: 62  YPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPL 121
           YP  APKVRF++ ++HPN+D  G ICLD+LK  WS    ++T+LLS+Q+LL  PN + PL
Sbjct: 74  YPYTAPKVRFVSPMWHPNVDMSGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPL 133

Query: 122 ANDVAEDWIKDEAKAKQ 138
               AE W  D  + K+
Sbjct: 134 NAVAAELWDTDMQEYKK 150

>KLLA0A11198g
           join(complement(974525..974529),
           complement(973755..974358)) similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 202

 Score =  101 bits (252), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 75/121 (61%), Gaps = 2/121 (1%)

Query: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRL-GRIC 87
           ED ++ F +   GP  +PYEKG+++L + LP++YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQ 146
           LDV+ + WSP   +  ++   I  LL  PN +DPL N+ A   +KD+   +Q   E+  +
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINK 146

Query: 147 Y 147
           Y
Sbjct: 147 Y 147

>ABR059W [650] [Homologous to ScYMR022W (QRI8) - SH]
           complement(503223..503720) [498 bp, 165 aa]
          Length = 165

 Score = 99.0 bits (245), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (50%), Gaps = 14/151 (9%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR++KE ++L+ D   GI A P  EDNL  +D  IEGP+ SPYE G+F   L  P DYP+
Sbjct: 7   KRLMKELQQLLRDSPDGIVAGPVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPN+   G +C+ +L                WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNVYPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEDWIKDEAKAKQTAKE 142
           L+ PN       D    W  + A  ++  +E
Sbjct: 127 LSEPNVESGANIDACILWRDNRADFERQVQE 157

>AEL045W [2461] [Homologous to ScYEL012W (UBC8) - SH]
           complement(549376..549380,549444..550074) [636 bp, 211
           aa]
          Length = 211

 Score = 99.8 bits (247), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 88/149 (59%), Gaps = 5/149 (3%)

Query: 1   MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           M+S  +RI  +  +L+   +     E  +DN++ F V   GP  +PYE+G+++L + LP+
Sbjct: 1   MSSSKRRIETDVMKLL---MSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPD 57

Query: 61  DYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLASPNPN 118
           +YP ++P + F+ KI+HPNID   G ICLDV+ + WSP   +  ++   I  LL  PN +
Sbjct: 58  NYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGS 117

Query: 119 DPLANDVAEDWIKDEAKAKQTAKEWTAQY 147
           DPL N+ A   +K+    ++  +E+  +Y
Sbjct: 118 DPLNNEAATLQLKNPQMYEEKIQEYIDKY 146

>CAGL0M03399g complement(389650..390294) highly similar to sp|P28263
           Saccharomyces cerevisiae YEL012w UBC8 E2
           ubiquitin-conjugating enzyme, hypothetical start
          Length = 214

 Score = 98.6 bits (244), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 76/121 (62%), Gaps = 2/121 (1%)

Query: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRIC 87
           ED+++ F V   GP  +PYE G+++L + LP++YP ++P + F+ KI+HPNID   G IC
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSIC 86

Query: 88  LDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQ 146
           LDV+ + WSP   +  ++   +  LL  PN +DPL N+ A   +KD+   ++  +E+  +
Sbjct: 87  LDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDK 146

Query: 147 Y 147
           Y
Sbjct: 147 Y 147

>CAGL0M07568g complement(758110..758607) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 97.1 bits (240), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 78/150 (52%), Gaps = 14/150 (9%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR+ KE ++L+ D  PGI A P  +DNL  +D  I+GP  +PY  G+F  +L  P+DYP+
Sbjct: 7   KRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
           L+ PN       D    W  + A+ ++  K
Sbjct: 127 LSEPNIESGANIDACILWRDNRAEFEKQVK 156

>Kwal_34.16174
          Length = 213

 Score = 97.8 bits (242), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 75/120 (62%), Gaps = 2/120 (1%)

Query: 30  DNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRL-GRICL 88
           DN++ F V   GP ++PYE G+++L + LP++YP ++P + F+ KI+HPNID   G ICL
Sbjct: 15  DNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICL 74

Query: 89  DVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQY 147
           DV+ + WSP   +  +L   I  LL  PN +DPL N+ A   +K +   ++  +E+  Q+
Sbjct: 75  DVINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATLQLKSKELYERKIREFIDQF 134

>YEL012W (UBC8) [1413] chr5 (131772..131776,131900..132551)
           Ubiquitin-conjugating enzyme involved in the catabolite
           degradation of fructose-1,6-bisphosphate [657 bp, 218
           aa]
          Length = 218

 Score = 97.1 bits (240), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 74/120 (61%), Gaps = 2/120 (1%)

Query: 30  DNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRICL 88
           D+++ F V   GP  +PYE G+++L + LP++YP ++P + F+ KI+HPNID   G ICL
Sbjct: 27  DSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICL 86

Query: 89  DVLKTNWSPALQ-IRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQY 147
           DV+ + WSP    I  V   I  LL  PN +DPL N+ A   ++D+   ++  KE+  +Y
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKY 146

>YMR022W (QRI8) [3986] chr13 (318679..319176) Ubiquitin-conjugating
           enzyme, associates with Ubc6p on the cytoplasmic side of
           endoplasmic reticulum [498 bp, 165 aa]
          Length = 165

 Score = 95.1 bits (235), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 71/125 (56%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR++KE ++L+ D  PGI A P  E+N+  +D  I+GP  +PY  G+F  +L  P+DYP+
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_694.33
          Length = 231

 Score = 95.9 bits (237), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 76/120 (63%), Gaps = 2/120 (1%)

Query: 30  DNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRICL 88
           ++++ F +   GP  +PYEKG+++L + LP++YP ++P + F+ KI+HPNID   G ICL
Sbjct: 50  NSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICL 109

Query: 89  DVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQY 147
           DV+ + WSP   +  ++   I  LL  PN +DPL N+ A   ++D+   ++  +E+  +Y
Sbjct: 110 DVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLELRDKKLYEEKIREYIDKY 169

>Kwal_26.8224
          Length = 165

 Score = 93.6 bits (231), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR+ KE ++L+ D   GI A P  EDNL  +D  I GP  SPY+ G+F   L  P+DYP+
Sbjct: 7   KRLFKELQQLLKDSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  SPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_709.49
          Length = 165

 Score = 93.2 bits (230), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 47/125 (37%), Positives = 70/125 (56%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           +R++KE ++L  D  PGI A P +E+NL  +D  ++GP  + YE GIF   L  P+DYP+
Sbjct: 7   RRLLKELQQLTKDSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   I  +LLS+ ++
Sbjct: 67  SPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSM 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Sklu_2411.7 YMR022W, Contig c2411 14633-15334 reverse complement
          Length = 233

 Score = 92.0 bits (227), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (50%), Gaps = 14/138 (10%)

Query: 6   KRIIKETERLVSDPVPGITAEP-HEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR++KE ++L  D   GI A P  EDNL  +D  I GP  SPYE G+F   L  P+DYP+
Sbjct: 75  KRLLKELQQLARDSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPL 134

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             P++ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 135 SPPRLTFTPSILHPNIYPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSM 194

Query: 112 LASPNPNDPLANDVAEDW 129
           L+ PN       D    W
Sbjct: 195 LSEPNVESGANIDACILW 212

>KLLA0E07711g complement(693694..694191) highly similar to sp|Q02159
           Saccharomyces cerevisiae YMR022w QRI8 E2
           ubiquitin-conjugation enzyme, start by similarity
          Length = 165

 Score = 89.7 bits (221), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 6   KRIIKETERLVSDPVPGITAEPHED-NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           KR++KE E+L  D   GI A P +D NL  +D  I GP  S YE G+F   L  P+DYP+
Sbjct: 7   KRLLKELEKLTKDSPEGILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDYPL 66

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVLKT-------------NWSPALQIRTVLLSIQAL 111
             PK+ F   I HPNI   G +C+ +L +              WSP   +  +LLS+ ++
Sbjct: 67  NPPKLTFQPSILHPNIYPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLSVMSI 126

Query: 112 LASPN 116
           L+ PN
Sbjct: 127 LSEPN 131

>Scas_621.4
          Length = 193

 Score = 90.1 bits (222), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 65/113 (57%), Gaps = 1/113 (0%)

Query: 35  FDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN 94
            DV I  P +  Y+ G F+  L   ++YPME PKV    +IYHPNID  G++CL++L+ +
Sbjct: 71  LDVII-SPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQGKVCLNILRED 129

Query: 95  WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQY 147
           WSPAL ++++++ +  L   PN  DPL  D A  + KD     +  ++    Y
Sbjct: 130 WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFSKDSNAFAKFVRKTMEGY 182

>CAGL0D06468g 615364..615927 similar to sp|P52491 Saccharomyces
           cerevisiae YLR306w UBC12 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 187

 Score = 85.5 bits (210), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%)

Query: 42  PSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P +  Y+ G F+      E YP++ PKV    KI+HPNID  G+ICL++L+ +WSPAL +
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDL 130

Query: 102 RTVLLSIQALLASPNPNDPLANDVAEDWIKDE 133
           + ++L + +L   PN NDPL  + AE   KD+
Sbjct: 131 QCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDK 162

>YLR306W (UBC12) [3694] chr12 (744153..744155,744290..744853)
           Rub1p-conjugating enzyme, with similarity to ubiquitin-
           and ubiquitin-like protein-conjugating enzymes [567 bp,
           188 aa]
          Length = 188

 Score = 84.7 bits (208), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 59/104 (56%)

Query: 38  TIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSP 97
            I  P +  Y  G     L   E YP+E PKV  L KI+HPNID  G +CL++L+ +WSP
Sbjct: 66  VIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSP 125

Query: 98  ALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
           AL +++++  +  L   PNPNDPL  D A+   + E +  +  +
Sbjct: 126 ALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAVR 169

>KLLA0C17248g complement(1509885..1510439) similar to sp|P52491
           Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 184

 Score = 84.7 bits (208), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 57/91 (62%)

Query: 42  PSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P    Y  G +   +++ + YPME P V+ + +IYHPNID  G +CL++L+ +W+PAL I
Sbjct: 67  PDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDI 126

Query: 102 RTVLLSIQALLASPNPNDPLANDVAEDWIKD 132
           +++++ I  L   PN  DPL  D A+  I+D
Sbjct: 127 QSIIIGILFLFHEPNGRDPLNKDAAKTLIED 157

>AER056C [2561] [Homologous to ScYDL064W (UBC9) - SH]
           (741224..741659,741718..741755) [474 bp, 157 aa]
          Length = 157

 Score = 82.0 bits (201), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 7/122 (5%)

Query: 6   KRIIKETERLVSDPVPGITAEP--HED---NLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60
           +R+ +E ++   D   G  A+P   ED   NL+ ++  I G   + ++ G++ + +  P+
Sbjct: 7   QRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPD 66

Query: 61  DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALLASPNPN 118
           DYP + P+V+F    YHPNI   G +CL +L    +W PA+ ++ +LL +Q LL SPNPN
Sbjct: 67  DYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPN 126

Query: 119 DP 120
            P
Sbjct: 127 SP 128

>CAGL0D00814g 98589..99062 highly similar to sp|P50623 Saccharomyces
           cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 157

 Score = 82.0 bits (201), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 80/143 (55%), Gaps = 8/143 (5%)

Query: 1   MASLP-KRIIKETERLVSDPVPGITAEPHED-----NLRYFDVTIEGPSQSPYEKGIFKL 54
           M+SL  +R+ +E ++   D   G  A+P +      NL+ ++  I G   + ++ G+F +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFPI 60

Query: 55  ELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  P++YP + PKV+F    YHPNI   G +CL +L    +W PA+ ++ ++L +Q LL
Sbjct: 61  TVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKDEAK 135
            SPNPN P        + K++A+
Sbjct: 121 DSPNPNSPAQEPAWRAFSKNKAE 143

>KLLA0E04983g 443446..443919 highly similar to sp|P50623
           Saccharomyces cerevisiae YDL064w UBC9 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 157

 Score = 82.0 bits (201), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 74/128 (57%), Gaps = 8/128 (6%)

Query: 1   MASLP-KRIIKETERLVSDPVPGITAEPHED-----NLRYFDVTIEGPSQSPYEKGIFKL 54
           M+SL  +R+ +E ++   D   G  A+P +      NL+ ++  I G   + ++ G++ L
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYPL 60

Query: 55  ELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  P+DYP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ +LL +Q LL
Sbjct: 61  TIEYPDDYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQLLLGVQDLL 120

Query: 113 ASPNPNDP 120
            SPNPN P
Sbjct: 121 DSPNPNSP 128

>Kwal_23.4227
          Length = 122

 Score = 80.5 bits (197), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 68/120 (56%), Gaps = 6/120 (5%)

Query: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDV 90
           NL+ ++  I G   + +++G+F + +  P+DYP + PKV+F    YHPNI   G +CL +
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSI 61

Query: 91  LK--TNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKD----EAKAKQTAKEWT 144
           L    +W PA+ ++ + L +Q LL SPNPN P        + K+    E K  + AK++T
Sbjct: 62  LNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKKYT 121

>YDR054C (CDC34) [905] chr4 complement(561436..562323)
           Ubiquitin-conjugating enzyme (E2); component of the SCF
           (Skp1p-Cdc53p-F-box) complexes which act with various
           F-box proteins to direct target proteins into the
           ubiquitin-dependent degradation pathway [888 bp, 295 aa]
          Length = 295

 Score = 83.2 bits (204), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  PED+P   P+ RF   IYHPN+ R GR+C+ +L  +          
Sbjct: 53  SIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDA 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
             WSP   + +VL+SI +LL  PN N P   D A D+ K+  + KQ  K
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVK 161

>Scas_635.18
          Length = 273

 Score = 80.9 bits (198), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  PED+P   P+ RF   IYHPN+ R GR+C+ +L             
Sbjct: 53  SIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQGGDPMTDEPDA 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
             WSP   + +VL+SI +LL  PN + P   D A D+ K+  + KQ  K
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVK 161

>AGL203C [4109] [Homologous to ScYDR054C (CDC34) - SH]
           (317749..318561) [813 bp, 270 aa]
          Length = 270

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  PED+P   P  RF   IYHPN+ R GR+C+ +L  +          
Sbjct: 53  SIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEPDS 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
             WSP   + +VL+SI +LL  PN + P   D A D+ K+  + KQ  K
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVK 161

>Kwal_27.10444
          Length = 278

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 57/106 (53%), Gaps = 12/106 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  PED+P   P  RF   IYHPN+ R GR+C+ +L T+          
Sbjct: 53  SIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTSGDPTSEEPDS 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQ 138
             WSP   + +VL+SI +LL  PN + P   D A D+ K+  + +Q
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNADQYRQ 158

>ADL035C [1707] [Homologous to ScYLR306W (UBC12) - SH]
           (634059..634610,634663..634713) [603 bp, 200 aa]
          Length = 200

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/91 (40%), Positives = 55/91 (60%)

Query: 42  PSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQI 101
           P +  Y  G F+  +   + YP+E P V+ L  IYHPNID  G ICL+VL+ +WSP + +
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDL 142

Query: 102 RTVLLSIQALLASPNPNDPLANDVAEDWIKD 132
           +TV+L +  L   PN +DPL    A+  ++D
Sbjct: 143 QTVVLGLLFLFLEPNGSDPLNRQAADTMLRD 173

>YDL064W (UBC9) [802] chr4 (337487..337524,337635..338070)
           Smt3p-conjugating enzyme required for G2/M transition,
           conjugates Smt3p to Pol30p (PCNA) in S phase, which may
           be antagonistic to non-proteolytic ubiquitination of
           Pol30p in the Rad6-dependent DNA repair pathway [474 bp,
           157 aa]
          Length = 157

 Score = 76.6 bits (187), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 78/143 (54%), Gaps = 8/143 (5%)

Query: 1   MASLP-KRIIKETERLVSDPVPGITAEPHED-----NLRYFDVTIEGPSQSPYEKGIFKL 54
           M+SL  +R+ +E ++   D   G  A+P +      +L+ ++  I G   + +  G++ +
Sbjct: 1   MSSLCLQRLQEERKKWRKDHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPI 60

Query: 55  ELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLK--TNWSPALQIRTVLLSIQALL 112
            +  P +YP + PKV+F    YHPN+   G ICL +L    +W PA+ ++ ++L +Q LL
Sbjct: 61  TVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLL 120

Query: 113 ASPNPNDPLANDVAEDWIKDEAK 135
            SPNPN P        + +++A+
Sbjct: 121 DSPNPNSPAQEPAWRSFSRNKAE 143

>Sklu_2136.5 YDR054C, Contig c2136 7737-8555
          Length = 272

 Score = 78.6 bits (192), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 56/106 (52%), Gaps = 12/106 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  PED+P   P  RF   IYHPN+ R GR+C+ +L  +          
Sbjct: 53  SIYHGGYFKAQMKFPEDFPFSPPNFRFTPAIYHPNVYRDGRLCISILHQSGDPTSDEPDS 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQ 138
             WSP   + +VL+SI +LL  PN + P   D A D+ K+  + KQ
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQ 158

>CAGL0E04598g complement(444288..445175) highly similar to sp|P14682
           Saccharomyces cerevisiae YDR054c CDC34 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 295

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G FK ++  P+D+P   P+ RF   IYHPN+ R GR+C+ +L  +          
Sbjct: 53  SIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDA 112

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
             WSP   + +VL+SI +LL  PN + P   D A D+ K+  + KQ  K
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKNPEQYKQRVK 161

>KLLA0D09196g 772795..773673 similar to sp|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating
           enzyme, start by similarity
          Length = 292

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (52%), Gaps = 12/110 (10%)

Query: 44  QSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN--------- 94
           +S Y  G FK ++  P+D+P   P  RF   IYHPN+ R GR+C+ +L  +         
Sbjct: 51  ESIYHGGYFKAQMKFPDDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHQSGNPTSDEPD 110

Query: 95  ---WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
              WSP   + +VL+SI +LL  PN + P   D A D+ K+  + KQ  K
Sbjct: 111 EETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYKKNPDQYKQKVK 160

>Sklu_1826.3 YGR133W, Contig c1826 3548-4033
          Length = 161

 Score = 76.3 bits (186), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFL----TKIYHPNID-RLGR 85
           N+ ++   I GP ++PY   +F L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95

Query: 86  ICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137

>Kwal_55.21246
          Length = 160

 Score = 75.9 bits (185), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 3/101 (2%)

Query: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIY-HPNID-RLGRI 86
           +DNL  ++  I GPS +PY+   F L + +P  YP+E PKV+F  +   H N+D   GRI
Sbjct: 33  DDNLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRI 92

Query: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
           C+++L + +WSPA  +  ++ +I  LLA+P P+ PL  D+A
Sbjct: 93  CINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPLDVDLA 133

>KLLA0E20493g 1814618..1815373 similar to sp|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme,
           start by similarity
          Length = 251

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 62/121 (51%), Gaps = 11/121 (9%)

Query: 1   MASLP--KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYL 58
           MAS+   KR+ KE + +V++P P I A PHEDN+  +   I GP  +PYE G +   L  
Sbjct: 1   MASIQANKRLTKEYKNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQYHGTLTF 60

Query: 59  PEDYPMEAPKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLA 113
           P DYP   P +R +T    PN       R+CL   D     W+PA  + T+L  + + + 
Sbjct: 61  PSDYPFNPPAIRMIT----PNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116

Query: 114 S 114
            
Sbjct: 117 G 117

>AFR314W [3506] [Homologous to ScYGR133W (PEX4) - SH]
           complement(1006421..1006888) [468 bp, 155 aa]
          Length = 155

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 3/107 (2%)

Query: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRF-LTKIYHPNID-RLGRICL 88
           +L  ++   +GP  +PY    F L + +PE YP E PK  F    I HPNI    G +CL
Sbjct: 33  DLHRWEAHFQGPENTPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCL 92

Query: 89  DVLKTN-WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEA 134
           D+LK   WSP   +  V+ +I  LLA P  + PL  D++  +  D A
Sbjct: 93  DLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRA 139

>CAGL0I10450g complement(1024541..1025029) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w ubiquitin-conjugating
           enzyme - peroxin, hypothetical start
          Length = 162

 Score = 68.6 bits (166), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 10/103 (9%)

Query: 33  RYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIY-------HPNID-RLG 84
           R+F V I+GP+++PY    FKL + +P  YPM  P ++F++          H N+D R G
Sbjct: 36  RWFAV-IKGPAETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTG 94

Query: 85  RICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126
            ICLD+LK   WSP   I  V+ +I  LL  P P+ PL  D+A
Sbjct: 95  EICLDILKPEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMA 137

>Scas_718.34
          Length = 258

 Score = 70.1 bits (170), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 12/106 (11%)

Query: 45  SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTN---------- 94
           S Y  G F+ ++  P+D+P   P+ +F+  IYHPN+ R G++C+ +L  +          
Sbjct: 60  SIYHGGYFQSQMKFPKDFPFSPPQFKFIPPIYHPNVYRDGKLCISILHQSGDAMTSEPDN 119

Query: 95  --WSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQ 138
             WSP   + +VL+SI +LL  PN + P   D A ++ K+  + K+
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKNYNEYKK 165

>YER100W (UBC6) [1532] chr5 (359558..360310) Ubiquitin-conjugating
           enzyme, anchored in the ER membrane with the
           catalytically active domain in cytoplasm [753 bp, 250
           aa]
          Length = 250

 Score = 68.6 bits (166), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + +V +P P I A P+EDN+  +   I GP+ +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLT--KIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    + PN     R+CL   D     W+P   + T+L  + + + S
Sbjct: 68  PPAIRMITPNGRFKPNT----RLCLSMSDYHPDTWNPGWSVSTILNGLLSFMTS 117

>Scas_712.59
          Length = 171

 Score = 66.2 bits (160), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88
           +L ++   I+GP  +PY    F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103

Query: 89  DVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A 
Sbjct: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143

>AGR372W [4683] [Homologous to ScYER100W (UBC6) - SH]
           complement(1419828..1420556) [729 bp, 242 aa]
          Length = 242

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + +  +P P I A P EDN+  +   I GP ++PYE G +   L  P DYP  
Sbjct: 8   KRLSKEYKMMTENPPPYIVAAPKEDNILVWHYVITGPPETPYEDGQYHGTLVFPNDYPFN 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R LT    PN       R+CL   D     W+P+  + T+L  + + + +
Sbjct: 68  PPAIRMLT----PNGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTT 117

>Kwal_27.10837
          Length = 246

 Score = 66.6 bits (161), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + +V +P P I A+P+EDN+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQYHGTLVFPSDYPFK 67

Query: 66  APKVRFLTKIYHPNIDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T       D   R+CL   D     W+P+  + T+L  + + + S
Sbjct: 68  PPAIRMVTPSGRFKED--TRLCLSMSDYHPDTWNPSWSVSTILTGLLSFMTS 117

>Scas_599.16
          Length = 224

 Score = 65.9 bits (159), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + +V +P+P I A P+EDN+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 110 KRLTKEYKLMVENPLPYILARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPSDYPYK 169

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + +L+  
Sbjct: 170 PPAIRMIT----PNGRFKDNTRLCLSMSDYHPDLWNPGWSVNTILNGLLSLMTG 219

>Sklu_2425.6 YER100W, Contig c2425 8506-9261 reverse complement
          Length = 251

 Score = 64.7 bits (156), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + ++ +P   I A+P+EDN+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLTKEYKAIIENPPQFINAQPNEDNILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+C+   D     W+PA  + T+L+ + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSFMTG 117

>YGR133W (PEX4) [2090] chr7 (756899..757450) Ubiquitin-conjugating
           enzyme and peroxisomal biogenesis protein (peroxin) [552
           bp, 183 aa]
          Length = 183

 Score = 63.5 bits (153), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 6   KRIIKETERL---------VSDPVPGITAEPH---EDNLRYFDVTIEGPSQSPYEKGIFK 53
            RI+KE + +         +++P  GI    +   E +L  ++  I GPS +PYE   F+
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 54  LELYLPEDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 111 LLASPNPNDPLANDVA 126
           LL  P  + PL  D+ 
Sbjct: 140 LLREPVCDSPLDVDIG 155

>CAGL0I05478g complement(518933..519673) highly similar to sp|P33296
           Saccharomyces cerevisiae YER100w UBC6 E2
           ubiquitin-conjugating enzyme, start by similarity
          Length = 246

 Score = 63.5 bits (153), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + +V +P P I A P+E+N+  +   I GP  +PY+ G +   L  P DYP +
Sbjct: 8   KRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGPPDTPYDGGQYHGTLTFPSDYPYK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICL---DVLKTNWSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL   D     W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

>KLLA0E03916g complement(365119..365595) similar to sp|P29340
           Saccharomyces cerevisiae YGR133w PAS2 E2
           ubiquitin-conjugating enzyme - peroxin, start by
           similarity
          Length = 158

 Score = 60.1 bits (144), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 8/119 (6%)

Query: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLP---EDYPMEA-PKVRFLTK-IYHPNID-R 82
           +D+L  +    +GPS+SP+E   F+L L +    E YP+   P+V F  + + HPN+   
Sbjct: 31  DDDLSEWVCRFQGPSESPFEG--FELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWD 88

Query: 83  LGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141
            G ICLD+LK  W+P   +  V+ +I+ LLA P  + PL  D+A+ +  D     Q  +
Sbjct: 89  TGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147

>Scas_609.7
          Length = 240

 Score = 60.5 bits (145), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 6   KRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPME 65
           KR+ KE + ++ +P P I A P+E+N+  +   I GP  +PY  G +   L  P DYP +
Sbjct: 8   KRLSKEYKLIIENPTPYILARPNENNILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFK 67

Query: 66  APKVRFLTKIYHPN--IDRLGRICLDVLKTN---WSPALQIRTVLLSIQALLAS 114
            P +R +T    PN       R+CL +   +   W+P   + T+L  + + +  
Sbjct: 68  PPAIRMIT----PNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSFMTG 117

>Kwal_27.11182
          Length = 101

 Score = 47.8 bits (112), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 32  LRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDR-LGRICLDV 90
           + Y++ TI GP  S +E  I+ + L     YP E PK++F++KI  P +++  G +  D 
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPCVNQTTGEVKRDQ 60

Query: 91  LKT--NWSPALQIRTVLLSIQALLASP 115
             T  +W  +  + T+LL ++  +A P
Sbjct: 61  FSTLRDWKRSYNMETLLLDLRKEMALP 87

>Scas_551.9
          Length = 153

 Score = 48.1 bits (113), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 10  KETERLVSDPVPGITAEP--HED---NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPM 64
           K  ++   D   G  A+P  H D   NL+ ++  I G   + + +G++ + +  P +YP 
Sbjct: 65  KNRKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPS 124

Query: 65  EAPKVRFLTKIYHPNIDRLGRICLDVL 91
           + PKV+     YHPN+   G ICL +L
Sbjct: 125 KPPKVKLPANFYHPNVYPSGTICLSIL 151

>KLLA0E19217g join(complement(1703226..1703236), highly similar to
           sp|P53152 Saccharomyces cerevisiae YGL087c MMS2 part of
           the error-free postreplication repair pathway singleton,
           start by similarity
          Length = 139

 Score = 43.1 bits (100), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 35  FDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT 93
           ++ TI GP  S +E  I+ + +     YP E PKV+F++KI  P ++   G +  +   T
Sbjct: 41  WNGTILGPPHSNHENRIYSVLIECGPSYPDEPPKVKFVSKINLPCVNSTTGEVVKEKFHT 100

Query: 94  --NWSPALQIRTVLLSIQALLASPN 116
              W  +  + TVLL ++  +A+P+
Sbjct: 101 LKEWKRSYTMETVLLELRKEMATPS 125

>CAGL0H03157g
           join(complement(297881..297891),
           complement(297272..297680)) highly similar to sp|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 1   MASLPK--RIIKETER----LVSDPVPGITAEPHEDNLRYFDVTIEGPSQSPYEKGIFKL 54
           M+ +P+  R+++E E+    L  +      A+  +  +  ++ TI GP  S +E  I+ +
Sbjct: 1   MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSV 60

Query: 55  ELYLPEDYPMEAPKVRFLTKIYHPNIDR-LGRICLDVLKT--NWSPALQIRTVLLSIQAL 111
            +     YP E P + F++KI  P +D+  G +  +   T  +W     + T+LL ++  
Sbjct: 61  SIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKE 120

Query: 112 LASP 115
           +ASP
Sbjct: 121 MASP 124

>Scas_720.10*
          Length = 134

 Score = 42.4 bits (98), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 35  FDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLKT 93
           ++ TI GP  S +E  I+ + ++    YP   P ++F++KI  P +D + G +      T
Sbjct: 37  WNGTILGPPHSNHENRIYSVAIHCGPHYPDAPPTIKFVSKINLPCVDEKTGEVKQASFHT 96

Query: 94  --NWSPALQIRTVLLSIQALLASP 115
             +W  +  + T+LL ++  +ASP
Sbjct: 97  LRDWKRSYTMETLLLDLRKEMASP 120

>YGL087C (MMS2) [1895] chr7
           complement(346407..346809,346895..346905)
           Ubiquitin-conjugating enzyme variant (UEV) protein
           required for resistance to DNA damaging agents and
           non-proteolytic multi-ubiquitination of Pol30p (PCNA)
           [414 bp, 137 aa]
          Length = 137

 Score = 42.4 bits (98), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 35  FDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRICLDVLK- 92
           ++ TI GP  S +E  I+ L +    +YP   PKV F++KI  P ++   G +  D    
Sbjct: 41  WNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTL 100

Query: 93  TNWSPALQIRTVLLSIQALLASP 115
            +W  A  + T+LL ++  +A+P
Sbjct: 101 RDWKRAYTMETLLLDLRKEMATP 123

>AFL064W [3129] [Homologous to ScYGL087C (MMS2) - SH]
           complement(314210..314220,314273..314678) [417 bp, 138
           aa]
          Length = 138

 Score = 40.4 bits (93), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNID-RLGRICLD 89
           ++ +++ TI GP  S +E  I+ + +    +YP   PKVRF+++I  P +D   G +  +
Sbjct: 37  SMTHWNGTILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPE 96

Query: 90  VLKT--NWSPALQIRTVLLSIQALLAS 114
                 +W  +  + T+L  ++  +AS
Sbjct: 97  AFHALRDWKRSSNMETLLQDLRKEMAS 123

>Kwal_23.4090
          Length = 2050

 Score = 28.1 bits (61), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 4    LPKRIIKET---ERLVSDPVPGITAEPHEDNLRYF 35
            L K IIKE    +RL+   +P +TA+P E    YF
Sbjct: 1992 LKKNIIKENVKADRLIGKYIPNLTAKPFEITKEYF 2026

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,021,918
Number of extensions: 201461
Number of successful extensions: 637
Number of sequences better than 10.0: 91
Number of HSP's gapped: 578
Number of HSP's successfully gapped: 91
Length of query: 147
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 55
Effective length of database: 13,411,253
Effective search space: 737618915
Effective search space used: 737618915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)