Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08041g60759831110.0
Scas_636.1460859928350.0
YDR091C60859928280.0
KLLA0C17556g60759828170.0
AGR125W60759828030.0
Kwal_56.2342953953925010.0
YPL226W (NEW1)11963211453e-09
Scas_618.37931901418e-09
AEL032W7531891401e-08
Kwal_0.32710191831372e-08
Sklu_2403.511793081373e-08
CAGL0D03674g11863081337e-08
YNL014W (HEF3)10443031337e-08
Kwal_0.16710442971338e-08
Scas_720.3611903211338e-08
Sklu_2187.27521891321e-07
KLLA0C16115g11833111312e-07
Scas_703.1710463061302e-07
Kwal_33.1556112971981292e-07
Sklu_2442.2010443071283e-07
Kwal_27.1271112462071283e-07
YFR009W (GCN20)7521811273e-07
Kwal_34.162407521881274e-07
CAGL0M13739g7271651274e-07
AGR047W14921841257e-07
KLLA0A10857g7521911248e-07
Kwal_33.156235621961231e-06
Scas_288.14942141221e-06
CAGL0B03487g10453011222e-06
Scas_716.8115651991222e-06
AFR432W12842111203e-06
YMR301C (ATM1)6901561193e-06
CAGL0E00385g6082191175e-06
AAL028W10443051185e-06
Scas_574.87022101176e-06
Scas_566.14662241166e-06
CAGL0I08019g12852211176e-06
KLLA0C04477g12532151176e-06
CAGL0K10472g7521811167e-06
YLR249W (YEF3)10442031168e-06
YKL209C (STE6)12901551151e-05
KLLA0A01452g6071821141e-05
KLLA0F12210g10442981141e-05
KLLA0D04554g10221981141e-05
KLLA0D03432g14832141142e-05
AER190W10111841132e-05
CAGL0K00363g12271751122e-05
Scas_628.1310601851123e-05
YOL075C12941611104e-05
AFL131W11893181095e-05
Scas_712.296101891086e-05
Scas_108.13351311067e-05
Scas_573.11689801078e-05
CAGL0L07744g10551651061e-04
AFR232C6071791061e-04
Sklu_2152.56081921042e-04
Kwal_26.94807191961032e-04
YER036C6101791032e-04
YDR011W (SNQ2)15012131043e-04
Scas_710.506021981033e-04
CAGL0I04862g15072161033e-04
CAGL0E03355g15351821033e-04
KLLA0A10131g7201651023e-04
Kwal_47.191166071661023e-04
Scas_695.2412881711024e-04
CAGL0C02343g6101951015e-04
KLLA0F08833g273216986e-04
YCR011C (ADP1)1049219999e-04
ABR125C1488217990.001
KLLA0D02156g52184980.001
KLLA0C14234g1454251970.002
AGL335W691164960.002
CAGL0L06402g1535158960.002
Scas_40.1203176920.002
Scas_468.169177950.002
YLL015W (BPT1)1559179950.002
YLR188W (MDL1)695227950.003
AFR683C677201950.003
Sklu_2316.11310173950.003
Kwal_56.227471538224930.004
KLLA0B14256g1271119930.004
Scas_643.11289177930.005
Scas_693.421512153920.006
ABR126W1512213920.007
Kwal_23.51611489166920.007
Kwal_14.2052523224900.008
Kwal_56.238441494129900.009
YGR281W (YOR1)1477225900.010
ACR022W75483890.012
CAGL0M07293g1515218890.013
Sklu_2343.377466890.014
KLLA0C01991g706202880.017
YPL270W (MDL2)77365880.018
YDR135C (YCF1)1515179880.019
KLLA0F14575g85184870.020
KLLA0A00286g1280109870.020
Scas_622.91657216870.024
KLLA0D00748g78965860.027
KLLA0F20075g1516137860.028
CAGL0A01133g80165860.032
Kwal_14.2435124783860.032
KLLA0D04059g1568152850.039
Scas_711.39122782840.049
YNR070W1333176840.051
Sklu_1870.3265217820.054
AGL142C1497199840.054
Kwal_56.2232977664830.057
KLLA0E00462g1650208840.059
YPL058C (PDR12)1511186830.066
AGL346W1400204820.099
CAGL0M01760g1499177810.13
Scas_714.421520177800.14
KLLA0B09702g1518171800.15
Scas_567.1810183800.15
YJL074C (SMC3)1230114800.16
YIL013C (PDR11)1411173790.20
AAL182W123182790.21
CAGL0G05093g54472780.22
Kwal_27.96661474164790.22
YLL048C (YBT1)1661207790.23
Scas_627.1853371780.25
CAGL0F01419g1398159780.26
Scas_472.1*39387770.30
Scas_717.6*1400180770.33
Scas_707.8294167760.33
YDR406W (PDR15)1529177770.36
Scas_612.11*1506153770.39
CAGL0H02805g1219112760.43
Scas_586.31531171760.44
KLLA0F21692g1525228760.51
YOR011W (AUS1)1394181760.52
Scas_455.1925199750.55
Scas_552.4720196750.56
CAGL0G00242g147766750.56
YOR328W (PDR10)1564209750.58
Scas_587.8715185740.67
KLLA0E19074g32679730.72
Scas_716.82675155740.80
Scas_469.160944730.97
YOR153W (PDR5)1511177721.3
CAGL0H03091g33439711.4
CAGL0F02717g1542177721.5
YHL035C1592197721.5
CAGL0C03289g1648211721.6
Kwal_14.124226920701.7
YGL091C (NBP35)32881701.9
YFL028C (CAF16)28920692.0
AFR152C27020692.1
YER013W (PRP22)1145136702.2
CAGL0K12474g294162692.2
Kwal_34.157701436164702.5
Sklu_2062.232854682.8
Kwal_27.1114732341683.1
YGL120C (PRP43)76761683.5
CAGL0K06281g18545663.7
CAGL0M02387g856177683.9
Kwal_23.404576152683.9
Kwal_26.9532147134684.5
CAGL0F07139g76844674.6
Kwal_26.8730831178674.6
Kwal_56.23638492225684.8
Kwal_14.172477044675.2
Scas_717.5818633655.4
Kwal_33.1330870672665.7
Scas_720.733239666.0
Sklu_1859.282445666.3
CAGL0D05258g117073666.5
YPL147W (PXA1)870119667.4
YKR104W (NFT1)306239657.4
AAR180C76645667.5
CAGL0B00418g74358658.4
Scas_713.334934174659.0
KLLA0B00561g76739659.2
Sklu_2035.347470649.3
YLR106C (MDN1)491044659.3
Scas_167.1*2791466410.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08041g
         (598 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...  1202   0.0  
Scas_636.14                                                          1096   0.0  
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...  1093   0.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...  1089   0.0  
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...  1084   0.0  
Kwal_56.23429                                                         967   0.0  
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    60   3e-09
Scas_618.3                                                             59   8e-09
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    59   1e-08
Kwal_0.327                                                             57   2e-08
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       57   3e-08
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    56   7e-08
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    56   7e-08
Kwal_0.167                                                             56   8e-08
Scas_720.36                                                            56   8e-08
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         55   1e-07
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    55   2e-07
Scas_703.17                                                            55   2e-07
Kwal_33.15561                                                          54   2e-07
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      54   3e-07
Kwal_27.12711                                                          54   3e-07
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    54   3e-07
Kwal_34.16240                                                          54   4e-07
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    54   4e-07
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    53   7e-07
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    52   8e-07
Kwal_33.15623                                                          52   1e-06
Scas_288.1                                                             52   1e-06
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    52   2e-06
Scas_716.81                                                            52   2e-06
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    51   3e-06
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    50   3e-06
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    50   5e-06
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    50   5e-06
Scas_574.8                                                             50   6e-06
Scas_566.1                                                             49   6e-06
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    50   6e-06
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    50   6e-06
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    49   7e-06
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    49   8e-06
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    49   1e-05
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    49   1e-05
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    49   1e-05
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    49   1e-05
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    49   2e-05
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    48   2e-05
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    48   2e-05
Scas_628.13                                                            48   3e-05
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    47   4e-05
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    47   5e-05
Scas_712.29                                                            46   6e-05
Scas_108.1                                                             45   7e-05
Scas_573.11                                                            46   8e-05
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    45   1e-04
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    45   1e-04
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         45   2e-04
Kwal_26.9480                                                           44   2e-04
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    44   2e-04
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    45   3e-04
Scas_710.50                                                            44   3e-04
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    44   3e-04
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    44   3e-04
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    44   3e-04
Kwal_47.19116                                                          44   3e-04
Scas_695.24                                                            44   4e-04
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    44   5e-04
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    42   6e-04
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    43   9e-04
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    43   0.001
KLLA0D02156g complement(184520..186085) similar to sgd|S0002468 ...    42   0.001
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    42   0.002
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    42   0.002
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    42   0.002
Scas_40.1                                                              40   0.002
Scas_468.1                                                             41   0.002
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    41   0.002
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    41   0.003
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    41   0.003
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           41   0.003
Kwal_56.22747                                                          40   0.004
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    40   0.004
Scas_643.1                                                             40   0.005
Scas_693.42                                                            40   0.006
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    40   0.007
Kwal_23.5161                                                           40   0.007
Kwal_14.2052                                                           39   0.008
Kwal_56.23844                                                          39   0.009
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    39   0.010
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    39   0.012
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    39   0.013
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            39   0.014
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    39   0.017
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    39   0.018
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    39   0.019
KLLA0F14575g complement(1351796..1354351) some similarities with...    38   0.020
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    38   0.020
Scas_622.9                                                             38   0.024
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    38   0.027
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    38   0.028
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    38   0.032
Kwal_14.2435                                                           38   0.032
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    37   0.039
Scas_711.39                                                            37   0.049
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    37   0.051
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            36   0.054
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    37   0.054
Kwal_56.22329                                                          37   0.057
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    37   0.059
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    37   0.066
AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH] complement(...    36   0.099
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    36   0.13 
Scas_714.42                                                            35   0.14 
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    35   0.15 
Scas_567.1                                                             35   0.15 
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    35   0.16 
YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane ...    35   0.20 
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    35   0.21 
CAGL0G05093g complement(483230..484864) similar to sp|Q12298 Sac...    35   0.22 
Kwal_27.9666                                                           35   0.22 
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    35   0.23 
Scas_627.18                                                            35   0.25 
CAGL0F01419g complement(142623..146819) highly similar to tr|Q08...    35   0.26 
Scas_472.1*                                                            34   0.30 
Scas_717.6*                                                            34   0.33 
Scas_707.8                                                             34   0.33 
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...    34   0.36 
Scas_612.11*                                                           34   0.39 
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    34   0.43 
Scas_586.3                                                             34   0.44 
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    34   0.51 
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    34   0.52 
Scas_455.1                                                             33   0.55 
Scas_552.4                                                             33   0.56 
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    33   0.56 
YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...    33   0.58 
Scas_587.8                                                             33   0.67 
KLLA0E19074g complement(1691643..1692623) highly similar to sp|P...    33   0.72 
Scas_716.82                                                            33   0.80 
Scas_469.1                                                             33   0.97 
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    32   1.3  
CAGL0H03091g complement(292976..293980) highly similar to sp|P52...    32   1.4  
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    32   1.5  
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    32   1.5  
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    32   1.6  
Kwal_14.1242                                                           32   1.7  
YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative ...    32   1.9  
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    31   2.0  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   2.1  
YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing f...    32   2.2  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    31   2.2  
Kwal_34.15770                                                          32   2.5  
Sklu_2062.2 YGL091C, Contig c2062 3197-4183                            31   2.8  
Kwal_27.11147                                                          31   3.1  
YGL120C (PRP43) [1866] chr7 complement(281638..283941) Pre-mRNA ...    31   3.5  
CAGL0K06281g complement(608987..609544) highly similar to sp|P15...    30   3.7  
CAGL0M02387g 280372..282942 similar to sp|P41909 Saccharomyces c...    31   3.9  
Kwal_23.4045                                                           31   3.9  
Kwal_26.9532                                                           31   4.5  
CAGL0F07139g complement(698363..700669) highly similar to sp|P53...    30   4.6  
Kwal_26.8730                                                           30   4.6  
Kwal_56.23638                                                          31   4.8  
Kwal_14.1724                                                           30   5.2  
Scas_717.58                                                            30   5.4  
Kwal_33.13308                                                          30   5.7  
Scas_720.7                                                             30   6.0  
Sklu_1859.2 YDL148C, Contig c1859 1033-3507 reverse complement         30   6.3  
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    30   6.5  
YPL147W (PXA1) [5300] chr16 (273254..275866) Protein required fo...    30   7.4  
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    30   7.4  
AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH] (665711..66...    30   7.5  
CAGL0B00418g 26584..28815 similar to sp|P25375 Saccharomyces cer...    30   8.4  
Scas_713.33                                                            30   9.0  
KLLA0B00561g 42284..44587 highly similar to sp|P53131 Saccharomy...    30   9.2  
Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement         29   9.3  
YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear p...    30   9.3  
Scas_167.1*                                                            29   10.0 

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 1202 bits (3111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/598 (97%), Positives = 586/598 (97%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFR            TRAYSYPDMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIVDATRAYSYPDMKR 360

Query: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420
           TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT
Sbjct: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420

Query: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480
           IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS
Sbjct: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480

Query: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598
           DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN
Sbjct: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598

>Scas_636.14
          Length = 608

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/599 (88%), Positives = 559/599 (93%), Gaps = 1/599 (0%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MS+K SRIA+V+ADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISE+LCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAITIINLPTNLE HVTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED+IKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGPVQKVGELLKLRMEK  +TVK YIKTLQL+H+LNREIG LSGGELQRFAI +SCVQDA
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIR LL P+KYVIAVEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFR             + + YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360

Query: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTS-VPKLNVSMKPQ 419
           TQGDF+L V+SG+FSDSEILVMMGENGTGKTTLIKLLAG I +D+ +  V KLNVSMKPQ
Sbjct: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420

Query: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479
           TIAPKFPGTVRQLFFKKIR QFL+PQFQTDVVKPLKIDDIIDQEV+HLSGGELQRVAIVL
Sbjct: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           +LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540

Query: 540 FDGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598
           F+GTPS++  A APESLLTGCNRFLKNLNVTFRRD  SFRPRINKLDSQMD+EQKLSGN
Sbjct: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLSGN 599

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/599 (88%), Positives = 559/599 (93%), Gaps = 1/599 (0%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MSDK SRIA+V+AD+CKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISE+LCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE+HVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGPVQKVGELLKLRMEK  + VK+YIK LQL+++L R+I  LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAA IIRSLL P+KYVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXX-XXXXXXXXXXTRAYSYPDMK 359
           YGVVTLP+SVREGINIFLDGHIP+EN+RFRTEALQFR             +RA+SYP +K
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQ 419
           +TQGDF LNV+ GEFSDSEILVMMGENGTGKTTLIKLLAGA+  D+G  +PKLNVSMKPQ
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420

Query: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479
            IAPKFPGTVRQLFFKKIR QFLNPQFQTDVVKPL+IDDIIDQEV+HLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           +LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540

Query: 540 FDGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598
           F+G PS+N  A APESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQK SGN
Sbjct: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGN 599

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/598 (87%), Positives = 554/598 (92%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MS K +RIA+V+ D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSKIAFISE LCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNL+S VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGRF+DPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGPVQKVGELLKLR+EK +D  K+YI  LQL ++LNRE+  LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAALIIRSLL P+ YVI VEHDLSVLDYLSDFVCI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSEN+RFRTEALQFR            +RA++YPDMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360

Query: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420
           TQGDF+L V++GEFSDS+ILVMMGENGTGKTTLIKLLAGAIPADDG  +PKLNVSMKPQ 
Sbjct: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420

Query: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480
           IAPKF GTVRQLFFK+IRAQFLNPQFQTDVVKPLKIDDIIDQEV+HLSGGELQRVAIVLS
Sbjct: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480

Query: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598
           DG PS+   A APESLLTGCN+FLKNLNVTFRRDP SFRPRINKLDSQMDKEQK SGN
Sbjct: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSSGN 598

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/598 (86%), Positives = 552/598 (92%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MSDK +RIA+V+ D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AITIINLPTNL+S VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGP+QKVGELLK RMEKP+  VK YIK L+L ++L R++  LSGGELQRFAI MSCVQ A
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAALIIRSLL+P+ YVI VEHDLSVLDYLSDF+CILYGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKR 360
           YGVVTLPSSVREGINIFLDGHIPSEN+RFRTEALQFR             RA+ YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360

Query: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420
           TQGDF LNV+ GEFSDSEILVMMGENGTGKTTLIKLLAGAI ADDG  +PKLNVSMKPQ 
Sbjct: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKDIPKLNVSMKPQK 420

Query: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480
           IAPKFPGTVRQLFFK+IRAQFLNPQFQTDV KPL+IDDIIDQEV+HLSGGELQRVAIVL+
Sbjct: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480

Query: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598
           +GTPS+N  A  PESLLTGCN+FLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN
Sbjct: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLSGN 598

>Kwal_56.23429
          Length = 539

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/539 (86%), Positives = 494/539 (91%), Gaps = 1/539 (0%)

Query: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60
           MS K +RIA+VN D+CKPKKCRQECKRSCPVVKTGKLCIEVTPT+KIAFISE LCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFDAI IINLPTNLE  VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180
           KILAGKQKPNLGR+DDPPEWQ+II+YFRGSELQNYFTKMLED+IKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240
           KGPVQKVGELLKLR+E+ QD  K  IK L L H+L R++G LSGGELQRFAI MSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300
           DVYMFDEPSSYLDVKQRLNAAL+IRSLL  + YVI+VEHDLSVLDYLSDFVCILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRXX-XXXXXXXXXXTRAYSYPDMK 359
           YGVVTLPSSVREGINIFL+GHIPSENMRFR EALQFR             TR+++YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQ 419
           RTQGDF LNV+SG FSDSEILVMMGENGTGKTTLIKLLAGA+  DDG  VPKLNVSMKPQ
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420

Query: 420 TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479
            IAPKFPGTVRQLFFK+IR QFLNPQFQTDVVKPLKI+ IIDQEV+HLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480

Query: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 538
           +LG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMATYLADKVI 539

 Score =  101 bits (252), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 120/241 (49%), Gaps = 46/241 (19%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKK- 436
           ++L ++G NG GK+T +K+LAG    + G    + +   + Q I   F G+  Q +F K 
Sbjct: 104 QVLGLVGTNGIGKSTALKILAGKQKPNLG----RYDDPPEWQDIIRYFRGSELQNYFTKM 159

Query: 437 ----IRAQFLNPQF--------------------------QTD---VVKPLKIDDIIDQE 463
               I+A  + PQ+                          Q D   V+K L +  ++ ++
Sbjct: 160 LEDNIKA-IIKPQYVDNIPRAIKGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRD 218

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI- 522
           V  LSGGELQR AI +S    AD+Y+ DEPS+YLD +QR+  + VIR  +  N  T  I 
Sbjct: 219 VGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVIRSLL--NATTYVIS 276

Query: 523 VEHDFIMATYLADKVIVFDGTPSQNTTATAPESLLTGCNRFLK----NLNVTFRRDPNSF 578
           VEHD  +  YL+D V +  G PS     T P S+  G N FL+    + N+ FR++   F
Sbjct: 277 VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQF 336

Query: 579 R 579
           R
Sbjct: 337 R 337

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 117/321 (36%), Gaps = 66/321 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ       E 
Sbjct: 597 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGE-----EG 645

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLL 222
           D+  +      + L    +  +    E +    E+   TV                 G L
Sbjct: 646 DLDLVSFIALDEELQSTSREEIAAALESVGFDEERRAQTV-----------------GSL 688

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAVEHDL 281
           SGG   +  +A + +Q AD+ + DEP+++LDV    N   +   LLE +    + V HD 
Sbjct: 689 SGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHDS 745

Query: 282 SVLD----------------YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSE 325
             LD                Y  +    +   P      TL  S              + 
Sbjct: 746 GFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDS--------------NA 791

Query: 326 NMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGE 385
            MRF    +                  +SYP  ++     +L+  S   S S  +  +G 
Sbjct: 792 QMRFPPPGILTGVKSNTRAVAKMTDVTFSYPGAQKP----SLSHVSCSLSLSSRVACLGP 847

Query: 386 NGTGKTTLIKLLAGAIPADDG 406
           NG GK+TLIKLL G +  ++G
Sbjct: 848 NGAGKSTLIKLLTGELVPNEG 868

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  ++   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 683 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITS 738

Query: 521 FIVEHD 526
            IV HD
Sbjct: 739 LIVSHD 744

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR     S  V+ + 
Sbjct: 1030 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW---SGGVVMIS 1086

Query: 279  HD 280
            H+
Sbjct: 1087 HN 1088

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 109 VGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           +G NG GKST +K+L G+  PN G+ +  P
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHP 874

>Scas_618.3
          Length = 793

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 90/190 (47%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D +
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN-REIGLLS 223
              +    VD + +A  G              K  +  + ++ +  +   L  +++ LLS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSV 283
           GG+  R A A  C+ +  + + DEPS++LD    L+A  ++ SL   S  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFVCI 293
           +D++ + + +
Sbjct: 751 IDHVCNEIWV 760

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 93/214 (43%), Gaps = 41/214 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEII---KYFRGSE---LQN-- 154
           G   GLVG NGIGKST L+ L+ ++        + P+   I+   +  RG E   LQ+  
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRREL-------NVPKHVSILHVEQELRGDETLALQSVL 318

Query: 155 ----YFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLR--MEKPQDTVKQYIKT 208
               +  ++L ++ K   + + +D L    +    +V +L   R  ++K    + + +  
Sbjct: 319 DADVWRKQLLSEEAKINERLKEMDKLRSEFEEDSLEVKKLDNEREDLDKHLIQIDEKLAD 378

Query: 209 LQLDHLLNREIGLL-----------------SGGELQRFAIAMSCVQDADVYMFDEPSSY 251
           ++ D    R   +L                 SGG   R ++A +     D+ + DEPS+ 
Sbjct: 379 MESDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNM 438

Query: 252 LDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           LDV      A  +++   PS  V+ V HD + L+
Sbjct: 439 LDVPSIAYLAEYLKTY--PST-VLTVSHDRAFLN 469

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 78/179 (43%), Gaps = 18/179 (10%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDG--TSVPKLNVSMKPQTIAPKFPGTVRQL- 432
           DS I  ++G NG GKTTL+K++   +    G  +   +L +    Q        T   + 
Sbjct: 599 DSRI-ALVGANGCGKTTLLKVMMEELRPTKGFVSRNGRLRIGYFTQHHVDSMDLTTSAVD 657

Query: 433 FFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIV-LSLGIPADIYLID 491
           +  K      + +++  +        +  Q+++ LSGG+  RVA   L L  P  I ++D
Sbjct: 658 WMSKAYPGKTDEEYRHHLGSFGITGTLGLQKMELLSGGQKSRVAFAALCLNNPH-ILVLD 716

Query: 492 EPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV--------FDG 542
           EPS +LD+       + ++ F         +V HD  +  ++ +++ V        FDG
Sbjct: 717 EPSNHLDTTGLDALVESLKNF----SGGVLMVSHDISIIDHVCNEIWVSENGTVKRFDG 771

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 90/189 (47%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +  I YF     Q++   M   D+ 
Sbjct: 562 IALVGANGCGKTTLLKVMMEQLRPITGHVSRNPRLR--IGYF----TQHHIDSM---DLN 612

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN-REIGLLSG 224
           A      VD + +   G              K  +  ++++    +   L  +++ LLSG
Sbjct: 613 A----SAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 654

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
           G+  R A A  C+    + + DEPS++LD    L+A  ++++L   S  V+ V HD+SV+
Sbjct: 655 GQKSRVAFAALCLNSPHILILDEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVI 711

Query: 285 DYLSDFVCI 293
           D + D + +
Sbjct: 712 DSVCDEIWV 720

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 91/217 (41%), Gaps = 48/217 (22%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG--TSV 409
           ++ Y + +    D  L+VQ     DS I  ++G NG GKTTL+K++   +    G  +  
Sbjct: 539 SFGYDESQLLLKDVNLDVQM----DSRI-ALVGANGCGKTTLLKVMMEQLRPITGHVSRN 593

Query: 410 PKLNVSMKPQ--------------TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLK 455
           P+L +    Q               ++  FPG   + + + + A          +   L 
Sbjct: 594 PRLRIGYFTQHHIDSMDLNASAVDWMSKTFPGKTDEEYRRHLGA--------FGITGSLG 645

Query: 456 IDDIIDQEVKHLSGGELQRVAIV-LSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
           +     Q+++ LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F  
Sbjct: 646 L-----QKMQLLSGGQKSRVAFAALCLNSPH-ILILDEPSNHLDTAGLDALVQALKNF-- 697

Query: 515 HNKKTAFIVEHDFIMATYLADKVIV--------FDGT 543
                  +V HD  +   + D++ V        FDG 
Sbjct: 698 --SGGVLMVSHDISVIDSVCDEIWVSESGTVKRFDGN 732

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 41/214 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQ------------KPNLGRFDDPPEWQEIIKYFRGS 150
           G+  GLVG NGIGKST L+ L+ ++            +  L R DD    Q ++      
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQEL-RGDDTKVLQSVL------ 278

Query: 151 ELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLR--MEKPQDTVKQYIKT 208
           +   +  ++L +++K   + Q +D L         +V +L   R  +E     + + +  
Sbjct: 279 DADVWRKQLLSEELKINERLQDIDKLRAEFDEDSLEVKKLDNERDDLESHLQQIAEKLAD 338

Query: 209 LQLDHLLNREIGLL-----------------SGGELQRFAIAMSCVQDADVYMFDEPSSY 251
           ++ D    R   +L                 SGG   R ++A +     D+ + DEPS+ 
Sbjct: 339 MESDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNM 398

Query: 252 LDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           LDV    + A +   L      V+ V HD S L+
Sbjct: 399 LDVP---SIAYLAEYLKTYPATVLVVSHDRSFLN 429

>Kwal_0.327
          Length = 1019

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 80/183 (43%), Gaps = 24/183 (13%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFP 426
           LN  SG     EI+ +MG +G GKTTL+ +LA    A   +   K+N S   +    K  
Sbjct: 385 LNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITKQNLSKIA 444

Query: 427 GTVRQ------------------LFFKKIRAQFLNPQFQT-DVVKPLKIDDIIDQEV--- 464
           G V Q                  L     +  F+  Q +   V++ L+I DI D+ +   
Sbjct: 445 GFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEELRILDIKDRIIGDD 504

Query: 465 --KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
             + +SGGE +RV+I   L     +  +DEP++ LDS       + + R  LH  +T  +
Sbjct: 505 LERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLIL 564

Query: 523 VEH 525
             H
Sbjct: 565 SIH 567

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 90/222 (40%), Gaps = 30/222 (13%)

Query: 69  AITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQK 128
            +T  N+  N+ S    R   N        + +PG+++ L+G +G GK+T L ILA K K
Sbjct: 365 TLTFENIEYNIRSEKGERMILNGIS----GSVKPGEIMALMGGSGAGKTTLLDILAMKDK 420

Query: 129 PNLGRFDDPPEWQEIIKYFRGS-----ELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGP 183
                        EI K          + +N+    L   +   +    +  LPR     
Sbjct: 421 AGKASGSIKINGSEITKQNLSKIAGFVDQENFLLPTL--TVYETVLNSALLRLPR----- 473

Query: 184 VQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQ 238
                   KL   + Q  V Q ++ L++  + +R IG      +SGGE +R +IA   V 
Sbjct: 474 --------KLSFVQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVT 525

Query: 239 DADVYMFDEPSSYLDVKQRLNA-ALIIRSLLEPSKYVIAVEH 279
              V   DEP+S LD     N    ++R  L  ++ +I   H
Sbjct: 526 SPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLILSIH 567

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 126/308 (40%), Gaps = 40/308 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +   
Sbjct: 578 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTRFVEHKLQGEEGDL--- 628

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLD-HLLNREIGL 221
           D+ + I          A+   +Q V           ++ +   ++++  D +  ++ +G 
Sbjct: 629 DLVSFI----------ALDPELQGVS----------REDIANALESVGFDDYRRSQTVGS 668

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAVEHD 280
           LSGG   +  +A + +Q ADV + DEP+++LDV    N   +   LLE ++   + V HD
Sbjct: 669 LSGGWKMKLELARAMLQKADVLLLDEPTNHLDVA---NVKWLEDYLLEHTEITSLIVSHD 725

Query: 281 LSVLDYLSDFVCILYGVPSVYGVVTLPSSVREG--INIFLDGHIPSENMRFRTEALQFRX 338
              LD +   +         Y    L + V +      +      +  MRF    +    
Sbjct: 726 SGFLDAVCTEIIHYENKKLAYYKGNLAAFVEQKPEAKAYYTLTDTNAQMRFPPPGILTGV 785

Query: 339 XXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLA 398
                        +++YP   +     +L   S   S S  + ++G NG GK+TLIKLL 
Sbjct: 786 KSNTRAVAKVTGVSFTYPGASQP----SLTDVSCSLSLSSRVAVLGPNGAGKSTLIKLLT 841

Query: 399 GAIPADDG 406
           G +   +G
Sbjct: 842 GELVPQEG 849

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 28/158 (17%)

Query: 382 MMGENGTGKTTLIKLLAGA----IPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKI 437
           + G NG GK+TL++ +A       P  D         +++ + +  K  G    L     
Sbjct: 583 LCGRNGAGKSTLMRSIANGQLEGFPDKD---------TLRTRFVEHKLQGEEGDLDLVSF 633

Query: 438 RAQFLNPQFQ-------TDVVKPLKIDDII-DQEVKHLSGGELQRVAIVLSLGIPADIYL 489
            A  L+P+ Q        + ++ +  DD    Q V  LSGG   ++ +  ++   AD+ L
Sbjct: 634 IA--LDPELQGVSREDIANALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQKADVLL 691

Query: 490 IDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
           +DEP+ +LD    +   K +  ++L H + T+ IV HD
Sbjct: 692 LDEPTNHLD----VANVKWLEDYLLEHTEITSLIVSHD 725

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR     +  V+ + 
Sbjct: 1011 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW---TGGVVMIS 1067

Query: 279  HD 280
            H+
Sbjct: 1068 HN 1069

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 49/107 (45%), Gaps = 19/107 (17%)

Query: 467  LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK-- 518
            LSGG+L +V I  ++     + ++DEP+ YLD +     +  IR +      I HN +  
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWTGGVVMISHNNEFV 1073

Query: 519  -----TAFIVEHDFIMATYLA--DKVIVFDGTPSQ----NTTATAPE 554
                   +IVE+  ++   +   D+    DG  +     NTTA  PE
Sbjct: 1074 GALCPEQWIVENGTMVQKGIKQIDQSRFEDGGNANAVGLNTTAIKPE 1120

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 823 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 855

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 120/308 (38%), Gaps = 40/308 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +   
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIAN------GQLDGFPDKDTLKTCFVEHKLQGEEGDL--- 640

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNRE-IGL 221
           D+ + I          A+   +Q             +D +   + ++  D     + +G 
Sbjct: 641 DLVSFI----------ALDEQLQTTS----------RDDIANALASVGFDETRRAQTVGS 680

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAVEHD 280
           LSGG   +  +A + +Q AD+ + DEP+++LDV    N   +   LLE +    + V HD
Sbjct: 681 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVSHD 737

Query: 281 LSVLDYLSDFVCILYGVPSVYGVVTLPSSVREG--INIFLDGHIPSENMRFRTEALQFRX 338
              LD +   +        +Y    L   V +      +      +  MRF    +    
Sbjct: 738 SGFLDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGILTGV 797

Query: 339 XXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLA 398
                         ++YP         +L+  S   S S  + ++G NG GK+TLIKLL 
Sbjct: 798 KSNTRAVAKVTDVTFTYPGASTP----SLSHVSCALSLSSRVAVLGPNGAGKSTLIKLLT 853

Query: 399 GAIPADDG 406
           G +   +G
Sbjct: 854 GELVPQEG 861

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 68/163 (41%), Gaps = 38/163 (23%)

Query: 382 MMGENGTGKTTLIKLLAGA----IPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKI 437
           + G NG GK+TL++ +A       P  D         ++K   +  K  G    L     
Sbjct: 595 LCGRNGAGKSTLMRSIANGQLDGFPDKD---------TLKTCFVEHKLQGEEGDLDLVSF 645

Query: 438 RAQFLNPQFQTDVVKPLKIDDIID-------------QEVKHLSGGELQRVAIVLSLGIP 484
            A  L+ Q QT        DDI +             Q V  LSGG   ++ +  ++   
Sbjct: 646 IA--LDEQLQT-----TSRDDIANALASVGFDETRRAQTVGSLSGGWKMKLELARAMLQK 698

Query: 485 ADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
           ADI L+DEP+ +LD    +   K +  ++L H   T+ IV HD
Sbjct: 699 ADILLLDEPTNHLD----VANVKWLEEYLLEHTNITSLIVSHD 737

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR     S  V+ + 
Sbjct: 1023 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW---SGGVVMIS 1079

Query: 279  HD 280
            H+
Sbjct: 1080 HN 1081

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 835 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 867

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 118/303 (38%), Gaps = 44/303 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P   E    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL-DHLLNREIGL 221
              +++   Y  N+                      +D +   +K     D ++   I  
Sbjct: 507 ---SVLDFVYSGNV--------------------GTKDVITSKLKEFGFSDEMIEMPIAS 543

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL 281
           LSGG   + A+A + ++DAD+ + DEP+++LD    +N   ++  L       + V HD 
Sbjct: 544 LSGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHDS 600

Query: 282 SVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFR--TEALQFRXX 339
             LD +  ++    G+        L   V++         + + ++ F+  T        
Sbjct: 601 GFLDKVCQYIIHYEGLKLRKYKGNLSEFVQKCPTAQSYYELGASDLEFQFPTPGYLEGVK 660

Query: 340 XXXXXXXXXXTRAYSYPDMKRTQ-GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLA 398
                        + YP   + Q  D T      + S S  + ++G NG GK+TLI +L 
Sbjct: 661 TKQKAIVKVSNMTFQYPGTTKPQVSDVTF-----QCSLSSRIAVIGPNGAGKSTLINVLT 715

Query: 399 GAI 401
           G +
Sbjct: 716 GEL 718

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  ++   ADI L+DEP+ +LD+    +  + +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT----VNVEWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDG 542
             T+ IV HD      +   +I ++G
Sbjct: 590 GITSVIVSHDSGFLDKVCQYIIHYEG 615

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 11/87 (12%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ LSGG  Q+V +VL+       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 522 IVEHDFIMATYLADKVI-VFDG--TPS 545
           I+ H       L D+V  V DG  TPS
Sbjct: 948 IITHSAEFTKNLTDEVWAVKDGKMTPS 974

>Kwal_0.167
          Length = 1044

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 119/297 (40%), Gaps = 40/297 (13%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
           GL G NG GKST ++ +A       G+ D  P   E    +            +E DI  
Sbjct: 460 GLCGPNGAGKSTLMRAIAN------GQVDGFPTQDECRTVY------------VEHDIDG 501

Query: 167 IIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGE 226
                 V  L    +G V           E   D ++++  +   D ++N  I  LSGG 
Sbjct: 502 THSDTSV--LDFVFQGDVGT--------KEAITDKLREFGFS---DEMINMPISSLSGGW 548

Query: 227 LQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDY 286
             + A+A + +++AD+ + DEP+++LD    +N A ++  L       I V HD   LD 
Sbjct: 549 KMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVSHDSGFLDN 605

Query: 287 LSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQF--RXXXXXXX 344
           ++ ++    G+        +   V++         + +  + FR     F          
Sbjct: 606 VTQYIIHYEGLKLRKYKGNMSEFVKKCPTAKSYYELGASELEFRFPEPGFLEGVKTKQKA 665

Query: 345 XXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAI 401
                   + YP   + Q    ++  S + S S  + ++G NG GK+TLI +L G +
Sbjct: 666 IVKVSNMTFQYPGTSKPQ----ISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGEL 718

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 8/162 (4%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQF 441
           + G NG GK+TL++ +A        T      V ++          +V    F+      
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTHSDTSVLDFVFQ---GDV 517

Query: 442 LNPQFQTDVVKPLKI-DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
              +  TD ++     D++I+  +  LSGG   ++A+  ++   ADI L+DEP+ +LD+ 
Sbjct: 518 GTKEAITDKLREFGFSDEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT- 576

Query: 501 QRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG 542
              +    +  ++     T+ IV HD      +   +I ++G
Sbjct: 577 ---VNVAWLVNYLNTCGITSIIVSHDSGFLDNVTQYIIHYEG 615

>Scas_720.36
          Length = 1190

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 115/321 (35%), Gaps = 66/321 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ       E 
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGE-----EG 641

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLL 222
           D+  +      + L    +  +    E +    E+   TV                 G L
Sbjct: 642 DLDLVSFIALDEELQATSREEISNALEHVGFDEERRAQTV-----------------GSL 684

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAVEHDL 281
           SGG   +  +A + +Q AD+ + DEP+++LDV    N   +   LLE +    + V HD 
Sbjct: 685 SGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITSLIVSHDS 741

Query: 282 SVLD----------------YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSE 325
             LD                Y  +    +   P      TL  S              + 
Sbjct: 742 GFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKSYYTLSDS--------------NA 787

Query: 326 NMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGE 385
            M F    +                  +SYP   +     +L+  S   S S  + ++G 
Sbjct: 788 QMHFPPPGILTGVKSNTRAVAKMTDVTFSYPGADKP----SLSHVSCALSLSSRVAVLGP 843

Query: 386 NGTGKTTLIKLLAGAIPADDG 406
           NG GK+TLIKLL G +   +G
Sbjct: 844 NGAGKSTLIKLLTGELVPQEG 864

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  ++   ADI L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 679 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLQDYLLEHTDITS 734

Query: 521 FIVEHD 526
            IV HD
Sbjct: 735 LIVSHD 740

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR     S  V+ + 
Sbjct: 1026 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW---SGGVVMIS 1082

Query: 279  HD 280
            H+
Sbjct: 1083 HN 1084

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 838 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 870

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN-REIGLLSG 224
             +    VD + +   G              K  +  ++++    +   L  +++ LLSG
Sbjct: 610 --LNTSAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 653

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
           G+  R A A  C+ +  + + DEPS++LD    L+A  +I +L   +  V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVI 710

Query: 285 DYLSDFVCI 293
           D++   + +
Sbjct: 711 DHVCSEIWV 719

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 92/217 (42%), Gaps = 48/217 (22%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG--TSV 409
           ++ Y +      D  L+VQ     DS I  ++G NG GKTTL+K++   +    G  +  
Sbjct: 538 SFGYEENSPLLKDVNLDVQM----DSRI-ALVGANGCGKTTLLKVMMEQLRPTKGYVSRN 592

Query: 410 PKLNV---------SMKPQT-----IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLK 455
           P+L +         SM   T     ++  FPG   + + + + A          +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLNTSAVDWMSKTFPGKTDEEYRRHLGA--------FGITGSLG 644

Query: 456 IDDIIDQEVKHLSGGELQRVAIV-LSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
           +     Q+++ LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F  
Sbjct: 645 L-----QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALIDALKNFT- 697

Query: 515 HNKKTAFIVEHDFIMATYLADKVIV--------FDGT 543
                  +V HD  +  ++  ++ V        FDGT
Sbjct: 698 ---GGVLMVSHDISVIDHVCSEIWVSEDGTVKRFDGT 731

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 85/207 (41%), Gaps = 27/207 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGE-LLKLRMEKPQ 199
           Q + +  + +E      K+ E+  +  ++ + +DN    +   ++++ E L+ +  +K +
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKLVDMESDKAE 344

Query: 200 DTVKQYIKTLQLD-HLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
                 +  L        +     SGG   R ++A +     D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP--- 401

Query: 259 NAALIIRSLLEPSKYVIAVEHDLSVLD 285
           + A +   L      V+ V HD + L+
Sbjct: 402 SIAYLSEYLKTYPATVLVVSHDRAFLN 428

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 467 LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            SGG   R+++  +L    D+ L+DEPS  LD       S+ ++ +      T  +V HD
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVLVVSHD 423

Query: 527 FIMATYLADKVI 538
                 +A  +I
Sbjct: 424 RAFLNEVATDII 435

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 119/311 (38%), Gaps = 46/311 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ       E 
Sbjct: 583 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTCFVEHKLQGE-----EG 631

Query: 163 DIKAI----IKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNRE 218
           D+  +    + P   D     I   ++ VG                       D+  ++ 
Sbjct: 632 DLDLVSFIALDPILKDVSKEDISNALESVG---------------------FDDYRRSQT 670

Query: 219 IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAV 277
           +G LSGG   +  +A + +Q ADV + DEP+++LDV    N   +   LLE +    + V
Sbjct: 671 VGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLDVA---NVKWLQDYLLEHTDITSLIV 727

Query: 278 EHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSEN--MRFRTEALQ 335
            HD   LD +   +         Y    L   V +         + + N  M F    + 
Sbjct: 728 SHDSGFLDTVCTDIIHYENKKLAYYKGNLADFVEQKPEAKAYYTLTNSNAQMHFPPPGIL 787

Query: 336 FRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIK 395
                            ++YP   +     +L+  S   S S  + ++G NG GK+TLIK
Sbjct: 788 SGVKSNTRAVAKMTDVTFTYPGASKP----SLSNVSCALSLSSRVAILGPNGAGKSTLIK 843

Query: 396 LLAGAIPADDG 406
           LL G +  D G
Sbjct: 844 LLNGELLPDSG 854

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 71/158 (44%), Gaps = 28/158 (17%)

Query: 382 MMGENGTGKTTLIKLLAGA----IPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKI 437
           + G NG GK+TL++ +A       P  D         +++   +  K  G    L     
Sbjct: 588 LCGRNGAGKSTLMRSIANGQLEGFPDKD---------TLRTCFVEHKLQGEEGDLDLVSF 638

Query: 438 RAQFLNPQFQ-------TDVVKPLKIDDII-DQEVKHLSGGELQRVAIVLSLGIPADIYL 489
            A  L+P  +       ++ ++ +  DD    Q V  LSGG   ++ +  ++   AD+ L
Sbjct: 639 IA--LDPILKDVSKEDISNALESVGFDDYRRSQTVGSLSGGWKMKLELARAMLQRADVLL 696

Query: 490 IDEPSAYLDSEQRIICSKVIRRFIL-HNKKTAFIVEHD 526
           +DEP+ +LD    +   K ++ ++L H   T+ IV HD
Sbjct: 697 LDEPTNHLD----VANVKWLQDYLLEHTDITSLIVSHD 730

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 4/105 (3%)

Query: 467  LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            LSGG+L +V I  ++     + ++DEP+ YLD +     +  IR +         I  ++
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMISHNN 1076

Query: 527  FIMATYLADKVIVFDGTPSQNTTATAPESLLT-GCNRFLKNLNVT 570
              +     ++ IV +GT  Q   A   +S    G N     LNVT
Sbjct: 1077 EFVGALCPEQWIVENGTMVQKGIAEIDQSRFEDGGNTNAVGLNVT 1121

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR   E +  V+ + 
Sbjct: 1017 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIR---EWTGGVVMIS 1073

Query: 279  HD 280
            H+
Sbjct: 1074 HN 1075

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPP 138
           + ++G NG GKST +K+L G+  P+ G+ +  P
Sbjct: 828 VAILGPNGAGKSTLIKLLNGELLPDSGKVEKHP 860

>Scas_703.17
          Length = 1046

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 119/306 (38%), Gaps = 48/306 (15%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
           GL G NG GKST ++ +A +Q                ++ F   E           + K 
Sbjct: 461 GLCGPNGAGKSTLMRAIANEQ----------------VEGFPSQE-----------ECKT 493

Query: 167 IIKPQYVDNLPRAIKGPVQKVGELLKLRMEK---PQDTVKQYIKTLQL-DHLLNREIGLL 222
           +     +DN              +L   ME     QD +   +K     D  +N  I  L
Sbjct: 494 VYVEHDIDN--------THSETSVLNFVMESGVGKQDVIVDKLKEFGFSDETINMPISAL 545

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLS 282
           SGG   + A+A + +++AD+ + DEP+++LD    +N   ++  L       I V HD  
Sbjct: 546 SGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCGITSIIVSHDSG 602

Query: 283 VLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRX--XX 340
            LD +  ++    G+        L   +++  +      + + ++ F+  A  +      
Sbjct: 603 FLDNVCQYIIHYEGLKLRKYKGNLSEFIKKCPSAKSYSELGASDLEFQFPAPGYLEGVKT 662

Query: 341 XXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGA 400
                       + YP   + Q    ++  S + S S  + ++G NG GK+TLI +L G 
Sbjct: 663 KQKAIVKVSNMTFQYPRTSKPQ----ISDVSFQCSLSSRIAVIGPNGAGKSTLINVLTGE 718

Query: 401 IPADDG 406
           +    G
Sbjct: 719 LLPTSG 724

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D+ I+  +  LSGG   ++A+  ++   ADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDG 542
             T+ IV HD      +   +I ++G
Sbjct: 591 GITSIIVSHDSGFLDNVCQYIIHYEG 616

 Score = 29.6 bits (65), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 463 EVKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRF 512
           +++ LSGG  Q+V +VL+       +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 QIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 943

>Kwal_33.15561
          Length = 1297

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 91/198 (45%), Gaps = 33/198 (16%)

Query: 353  YSYPDMKR--TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD------ 404
            +SY ++       + +L V  GE     I+ ++G +G+GK+TL  LL    P +      
Sbjct: 1066 FSYSNINNPMVYKNLSLKVDRGE-----IVGLIGTSGSGKSTLWSLLTRLYPVENGSISI 1120

Query: 405  DGTSVPKLN----------VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQT----DV 450
            DGT + + +          V  KP   +      +     +K+  + +N    T    + 
Sbjct: 1121 DGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEF 1180

Query: 451  VK--PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKV 508
            V   P ++  +ID ++  LSGG++QR+AIV +L     + ++DE ++ LD+    I S+ 
Sbjct: 1181 VNSTPKRLHSVIDTQL--LSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEF 1238

Query: 509  IRRFILHNKKTAFIVEHD 526
            ++  + H   T  +V H 
Sbjct: 1239 VKHHLYHT--TTLVVTHS 1254

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 68/164 (41%), Gaps = 29/164 (17%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L        G                G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLYPVENGSIS-----------IDGTDINQWDRKALRS 1135

Query: 163  DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDT-VKQYIKTLQLDHLLNR---- 217
             I        V+  P    G +  +  L    M K  D  V + + TL +   +N     
Sbjct: 1136 CIAV------VEQKPLFFSGSI--IENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKR 1187

Query: 218  -----EIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQ 256
                 +  LLSGG++QR AI  + ++   + + DE +S LD + 
Sbjct: 1188 LHSVIDTQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARH 1231

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 90/202 (44%), Gaps = 35/202 (17%)

Query: 352 AYSYPDMKR--TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLL-------AGAIP 402
           +++YP   +     +  L V  G F+      ++G++G+GK+T+  LL       +G I 
Sbjct: 366 SFAYPSRSKHPVIKNLNLKVPGGRFT-----FIVGKSGSGKSTISNLLLKLYRPCSGLIK 420

Query: 403 ADDGTSVPKLN-------VSMKPQTIAPKFPGTVR---QLFFKKIR-----AQFLNPQFQ 447
            +D   + ++N       +++  Q  +P F  +++   QL   + R     +Q       
Sbjct: 421 VND-VDIREINQQDLFRSITLVEQN-SPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAML 478

Query: 448 TDVVKPLK--IDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIIC 505
             V++ L   +D II      LSGGE QRVA+  +    + I ++DE  +  D   + + 
Sbjct: 479 EGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLL 538

Query: 506 SKVIRRFILHNKKTAFIVEHDF 527
            + IR +     +T  I+ H+ 
Sbjct: 539 MEAIRFW--RKGRTTIILTHEL 558

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 31/203 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFD-DPPEWQEIIK--YFRGSELQNYFTKM 159
           G+   +VG +G GKST   +L    +P  G    +  + +EI +   FR   L    + +
Sbjct: 388 GRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPL 447

Query: 160 LEDDIKAIIK---PQYVDN--LPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHL 214
            ED IK  I+    ++ D+  L +A +  +    E +   + K  DT+   I +  +D  
Sbjct: 448 FEDSIKNNIQLTSDEHRDDGRLSQACQAAML---EGVIRDLAKGLDTI---IGSSGVD-- 499

Query: 215 LNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL--LEPSK 272
                  LSGGE QR A+A + V+D+ + + DE    L  + R++  L++ ++      +
Sbjct: 500 -------LSGGEQQRVALARAFVRDSPILILDEA---LSAQDRMHKDLLMEAIRFWRKGR 549

Query: 273 YVIAVEHDLSVLDYLS-DFVCIL 294
             I + H+L+  D L  DFV ++
Sbjct: 550 TTIILTHELN--DILEDDFVLLM 570

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 120/307 (39%), Gaps = 60/307 (19%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
           GL G NG GKST ++ +A       G+ D  P   E    +            +E DI  
Sbjct: 460 GLCGPNGAGKSTLMRAIAN------GQVDGFPSQDECRTVY------------VEHDIDG 501

Query: 167 IIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL-DHLLNREIGLLSGG 225
                 V  L    +G V              ++T+ + ++     D ++   I  LSGG
Sbjct: 502 THSDTSV--LEFVFQGDVGT------------KETISEKLREFGFSDEMIEMPIASLSGG 547

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
              + A+A + +++AD+ + DEP+++LD    +N A ++  L       I V HD   LD
Sbjct: 548 WKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVSHDSGFLD 604

Query: 286 YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEA--LQFR------ 337
            +  ++    G+             R  ++ F+    P+    +   A  L+FR      
Sbjct: 605 SVCQYIIHYEGLKL--------RKYRGNLSEFVK-KCPTAKSYYELGASELEFRFPEPGY 655

Query: 338 ---XXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLI 394
                             + YP   + Q    ++  S + S S  + ++G NG GK+TLI
Sbjct: 656 LEGVKTKQKAIVKVSNMTFQYPGTSKPQ----ISDISFQCSLSSRIAVIGPNGAGKSTLI 711

Query: 395 KLLAGAI 401
            +L G +
Sbjct: 712 NVLTGEL 718

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  ++   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDG 542
             T+ IV HD      +   +I ++G
Sbjct: 590 GITSIIVSHDSGFLDSVCQYIIHYEG 615

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 11/94 (11%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 522 IVEHDFIMATYLADKVI-VFDG--TPSQNTTATA 552
           I+ H       L ++V  V DG  TPS +   T 
Sbjct: 948 IITHSAEFTKDLTEEVWAVKDGKMTPSGHNWVTG 981

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 85/234 (36%), Gaps = 88/234 (37%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RFDDPPEWQE 142
           + ++G NG GKST + +L G+  P +G                         D  P   E
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSE----LQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQK----------- 186
            I++ F+  E    +     ++ EDD +A+ K   +D  PR I G   +           
Sbjct: 755 YIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 187 ---VGELLKLRMEK--PQDTV-----------------------KQYIKTLQLDHLLNRE 218
              +GE + ++ E+  P  +V                       K+ + + Q   L  +E
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 219 I-------GL------------LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           I       GL            LSGG+  +  +A    Q   + + DEP++YLD
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 928

>Kwal_27.12711
          Length = 1246

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 95/207 (45%), Gaps = 35/207 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFDDPPEWQEIIKYFRGSELQNYFTKM 159
           G ++ ++G +G GK+T L +LA K    L   G F   PE         G    +Y T  
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPE----TSSHSGEITTSYLT-- 99

Query: 160 LEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKP--QDTVKQYIKTLQLDHLLNR 217
            + DI A        NL    +  +Q   +L KL+  K   Q  V++ I  L L    N 
Sbjct: 100 -QQDILA-------SNL--TCRETLQYAADL-KLQSSKSERQGLVEELIAELGLKDCANT 148

Query: 218 EIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPS- 271
            +G      LSGGE +R +I +  + +  +   DEP++ LD     +A L++R+L + S 
Sbjct: 149 LVGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDA---YSAYLVVRTLRKLSH 205

Query: 272 ----KYVIAVEHDLSVLDYLSDFVCIL 294
                +++++    + + +L D VCI+
Sbjct: 206 KGGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 85/190 (44%), Gaps = 21/190 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRFDDPPEWQEIIKYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  F+          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDDIKAIIKPQYVDNL-PRAIKGPVQKVGELLKLRMEKPQDTVKQ---YIKTLQLDHLL 215
           +  D+ + + PQ  D+L P+            L+L   K ++ + +    I  L L H  
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 216 NREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL-LE 269
           N  +G      +SGGE +R ++    + D+ + + DEP+S LD         ++ ++  +
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDSFTSFKILEVLTNISRK 843

Query: 270 PSKYVIAVEH 279
           P K VI   H
Sbjct: 844 PGKTVILTIH 853

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 70/160 (43%), Gaps = 39/160 (24%)

Query: 374 FSDSEILVMMGENGTGKTTLIKLLAG----AIPADDGTS-------------VPKLNVSM 416
           F    I  +MG +G+GK+TL+  L+G     + A   TS             + K   S 
Sbjct: 673 FQPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGSIFFNNSQVTQDIFKDVCSF 732

Query: 417 KPQTIAPKFPG-TVRQ--LFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQE---------- 463
            PQ      P  TVR+  LF   +R   +  + +       ++DD+I +           
Sbjct: 733 VPQDDDHLLPQLTVRETLLFAADLRLHHMKARNRIS-----RVDDLISELGLKHCENTLV 787

Query: 464 ----VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
               VK +SGGE +R+++   L   + I L+DEP++ LDS
Sbjct: 788 GSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDS 827

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 34/186 (18%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAP 423
           D ++ V SG      I+ ++G +G+GKTTL+ +LA  +     T   + +    P+T + 
Sbjct: 38  DISMTVPSGS-----IMAIIGGSGSGKTTLLNVLASKMSK---TLKQRGSFRFVPETSSH 89

Query: 424 KFPGTVRQLFFKKIRAQFLNP----QFQTDV----------------VKPLKIDDIIDQE 463
               T   L  + I A  L      Q+  D+                +  L + D  +  
Sbjct: 90  SGEITTSYLTQQDILASNLTCRETLQYAADLKLQSSKSERQGLVEELIAELGLKDCANTL 149

Query: 464 VKH-----LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK 518
           V       LSGGE +R++I + +     +  +DEP+  LD+    +  + +R+ + H   
Sbjct: 150 VGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDAYSAYLVVRTLRK-LSHKGG 208

Query: 519 TAFIVE 524
            +FI+ 
Sbjct: 209 RSFIMS 214

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 85/181 (46%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKI+  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN-REIGLLSG 224
             +    VD + ++  G              K  +  ++++ +  +   L  +++ LLSG
Sbjct: 610 --LTTSAVDWMSKSFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
           G+  R A A  C+ +  + + DEPS++LD    L+A  ++ +L   +  V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVI 710

Query: 285 D 285
           D
Sbjct: 711 D 711

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 89/228 (39%), Gaps = 69/228 (30%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEII---KYFRGSELQNYFTKM 159
           G   GLVG NGIGKST L+ L+ ++        + P+   I+   +  RG          
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRREL-------NVPKHVSILHVEQELRG---------- 267

Query: 160 LEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLK----LRMEKPQDTVKQYIKTLQ----- 210
             DD KA+      D   + +     K+ E LK    LR E  +D+++  +K L      
Sbjct: 268 --DDTKALQSVLDADVWRKQLLSEEAKINERLKEMDVLRQEFEEDSLE--VKKLDNERED 323

Query: 211 LD-HLLN---------------REIGLL-----------------SGGELQRFAIAMSCV 237
           LD HL+                R   +L                 SGG   R ++A +  
Sbjct: 324 LDNHLIQISDKLVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALF 383

Query: 238 QDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
              D+ + DEPS+ LDV    + A +   L      V+ V HD + L+
Sbjct: 384 CQPDLLLLDEPSNMLDVP---SIAYLAEYLKTYPNTVLTVSHDRAFLN 428

>Kwal_34.16240
          Length = 752

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 81/188 (43%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKIL  + +P  G     P  +  + YF    + +        D  
Sbjct: 561 IALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLR--VAYFTQHHVDSMDLNTSAVDWM 618

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGG 225
           +   P   D   R   G     G L   +M+                        LLSGG
Sbjct: 619 STTFPGKTDEEYRRHLGAFGITGSLGLQKMQ------------------------LLSGG 654

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           +  R A A  C+ +  + + DEPS++LD    L+A  ++ +L + +  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVID 711

Query: 286 YLSDFVCI 293
            + + + +
Sbjct: 712 GVCNEIWV 719

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 35/211 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   G+VG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 141 ----QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGE-LLKLRM 195
               +E     R  E++   ++  ED +++    + +DN    ++  ++++ E L+ +  
Sbjct: 285 QLLSEESKINERLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKLIDMES 340

Query: 196 EKPQDTVKQYIKTLQLDHLLNRE-IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDV 254
           +K +      +  L       ++     SGG   R ++A +     D+ + DEPS+ LDV
Sbjct: 341 DKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDV 400

Query: 255 KQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
               + A +   L      V+ V HD + L+
Sbjct: 401 P---SIAYLSEYLKTYPATVVVVSHDRAFLN 428

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       S+ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVV 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 74/165 (44%), Gaps = 34/165 (20%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         RF DP E + ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DDIKAIIK--PQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNR-- 217
             I  + +  P + D +   +K            R+E   + + + I   QL  L+ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG----------RIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 218 --------EIGLL-SGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
                   E GL+ SGGE QR AIA   ++DAD+  FDE +S LD
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALD 633

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 103/236 (43%), Gaps = 29/236 (12%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPADDGTSVPKLNVSMKPQTIA------PKFPGT 428
           + G +G+GK+T++KL+        G +  + G  V + ++    + I       P F  T
Sbjct: 496 IAGPSGSGKSTVLKLVFRFYDPEEGRVLVN-GVDVREYDIDQLRKAIGVVPQDTPLFNDT 554

Query: 429 VRQ-LFFKKIRA------QFLNPQFQTDVVK--PLKIDDIIDQEVKHLSGGELQRVAIVL 479
           + + + F +I A      + ++    +D++   P     I+ +    +SGGE QR+AI  
Sbjct: 555 IWENVKFGRIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIAR 614

Query: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
            L   ADI   DE ++ LD+       + IRR     +KT+  + H  +     ADK+IV
Sbjct: 615 VLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHR-LRTIADADKIIV 673

Query: 540 F-DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQK 594
             +GT  +  T    + LL   N   K L    + D +     IN     ++K  K
Sbjct: 674 LEEGTVREEGT---HQELLARENSLYKEL-WRIQEDLDLLEDEINHEKETLEKLNK 725

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 31/184 (16%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQ--LFF 434
           SE+  ++G+ G+GK+ LI+ + G +   +G++V + NV+   Q +A    GTVR   LF 
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILFG 696

Query: 435 KKIRAQFLNPQFQTDVVKPLKID---------DIIDQEVKHLSGGELQRVAIVLSLGIPA 485
            K  A+F     QT     L +D           + ++   LSGG+  R+++  ++   A
Sbjct: 697 HKYDAKFYQ---QTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARA 753

Query: 486 DIYLIDEPSAYLDSEQRIICSKVIRRFILHN--------KKTAFIVEHDFIMATYLADKV 537
           D YL+D+P A +D          + + +L N        K  A ++  + I A  +AD +
Sbjct: 754 DTYLLDDPLAAVDEH--------VAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADHI 805

Query: 538 IVFD 541
           ++ +
Sbjct: 806 VLLE 809

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           LSGG+  R ++A +    AD Y+ D+P + +D
Sbjct: 735 LSGGQKARLSLARAVYARADTYLLDDPLAAVD 766

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 81/191 (42%), Gaps = 29/191 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +  I YF    + +        D  
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR--IGYFTQHHVDSMDLNQSAVDWM 618

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGG 225
           +   P   D   R   G     G L   RM+                        LLSGG
Sbjct: 619 STAFPGKTDEEYRRHLGAFGISGSLGIQRMQ------------------------LLSGG 654

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           +  R A A  C+ +  + + DEPS++LD    L+A  ++ +L   +  V+ V HD+SV++
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISVIN 711

Query: 286 YLSDFVCILYG 296
            + + + +  G
Sbjct: 712 SVCNEIWVSEG 722

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN------YF 156
           G+  GLVG NGIGKST LK L+ +++ N+ +       ++ I+      LQ+      + 
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALS-RRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWR 283

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLR--MEKPQDTVKQYIKTLQLDHL 214
            ++L ++ K   + Q ++NL +       +V +L   R  +E+  + + + +  ++ D  
Sbjct: 284 KQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEKLIDMESDKA 343

Query: 215 LNREIGLL-----------------SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQR 257
             R   +L                 SGG   R ++A +     D+ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVP-- 401

Query: 258 LNAALIIRSLLEPSKYVIAVEHDLSVLD 285
            + A +   L      V+ V HD + L+
Sbjct: 402 -SIAYLAEYLKTYPATVLVVSHDRAFLN 428

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 90/217 (41%), Gaps = 40/217 (18%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG--TSV 409
           ++SY +      D  L+VQ     DS I  ++G NG GKTTL+K++   +    G  +  
Sbjct: 538 SFSYKESDPLLTDVNLDVQM----DSRI-SLVGANGCGKTTLLKVMMEQLRPTKGFVSRN 592

Query: 410 PKLNVSMKPQ--------------TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLK 455
           P+L +    Q               ++  FPG   + + + + A          +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPGKTDEEYRRHLGA--------FGISGSLG 644

Query: 456 IDDIIDQEVKHLSGGELQRVAIV-LSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
           I     Q ++ LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F  
Sbjct: 645 I-----QRMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALVDALKSF-- 696

Query: 515 HNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTAT 551
                  +V HD  +   + +++ V +G   Q    T
Sbjct: 697 --NGGVLMVSHDISVINSVCNEIWVSEGGKVQRFDGT 731

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Kwal_33.15623
          Length = 562

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 88/196 (44%), Gaps = 15/196 (7%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         DD P    I    R   L  +F ++  +
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEVDGN 112

Query: 163 --DIKAIIKPQYVDNLPRAIKGPVQKVGE--LLKLRMEKPQDTVKQYIKTLQLDHLLNRE 218
              ++ ++K  Y D +   ++ P+       + +L      +  +Q         +L R 
Sbjct: 113 LLAVEVLLKSLYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRP 172

Query: 219 IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
             LLSGGE  +  +    + + D  + DEP+++LD K        +R     +  V+ V 
Sbjct: 173 FRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF---NGTVVMVT 229

Query: 279 HDLSVLDYLSDFVCIL 294
           HD ++++ +S F+  L
Sbjct: 230 HDRALINAVSSFISEL 245

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 70/183 (38%), Gaps = 20/183 (10%)

Query: 374 FSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLF 433
            +  E LV+ G NG GKTTL ++L   I  D GT      VSM    +          L 
Sbjct: 390 LTKGERLVIQGPNGCGKTTLNRILMAHIKPDHGT------VSMSGNAVVGYLDQEQENLP 443

Query: 434 FKKIRAQFLNPQFQTDVVKPLKIDDIID----------QEVKHLSGGELQRVAIVLSLGI 483
            +K   Q L    + D  +   I ++ D            ++ LS G  ++  +   +  
Sbjct: 444 LEKSPIQLLEEDPKIDASRQTAIRNLRDFGIYKWHDLKSPLRDLSVGCRRKTQLCQIIMR 503

Query: 484 PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGT 543
              I ++DEP+ ++D        +VI   +L          HD      +A ++I F   
Sbjct: 504 KCSILVLDEPTNHID----FPSLEVIEDALLAFPGIIVATTHDRYFTEKVATRIIDFSKY 559

Query: 544 PSQ 546
            S+
Sbjct: 560 SSE 562

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 35/175 (20%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADD----GTSVPKLNVSMKPQT--------------I 421
           + ++GENG GKTT +KLL+G    DD    G+   +  +   PQ               +
Sbjct: 64  VTIVGENGIGKTTFLKLLSG---VDDYPFSGSIEIEGRIGFLPQHFEEVDGNLLAVEVLL 120

Query: 422 APKFPGTVRQLF------FKKIRAQFLNPQFQTDVVKPLKI----DDIIDQEVKHLSGGE 471
              +   + +        F     Q LN     ++ + +       +I+ +  + LSGGE
Sbjct: 121 KSLYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRPFRLLSGGE 180

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
             +  +     +  D  L+DEP+ +LD++        +R+F      T  +V HD
Sbjct: 181 KTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF----NGTVVMVTHD 231

>Scas_288.1
          Length = 494

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 97/214 (45%), Gaps = 22/214 (10%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQNY 155
            G+++ ++G  G G S+ LK+ AG+     G       +D  P+  E++K +R   + N 
Sbjct: 72  AGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN- 129

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLL 215
               L+     +   Q +D    A K P ++V ++ K   E  + T + Y     L H  
Sbjct: 130 --GELDVHFPYLTVQQTLD-FAIACKTPAKRVNDVSK--EEYIKSTRELYATIFGLRHTY 184

Query: 216 NREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR---SL 267
           N ++G      +SGGE +R +IA +   +  +Y +D  +  LD    L  A  IR   +L
Sbjct: 185 NTKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNL 244

Query: 268 LEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           L+ + +V   +   ++ +   D V +LY    +Y
Sbjct: 245 LKSTAFVTIYQASENIYETF-DKVTVLYSGRQIY 277

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR  I+ N  K TAF
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIR--IMTNLLKSTAF 250

Query: 522 IV 523
           + 
Sbjct: 251 VT 252

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 120/301 (39%), Gaps = 40/301 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P  +E +  +            +E 
Sbjct: 456 GRRYGLCGPNGAGKSTLMRAIAN------GQVDGFPTPEECMTVY------------VEH 497

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLL 222
           DI        V +              ++   +   +    + ++    + ++N  I  L
Sbjct: 498 DIDGTHADTSVLDF-------------VVSSEVGTKEAITAKLVEFGFTEEMINMPISSL 544

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLS 282
           SGG   + A+A + +++AD+ + DEP+++LD    +N A ++  L       + V HD  
Sbjct: 545 SGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSVIVSHDSG 601

Query: 283 VLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQF--RXXX 340
            LD +  ++    G+        L   V++         + + ++ F+     +      
Sbjct: 602 FLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAQSYYELGASDLEFKFPEPGYLEGVKT 661

Query: 341 XXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGA 400
                       + YP   + Q    ++  S + S S  + ++G NG GK+TLI +L G 
Sbjct: 662 KQKAIVKVSNMTFQYPGTSKPQ----ISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGE 717

Query: 401 I 401
           +
Sbjct: 718 L 718

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 71/161 (44%), Gaps = 6/161 (3%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQF 441
           + G NG GK+TL++ +A      DG   P+  +++  +            L F       
Sbjct: 461 LCGPNGAGKSTLMRAIANG--QVDGFPTPEECMTVYVEHDIDGTHADTSVLDFVVSSEVG 518

Query: 442 LNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQ 501
                   +V+    +++I+  +  LSGG   ++A+  ++   ADI L+DEP+ +LD+  
Sbjct: 519 TKEAITAKLVEFGFTEEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT-- 576

Query: 502 RIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG 542
             +    +  ++     T+ IV HD      +   +I ++G
Sbjct: 577 --VNVAWLVNYLNTCGITSVIVSHDSGFLDNVCQYIIHYEG 615

>Scas_716.81
          Length = 1565

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 95/199 (47%), Gaps = 26/199 (13%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGR----FDDPPEWQEI 143
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   +    +D  P+ +E+
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQ-KEM 289

Query: 144 IKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVK 203
           +K+++   + N     L+     +   Q +D    A K P ++V  +   R E  + + +
Sbjct: 290 MKHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNI--SRDEYIKSSRE 343

Query: 204 QYIKTLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
            Y     L H  N ++G      +SGGE +R +IA +   +  +Y +D  +  LD    L
Sbjct: 344 LYATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTAL 403

Query: 259 NAALIIR---SLLEPSKYV 274
             A  IR   +LL  + +V
Sbjct: 404 EYAKAIRIMTNLLGSTAFV 422

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR        TAF+
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFV 422

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 82/185 (44%), Gaps = 20/185 (10%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF--RGSELQNYFTKM 159
            PG +  L+G +G GK+T L  LA + +  +   D     + +   F  R   +Q     +
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGDMLVNGRPVDASFERRTGYVQQQDIHI 999

Query: 160  LEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREI 219
             E  ++  +  Q+   + R+     + V +  KL        V++ I+ L+++   +  +
Sbjct: 1000 AELTVRESL--QFSARMRRS-----EHVSDEEKLAY------VEKIIRVLEMEEFADALV 1046

Query: 220  GLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQRLNAALIIRSLLEPSKYV 274
            G +  G    + ++ +I +  V   D+ +F DEP+S LD +       ++R L +  + +
Sbjct: 1047 GAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLAQAGQSI 1106

Query: 275  IAVEH 279
            +   H
Sbjct: 1107 LCTIH 1111

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 78/168 (46%), Gaps = 23/168 (13%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPADDGTSVPKLNVSMKPQT- 420
            L+  SG      +  +MGE+G GKTTL+  LA     G +  D   +   ++ S + +T 
Sbjct: 931  LDHVSGYCVPGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGDMLVNGRPVDASFERRTG 990

Query: 421  --------IAPKFPGTVRQLFFKKIRAQFLNPQ----FQTDVVKPLKIDDIIDQEVKHLS 468
                    IA        Q   +  R++ ++ +    +   +++ L++++  D  V  + 
Sbjct: 991  YVQQQDIHIAELTVRESLQFSARMRRSEHVSDEEKLAYVEKIIRVLEMEEFADALVGAIG 1050

Query: 469  GG----ELQRVAIVLSLGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 511
             G    + ++++I + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 1051 CGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRK 1098

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 99/211 (46%), Gaps = 32/211 (15%)

Query: 353  YSYPDMKRTQ--GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD------ 404
            ++YP  K  Q   +F L +  G       + ++GE+G+GK+TL  L+ G  P        
Sbjct: 1053 FAYPAAKDVQIYKNFNLRINQGT-----KVAIVGESGSGKSTLFYLICGLYPVKPASLFI 1107

Query: 405  DGTSVPKLNVSMKPQTIA-----PKF-PGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDD 458
            DGT +    +S   + IA     P+F  GT+R+     +     + +   +V+  ++I +
Sbjct: 1108 DGTDICNWEMSALRKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIY-EVLAEVRIIN 1166

Query: 459  IIDQ---------EVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVI 509
             +           +   +SGG+LQR++IV +L     + ++DE ++ LD+      + V+
Sbjct: 1167 FVRSLPEGLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVV 1226

Query: 510  RRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
            R   LH+  T  ++ H   M   + D+++V 
Sbjct: 1227 RNS-LHD-ITVIVITHSKQMMK-MCDRIVVL 1254

 Score = 36.2 bits (82), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 85/198 (42%), Gaps = 28/198 (14%)

Query: 99  TPRPGQVLGLVGTNGIGKSTA----LKILAGKQ------KPNLGRFDDPPEWQEIIKYFR 148
           T RP Q+  +VG +G GKST     LK  +  +        NL   D     Q I    +
Sbjct: 383 TFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQ 442

Query: 149 GSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKT 208
              L   F   L ++I    KP  V+    A+K   Q +  L KL  + P+         
Sbjct: 443 SCTL---FNGTLFENITLSAKP--VNKTAGAVKRACQ-MALLEKLVFDLPEG-------- 488

Query: 209 LQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
             L   +      +SGG+ QR A+A + ++DA V + DE  S LD+  R     +IRS  
Sbjct: 489 --LHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRS-W 545

Query: 269 EPSKYVIAVEHDLS-VLD 285
              K  I + H+LS VLD
Sbjct: 546 RADKTTIILTHELSHVLD 563

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 83/188 (44%), Gaps = 30/188 (15%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQ--KPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            G  + +VG +G GKST   ++ G    KP    F D            G+++ N+    L
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICGLYPVKPA-SLFID------------GTDICNWEMSAL 1120

Query: 161  EDDIKAI-IKPQYV-----DNLPRAIKGPV--QKVGELLKLRMEKPQDTVKQYIKTLQLD 212
               I  +  KP++      +NL   ++G +   ++ E+L       +  +  ++++L   
Sbjct: 1121 RKIIAVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVL------AEVRIINFVRSLPEG 1174

Query: 213  HLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSK 272
                 +  L+SGG+LQR +I  + ++   + + DE +S LD       A ++R+ L    
Sbjct: 1175 LETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSLHDIT 1234

Query: 273  YVIAVEHD 280
             VI + H 
Sbjct: 1235 -VIVITHS 1241

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 18/156 (11%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         RF DP   + +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 DIKAIIK--PQYVDNLPRAIK-GPVQKVGELLKLRMEKPQDTVKQYIKTL--QLDHLLNR 217
            I  + +  P + D +   +K G +    E +   +EK Q  +   IK L    D ++  
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEKAQ--LAPLIKKLPQGFDTIVGE 568

Query: 218 EIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
              ++SGGE QR AIA   +++A +  FDE +S LD
Sbjct: 569 RGLMISGGEKQRLAIARVLLKNARIMFFDEATSALD 604

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 82/184 (44%), Gaps = 28/184 (15%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPADDGTSVPKLNVSMKPQTIA------PKFPGT 428
           ++G +G+GK+T++KL+       +G I  + G  + + ++    + I       P F  T
Sbjct: 467 IVGSSGSGKSTILKLVFRFYDPESGRILIN-GRDIKEYDIDALRKVIGVVPQDTPLFNDT 525

Query: 429 VRQ-LFFKKIRAQFLNPQFQTDVVK----------PLKIDDIIDQEVKHLSGGELQRVAI 477
           + + + F +I A   + +  T V K          P   D I+ +    +SGGE QR+AI
Sbjct: 526 IWENVKFGRIDAT--DEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAI 583

Query: 478 VLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKV 537
              L   A I   DE ++ LD+       + IR       +T+  + H  +     ADK+
Sbjct: 584 ARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHR-LRTIADADKI 642

Query: 538 IVFD 541
           IV D
Sbjct: 643 IVLD 646

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 95/219 (43%), Gaps = 40/219 (18%)

Query: 88  SANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRFD----DPP 138
           S  +F++H      PG+ +  VG +G GKST   +L      G    ++G +D    +  
Sbjct: 383 SEMNFQIH------PGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLR 436

Query: 139 EWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKP 198
           +++ ++   +   L   F   + D+I   +  + + +L  A+K                 
Sbjct: 437 KYRRMLGVVQQEPL--LFNGTILDNITYGLHDKSLTDLNMALKAA--------------- 479

Query: 199 QDTVKQYIKT--LQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQ 256
                Q+IK   + LD L+      LSGG+ QR A+A   +Q+ D+ + DE +S LD K 
Sbjct: 480 --NCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKS 537

Query: 257 R--LNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCI 293
              +N  L  R   E     I++ H LS + + S  + I
Sbjct: 538 EDIINKELQRRQ--EAGMTTISIAHRLSTIRHSSRVIVI 574

 Score = 36.2 bits (82), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (41%), Gaps = 26/181 (14%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT-SVP 410
           +++Y + K    +    +  GE      +  +G +G GK+T+  LL        G  S+ 
Sbjct: 372 SFAYSNGKSVLSEMNFQIHPGEH-----VCFVGGSGCGKSTISSLLLRYYRTGSGNISIG 426

Query: 411 KLNVSMKPQTIAPKFPGTVRQ---LFFKKIRAQF---LNPQFQTDVVKPLK--------- 455
             ++S        +  G V+Q   LF   I       L+ +  TD+   LK         
Sbjct: 427 NYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTDLNMALKAANCDQFIK 486

Query: 456 -----IDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
                +D ++      LSGG+ QR+A+        DI ++DE ++ LD++   I +K ++
Sbjct: 487 ESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQ 546

Query: 511 R 511
           R
Sbjct: 547 R 547

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 120/305 (39%), Gaps = 44/305 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
           R  +  GL G NG GKST ++ +A       G+ D  P   E    +            +
Sbjct: 454 RRARRYGLCGPNGAGKSTLMRAIAN------GQVDGFPTQDECRTVY------------V 495

Query: 161 EDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL-DHLLNREI 219
           E DI        V  L    +G V              ++ + + ++     D ++   I
Sbjct: 496 EHDIDGTQADTSV--LDFVFQGDV------------GTREVITEKLREFGFSDEMIAMPI 541

Query: 220 GLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEH 279
             LSGG   + A+A + +++AD+ + DEP+++LD    +N A ++  L       I V H
Sbjct: 542 MSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVSH 598

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQF--R 337
           D   LD +  ++    G+        L   V++         + + ++ F+     F   
Sbjct: 599 DSGFLDNVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASDLEFKFPEPGFLEG 658

Query: 338 XXXXXXXXXXXXTRAYSYPDMKRTQ-GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKL 396
                         ++ YP   + Q  D  +N Q    S S  + ++G NG GK+TLI +
Sbjct: 659 VKTKQKAIVKVSNMSFQYPGTSKPQIAD--INFQC---SLSSRIAVIGPNGAGKSTLINV 713

Query: 397 LAGAI 401
           L G +
Sbjct: 714 LTGEL 718

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 72/172 (41%), Gaps = 28/172 (16%)

Query: 382 MMGENGTGKTTLIKLLAGA----IPADDGTSVPKL-----NVSMKPQTIAPKFPGTV--R 430
           + G NG GK+TL++ +A       P  D      +             +   F G V  R
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQDECRTVYVEHDIDGTQADTSVLDFVFQGDVGTR 520

Query: 431 QLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLI 490
           ++  +K+R    +             D++I   +  LSGG   ++A+  ++   ADI L+
Sbjct: 521 EVITEKLREFGFS-------------DEMIAMPIMSLSGGWKMKLALARAVLKNADILLL 567

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG 542
           DEP+ +LD+    +    +  ++     T+ IV HD      +   +I ++G
Sbjct: 568 DEPTNHLDT----VNVAWLVNYLNTCGITSIIVSHDSGFLDNVCQYIIHYEG 615

>Scas_574.8
          Length = 702

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 20/210 (9%)

Query: 82  HVTHRYSANSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEW 140
           +VT  Y +    L+      PG +   +VG +G GKST LK++         RF DP + 
Sbjct: 440 NVTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQG 491

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIK--PQYVDNLPRAIK-GPVQKVGELLKLRMEK 197
           + +I    G +++ Y    L   +  + +  P + D +   +K G +    E +   +EK
Sbjct: 492 RILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIEK 548

Query: 198 PQDTVKQYIKTL--QLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
            Q  +   IK L    + ++     ++SGGE QR AIA   +++A +  FDE +S LD  
Sbjct: 549 AQ--LAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTH 606

Query: 256 QRLNAALIIRSLLEP-SKYVIAVEHDLSVL 284
                   IR+  E  S+  + + H L  +
Sbjct: 607 TEQALLTTIRANFESGSRTSVYIAHRLRTI 636

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   + I+ +    +SGGE QR+AI   L   A I   DE ++ LD+         IR  
Sbjct: 559 PQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRAN 618

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVF-DGTPSQNTTATA----PESLLTGCNRFLKNL 567
                +T+  + H  +     ADK+IV  DG   +  T +     P SL        +NL
Sbjct: 619 FESGSRTSVYIAHR-LRTIADADKIIVLEDGAVKEEGTHSGLLATPGSLYANLWNIQENL 677

Query: 568 NV 569
           +V
Sbjct: 678 DV 679

>Scas_566.1
          Length = 466

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 100/224 (44%), Gaps = 24/224 (10%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRG 149
           NSF L  LP+   G V+ ++G +G GK+T L +LA K    L + D    +    K  R 
Sbjct: 68  NSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGL-KTDGDIHYILEEKPQRD 122

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQD--TVKQYIK 207
           SE +    + ++D +K    PQ      R            LKL   K +    V Q I 
Sbjct: 123 SEQE----QEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIH 178

Query: 208 TLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAAL 262
            L L       +G      LSGGE +R ++    + +  +   DEP++ LD     +A L
Sbjct: 179 ELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDA---YSAYL 235

Query: 263 IIRSLLEPSK-----YVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           ++++L + +K     +++++    S + +L D VCIL     VY
Sbjct: 236 VVKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 84/207 (40%), Gaps = 43/207 (20%)

Query: 365 FTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAI-----------------PADDGT 407
           F+L++ SG      ++ +MG +G+GKTTL+ +LA  I                 P  D  
Sbjct: 70  FSLDLPSGS-----VMAVMGGSGSGKTTLLNVLASKISGGLKTDGDIHYILEEKPQRDSE 124

Query: 408 SVPKLNVSMK----PQTIAPKFPGTVRQLF-----FKKIRAQFLNPQFQTDVVKPLKIDD 458
              ++   +K    PQ        T R+        K  R++         ++  L + D
Sbjct: 125 QEQEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIHELGLKD 184

Query: 459 -----IIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 513
                + D   + LSGGE +R+++   +     I  +DEP+  LD+    +  K +++  
Sbjct: 185 CAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLA 244

Query: 514 LHNKKTAFIVEHDFIMATYLADKVIVF 540
             + +T       FIM+ +     I+F
Sbjct: 245 KEDGRT-------FIMSIHQPRSDILF 264

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 95/221 (42%), Gaps = 19/221 (8%)

Query: 90  NSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF- 147
           +S  +H L    P G V+ ++G +G GK+T L +LA K    L    +     E  K   
Sbjct: 34  DSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNV 93

Query: 148 --RGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDT--VK 203
               SE         ++++     PQ      R            LKL   K + T  V 
Sbjct: 94  DDSSSEASFDLNATYKENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVN 153

Query: 204 QYIKTLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
           Q I  L L    +  +G      LSGGE +R ++    V +  V   DEP++ LD     
Sbjct: 154 QLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDA---Y 210

Query: 259 NAALIIRSLLEPSK-----YVIAVEHDLSVLDYLSDFVCIL 294
           +A L++++L + +K     +++++    S + +L D+VCIL
Sbjct: 211 SAYLVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 99/235 (42%), Gaps = 39/235 (16%)

Query: 70  ITIINLPTNLESHVTHRYSANSFKLHRLPTPR----------PGQVLGLVGTNGIGKSTA 119
           IT++    +LE   T  Y+  + K+      +          PG +  ++G +G GKS+ 
Sbjct: 669 ITVVAQDVDLEVKYTKLYNRKNHKIFEYENKKILQNVSAVFKPGMINAIMGPSGSGKSSF 728

Query: 120 LKILAGKQKPNLG---------RFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKP 170
           L +++G+ + +L          + +D P  Q++ K+      Q+      +D + A++  
Sbjct: 729 LNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYVSQD------DDHLLAMLTV 782

Query: 171 QYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGL-----LSGG 225
           +   +   A++        L  L  +  +      I  L L H  N  IG      +SGG
Sbjct: 783 RETFDFAAALR--------LKHLSKDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGG 834

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLL-EPSKYVIAVEH 279
           E +R ++ +  + D  + + DEP+S LD         I+ +L  E +K VI   H
Sbjct: 835 EKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSEHNKTVILTIH 889

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 76/187 (40%), Gaps = 35/187 (18%)

Query: 371 SGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD-----DGTSVPKLNVSMKPQTIAPKF 425
           S  F    I  +MG +G+GK++ + L++G + +      +     KLN +   Q +    
Sbjct: 706 SAVFKPGMINAIMGPSGSGKSSFLNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHL 765

Query: 426 PGTVRQ-----LFFKKIRAQFLNPQFQTDV-VKPLKIDD--------------------I 459
              V Q     L    +R  F    F   + +K L  DD                    I
Sbjct: 766 CSYVSQDDDHLLAMLTVRETF---DFAAALRLKHLSKDDKRSRTDSLIAILGLKHCENTI 822

Query: 460 IDQE-VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK 518
           I  E +K +SGGE +RV++ + L     I L+DEP++ LDS       +++      + K
Sbjct: 823 IGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSEHNK 882

Query: 519 TAFIVEH 525
           T  +  H
Sbjct: 883 TVILTIH 889

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/186 (19%), Positives = 72/186 (38%), Gaps = 39/186 (20%)

Query: 379 ILVMMGENGTGKTTLIKLLAGAIPA-------------------DDGTSVPK--LNVSMK 417
           ++ +MG +G+GKTTL+ +LA  I +                   DD +S     LN + K
Sbjct: 50  VMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSSSEASFDLNATYK 109

Query: 418 PQTIAPKFPG--------TVRQLFFKKIRAQFLNPQFQTDVVKPLKIDD----------I 459
                   P         T R+        +    + +  ++    ID+          +
Sbjct: 110 ENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVNQLIDELGLKDCADTLV 169

Query: 460 IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            D   + LSGGE +R+++   +     +  +DEP+  LD+    +  K +++    + +T
Sbjct: 170 GDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRT 229

Query: 520 AFIVEH 525
             +  H
Sbjct: 230 FILSIH 235

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 99/215 (46%), Gaps = 26/215 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ ++G +G GK+T L +LAGK   ++  +D        I+Y R +  +       ++
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-NYDGE------IQYSRDAAKEG---SKADE 90

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQ--DTVKQYIKTLQLDHLLNREIG 220
            +      Q+     R       ++   LKL + K +    V++ I  L L       +G
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 221 -----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKY-- 273
                 LSGGE +R +IA+  + +  V   DEP++ LD     +A L+I++L +  ++  
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDA---YSAFLLIKTLKKLCEHGG 207

Query: 274 ---VIAVEHDLSVLDYLSDFVCILY-GVPSVYGVV 304
              ++++    S + +  D VC+L  G P   G V
Sbjct: 208 RTIIMSIHQPRSDILFALDQVCLLSKGFPMYCGAV 242

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 26/185 (14%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAI---------------PADDGTSV-P 410
           +N  S    + +++ ++G +G+GKTT++ +LAG                  A +G+    
Sbjct: 31  VNNVSFSLPNGQLMAIIGGSGSGKTTMLNVLAGKTNSSINYDGEIQYSRDAAKEGSKADE 90

Query: 411 KLNVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQ-----FQTDVVKPLKIDD-----II 460
           K+  +   Q  A     T R+        +   P+        +++  L + D     + 
Sbjct: 91  KVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFVG 150

Query: 461 DQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           D   K LSGGE +R++I + +     +  +DEP+  LD+    +  K +++   H  +T 
Sbjct: 151 DSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLKKLCEHGGRTI 210

Query: 521 FIVEH 525
            +  H
Sbjct: 211 IMSIH 215

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 81/189 (42%), Gaps = 20/189 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRFDDPP----EWQEIIKYFRGSELQNY 155
           RP  +  ++G +G GK++ L +++ +   N   +F++        Q ++K    S  ++ 
Sbjct: 683 RPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNESGRIIFNQQPVMK----SMFKSV 738

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLL 215
              + +DD   +      + L  A +  +    E       + +  V+  I  L L +  
Sbjct: 739 CCYVSQDDNHLLPNLTVYETLKYAARLRLSHHNE------SRIETRVRTLISDLGLKNCA 792

Query: 216 NREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEP 270
           N  +G      +SGGE +R +I +  + D  V + DEP+S LD         +++ L + 
Sbjct: 793 NTLVGNDLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDSFTSSTIIELLKKLCQQ 852

Query: 271 SKYVIAVEH 279
            K +I   H
Sbjct: 853 GKTIILTIH 861

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
           +K +SGGE +RV+I + L     + L+DEP++ LDS
Sbjct: 801 IKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDS 836

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 81/181 (44%), Gaps = 31/181 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P  +             YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN-REIGLLSG 224
             +    VD + +   G              K  +  ++++ +  +   L  +++ LLSG
Sbjct: 610 --LSTSAVDWMSKTFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
           G+  R A A  C+ +  + + DEPS++LD         ++ ++   +  ++ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVI 710

Query: 285 D 285
           +
Sbjct: 711 N 711

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 27/207 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRFDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 141 QEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGE-LLKLRMEKPQ 199
           Q + +  + +E      K+ E+  +  ++ + +DN    +   + ++ E L+ +  +K +
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKLVDMESDKAE 344

Query: 200 DTVKQYIKTLQLDHLLNRE-IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
                 +  L       ++     SGG   R ++A +     D+ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 259 NAALIIRSLLEPSKYVIAVEHDLSVLD 285
             A  ++S   PS  V+ V HD + L+
Sbjct: 405 YLAEYLKSY--PST-VLTVSHDRAFLN 428

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  +L    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 522 IVEHDFIMATYLADKVI 538
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 87/203 (42%), Gaps = 31/203 (15%)

Query: 212 DHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPS 271
           D ++   I  LSGG   + A+A + +++AD+ + DEP+++LD    +N A ++  L    
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 590

Query: 272 KYVIAVEHDLSVLDYLSDFVCILYGVP--SVYGVVT-------LPSSVREGINIFLDGHI 322
              I + HD   LD + +++    G+      G  T          +  E  N  L+   
Sbjct: 591 ITSITISHDSVFLDNVCEYIINYEGLKLRKYKGNFTEFVKKCPAAKAYEELSNTDLEFKF 650

Query: 323 PS----ENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSE 378
           P     E ++ + +A+                  + YP   + Q    +N Q    S S 
Sbjct: 651 PEPGYLEGVKTKQKAI-----------VKVTNMEFQYPGTSKPQIT-DINFQC---SLSS 695

Query: 379 ILVMMGENGTGKTTLIKLLAGAI 401
            + ++G NG GK+TLI +L G +
Sbjct: 696 RIAVIGPNGAGKSTLINVLTGEL 718

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  ++   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDG 542
             T+  + HD +    + + +I ++G
Sbjct: 590 GITSITISHDSVFLDNVCEYIINYEG 615

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKEF----EGGVI 947

Query: 522 IVEHDFIMATYLADKVI-VFDG--TPS 545
           I+ H       L ++V  V DG  TPS
Sbjct: 948 IITHSAEFTKNLTEEVWAVKDGRMTPS 974

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL 281
           LSGG+  +  +A    Q   + + DEP++YLD   R +   + ++L E    VI + H  
Sbjct: 897 LSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD---RDSLGALSKALKEFEGGVIIITHSA 953

Query: 282 SVLDYLSDFV 291
                L++ V
Sbjct: 954 EFTKNLTEEV 963

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
            transporter responsible for export of a factor mating
            pheromone, member of ATP-binding cassette (ABC)
            superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 75/155 (48%), Gaps = 22/155 (14%)

Query: 378  EILVMMGENGTGKTTLIKLLAGAIPAD------DGTSVPKLNVSMKPQTIAPK------F 425
            + L ++GE+GTGK+TL+ LL      +      DGT V   N++   + I+        F
Sbjct: 1081 QTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLF 1140

Query: 426  PGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQ---------EVKHLSGGELQRVA 476
             GT+R      ++ + L  +   D +K + I D +           +   LSGG+ QR+ 
Sbjct: 1141 NGTIRDNLTYGLQDEILEIEMY-DALKYVGIHDFVISSPQGLDTRIDTTLLSGGQAQRLC 1199

Query: 477  IVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR 511
            I  +L   + I ++DE ++ LDS    I ++++++
Sbjct: 1200 IARALLRKSKILILDECTSALDSVSSSIINEIVKK 1234

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 84/209 (40%), Gaps = 40/209 (19%)

Query: 352 AYSYPD--MKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT-S 408
           ++SYP    +    + +LN  +G+F+      ++G++G+GK+TL  LL       +G+ S
Sbjct: 363 SFSYPSRPSEAVLKNVSLNFSAGQFT-----FIVGKSGSGKSTLSNLLLRFYDGYNGSIS 417

Query: 409 VPKLNVSMKPQTIAPKFPGTVRQ---LFFKKIRAQFL----------------NPQFQTD 449
           +   N+    Q +  +    V Q   LF   +R   L                N     D
Sbjct: 418 INGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKD 477

Query: 450 VVK-----------PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLD 498
             +           P  ++ +I      LSGG+ QRVAI  +      I  +DE  + LD
Sbjct: 478 ACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALD 537

Query: 499 SEQRIICSKVIRRFILHNKKTAFIVEHDF 527
              R +  K IR +     KT  I+ H+ 
Sbjct: 538 IVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 23/158 (14%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
            GQ LG++G +G GKST + +L       +G+               G+++ ++    L  
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIK-----------IDGTDVNDWNLTSLRK 1128

Query: 163  DIKAIIKPQYV------DNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQ-LDHLL 215
            +I  + +   +      DNL   ++  + ++     L+     D V   I + Q LD  +
Sbjct: 1129 EISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFV---ISSPQGLDTRI 1185

Query: 216  NREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
            +    LLSGG+ QR  IA + ++ + + + DE +S LD
Sbjct: 1186 DTT--LLSGGQAQRLCIARALLRKSKILILDECTSALD 1221

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL--LEPSKYVIAVEH 279
           LSGG+ QR AIA + ++D  +   DE  S LD+  R    L+++++      K  I + H
Sbjct: 506 LSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHR---NLLMKAIRHWRKGKTTIILTH 562

Query: 280 DLSVL---DYL 287
           +LS +   DYL
Sbjct: 563 ELSQIESDDYL 573

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 88/182 (48%), Gaps = 42/182 (23%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKP------QTIAPKFPGTVRQL-- 432
           ++GENG GK+T +K +A    P  +   +  L+   +P      + +  +  G +++L  
Sbjct: 109 LLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGELKRLED 168

Query: 433 FFKKIRAQFLNPQFQTDVVKPL--KIDDI----------------------IDQEVKHLS 468
             +KI    L    ++D+++PL  ++DD+                      I+++ K +S
Sbjct: 169 LVEKI---LLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTINKKTKDMS 225

Query: 469 GGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--D 526
           GG   RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  D
Sbjct: 226 GGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQD 281

Query: 527 FI 528
           F+
Sbjct: 282 FL 283

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR       +  + Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGV-YSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGG 225
                   D  P   +      G+L +  +     TV               ++G LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQLGRYGLTGEGQTV---------------QMGTLSEG 516

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           +  R   A+  ++  +V + DEP++ LD+    + A  I    E +  V+ V HD  +LD
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIN---EFNGGVVVVSHDFRLLD 573

Query: 286 YLSDFVCIL 294
            ++  + ++
Sbjct: 574 KIAKDIFVV 582

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 77/170 (45%), Gaps = 33/170 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE------IIKYFRGSE 151
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E      +++  +G  
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL 211
                 K LED ++ I+             GP   + E L  RM+    +  +    + L
Sbjct: 163 -----LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIIL 207

Query: 212 DHL------LNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
             L      +N++   +SGG   R A+A +      + + D+P+++LD++
Sbjct: 208 IGLGFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 85/213 (39%), Gaps = 46/213 (21%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGT----SVPKLNV-SMKPQT---------- 420
           DS I  ++G NG GK+TL+K++ G +    G     S  KL V S   Q           
Sbjct: 418 DSRI-ALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVKLGVYSQHSQDQLDLTKSALE 476

Query: 421 -IAPKFPGTVRQLFFKKIRAQF----LNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRV 475
            +  K+P   +   F+  R Q     L  + QT              ++  LS G+  RV
Sbjct: 477 FVRDKYPHVSQD--FQYWRGQLGRYGLTGEGQT-------------VQMGTLSEGQRSRV 521

Query: 476 AIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLAD 535
              L      ++ L+DEP+  LD       +  I  F         +V HDF +   +A 
Sbjct: 522 VFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAK 577

Query: 536 KVIVFDGTPSQNTTATAPE-SLLTGCNRFLKNL 567
            + V      ++ TAT  + S+L   N+  KN+
Sbjct: 578 DIFVV-----EHKTATRWDGSILDYKNKLAKNV 605

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 114/298 (38%), Gaps = 42/298 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
           GL G NG GKST ++ +A       G+ D  P  +E    +            +E DI  
Sbjct: 460 GLCGPNGAGKSTLMRAIAN------GQVDGFPTQEECRTVY------------VEHDIDG 501

Query: 167 IIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL-DHLLNREIGLLSGG 225
                 V +      G V              +D +   ++     D ++   I  LSGG
Sbjct: 502 TQADTSVVDF--VFSGNVGT------------KDVITDKLREFGFSDEMIAMPIASLSGG 547

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
              + A+A + +++AD+ + DEP+++LD    +N   ++  L       I V HD   LD
Sbjct: 548 WKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVSHDSGFLD 604

Query: 286 YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQF--RXXXXXX 343
            +  ++    G+        L   V++         + +  + FR     +         
Sbjct: 605 KVCQYIIHYEGLKLRKYKGNLSEFVKKCPTAKSYYELGASELEFRFPEPGYLEGVKTKQK 664

Query: 344 XXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAI 401
                    + YP   + Q    ++  S + S S  + ++G NG GK+TLI +L G +
Sbjct: 665 AIVKVSNMTFQYPGTAKPQ----ISDISFQCSLSSRIAVIGPNGAGKSTLINVLTGEL 718

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 69/162 (42%), Gaps = 8/162 (4%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQF 441
           + G NG GK+TL++ +A        T      V ++      +   +V    F       
Sbjct: 461 LCGPNGAGKSTLMRAIANGQVDGFPTQEECRTVYVEHDIDGTQADTSVVDFVFS---GNV 517

Query: 442 LNPQFQTDVVKPLKI-DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
                 TD ++     D++I   +  LSGG   ++A+  ++   ADI L+DEP+ +LD+ 
Sbjct: 518 GTKDVITDKLREFGFSDEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT- 576

Query: 501 QRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG 542
              +    +  ++     T+ IV HD      +   +I ++G
Sbjct: 577 ---VNVNWLVEYLNTCGITSIIVSHDSGFLDKVCQYIIHYEG 615

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 11/97 (11%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ LSGG  Q+V +VL+       +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 947

Query: 522 IVEHDFIMATYLADKVI-VFDG--TPSQNTTATAPES 555
           I+ H       L ++V  V DG  TPS +   T   S
Sbjct: 948 IITHSAEFTKNLTEEVWAVKDGRMTPSGHNWVTGQGS 984

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 85/234 (36%), Gaps = 88/234 (37%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RFDDPPEWQE 142
           + ++G NG GKST + +L G+  P +G                         D  P   E
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTVGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSELQNYFTK----MLEDDIKAIIKPQYVDNLPRAIKGPVQK----------- 186
            I++ F+  E +    +    + EDD +A+ K   +D  PR I G   +           
Sbjct: 755 YIQWRFQTGEDRETMDRANRVINEDDAEAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 187 ---VGELLKLRMEK--PQDTV-----------------------KQYIKTLQLDHLLNRE 218
              +GE + ++ E+  P  +V                       K+ + + Q   L  +E
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 219 I-------GL------------LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           I       GL            LSGG+  +  +A    Q   + + DEP++YLD
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 928

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 81/198 (40%), Gaps = 25/198 (12%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPK 411
            Y     K    D  LN  +G     E+L +MG +G GKTTL+ +LA        T   K
Sbjct: 376 TYEVSPAKNVTAD-VLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIK 434

Query: 412 LNVSMKPQTIAPKFPGTVRQ---------LFFKKIRAQFLNPQFQT----------DVVK 452
           +N     +    K  G V Q         ++   + +  L    Q           DV++
Sbjct: 435 VNGVDIDKDKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLE 494

Query: 453 PLKIDDIIDQEV-----KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSK 507
            L+I DI D+ +     + +SGGE +RV+I   L     +  +DEP++ LD+       +
Sbjct: 495 ELRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVIE 554

Query: 508 VIRRFILHNKKTAFIVEH 525
            + R   H  KT  +  H
Sbjct: 555 CLVRLANHYNKTLVLSIH 572

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 81/186 (43%), Gaps = 34/186 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K           G   D  ++ +II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLD 212
           ++Y    L   +   +    +  LPR             +L     Q  V   ++ L++ 
Sbjct: 455 EDYLLPTLT--VYETVLNSALLRLPR-------------QLSFSAKQRRVYDVLEELRIF 499

Query: 213 HLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL 267
            + +R IG      +SGGE +R +IA   V    V   DEP+S LD     NA  +I  L
Sbjct: 500 DIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDAN---NANNVIECL 556

Query: 268 LEPSKY 273
           +  + +
Sbjct: 557 VRLANH 562

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RFDDPPEWQEIIKYFRGSELQNY 155
           RPG++L ++G  G G ST LK +AG+     G      +D   + ++++KYF+   + N 
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQ-KDMLKYFKSDVIYN- 226

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLL 215
               ++     +   Q +D    A K P +++ +    R +  +     Y     L H  
Sbjct: 227 --GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDF--TRQQYIEFIRDLYATIFGLKHTY 281

Query: 216 NREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR---SL 267
           N ++G      +SGGE +R +IA +      +Y +D  +  LD    L     IR   +L
Sbjct: 282 NTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNL 341

Query: 268 LEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           L+ +  +   +   ++ +   D V ILY    +Y
Sbjct: 342 LKSTALITVYQASENIYETF-DKVTILYEGKQIY 374

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 82/201 (40%), Gaps = 38/201 (18%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTS----------------------------- 408
           E+L+++G  G+G +T +K +AG +    G S                             
Sbjct: 172 EMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYFKSDVIYNGEMDV 231

Query: 409 -VPKLNVSMKPQ-TIAPKFPGTVRQLFFKKIRAQFLNPQFQTDV-VKPLKIDDIIDQEVK 465
             P L V       +A K P      F ++   +F+   + T   +K      + D  V+
Sbjct: 232 HFPHLTVQQTLDFAVACKTPSKRINDFTRQQYIEFIRDLYATIFGLKHTYNTKVGDDFVR 291

Query: 466 HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +SGGE +RV+I  +L     IY  D  +  LD+   +  ++ IR      K TA I  +
Sbjct: 292 GVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTALITVY 351

Query: 526 ---DFIMATYLADKV-IVFDG 542
              + I  T+  DKV I+++G
Sbjct: 352 QASENIYETF--DKVTILYEG 370

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 78/171 (45%), Gaps = 37/171 (21%)

Query: 371  SGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPADDGTSVPKLNVSMKPQTIAPKF 425
            SG      +  +MGE+G GKTTL+  LA     G +  D   +   ++ S + +T     
Sbjct: 860  SGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIGVVTGDMLVNGKPIDASFERRT----- 914

Query: 426  PGTVRQ--LFFKKIRAQFLNPQFQTDVVKPL------------KIDDIIDQE------VK 465
             G V+Q  +  K++  +  + QF   + +PL            K+ +I+D        V 
Sbjct: 915  -GYVQQQDVHIKEMTVR-ESLQFSARMRRPLTVPDEEKLDYVEKVIEILDMSAYGEALVG 972

Query: 466  HLSGG----ELQRVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++  G    + ++++I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 973  NIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQLLKK 1023

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 26/184 (14%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLN-VSMKPQTIAPKF 425
           LN  SG  S  EIL +MG +G GKT L+ +L     A + +   K+N V +   T++ K 
Sbjct: 384 LNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVS-KV 442

Query: 426 PGTVRQ---------LFFKKIRAQFLN-PQFQT---------DVVKPLKIDDIIDQEV-- 464
            G V Q         ++   + +  L  P+  +          V++ L+I DI D+ +  
Sbjct: 443 VGFVDQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGN 502

Query: 465 ---KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
              + +SGGE +RV+I   L     I  +DEP++ LDS       + + R     ++T  
Sbjct: 503 DFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLV 562

Query: 522 IVEH 525
           +  H
Sbjct: 563 LSIH 566

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 74/177 (41%), Gaps = 28/177 (15%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPN----LGRFDDPPEWQEIIKYFRGSELQ-NYF 156
           PG++L ++G +G GK+  L IL  K K        + +  P  +  +    G   Q N+ 
Sbjct: 393 PGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKVVGFVDQDNHL 452

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN 216
              L   +   +    +  LPR++                  Q  V Q ++ L++  + +
Sbjct: 453 LPTL--TVYETVLNSALLRLPRSMS-------------FAAKQKRVYQVLEELRIFDIRD 497

Query: 217 REIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
           R IG      +SGGE +R +IA   V    +   DEP+S LD     NA  +I  L+
Sbjct: 498 RLIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSN---NANNVIECLV 551

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 36/175 (20%)

Query: 382 MMGENGTGKTTLIKLLA-------GAIPADDGT--SVPKLNVSMKPQTIAPKFPGTVRQL 432
           ++G +G+GK+TL  L+        G+I   D    S+ + N+ ++  T+  + P     L
Sbjct: 385 VIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINR-NIILENITLVSQTP----TL 439

Query: 433 FFKKIRAQFLNPQFQTDVVKPLKID----------------DIIDQEVKH----LSGGEL 472
           F   IR   L     T++   L+++                D +D  +      LSGG+ 
Sbjct: 440 FNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQA 499

Query: 473 QRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 527
           Q+VA+  +      I L+DEP + +D  QRI+  + I+R+   N KT  I+ HD 
Sbjct: 500 QKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRW--RNGKTTVIITHDL 552

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL 281
           LSGG+ Q+ A+A +  ++  + + DEP S +D++QR+     I+      K  + + HDL
Sbjct: 494 LSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKR-WRNGKTTVIITHDL 552

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
              Q+ G+VG +G GKST + ++ G    + G  +               ++  + TK L 
Sbjct: 1019 SNQIYGIVGKSGSGKSTLINLICGLYSLSEGSIN-----------ICSCDINKWSTKELH 1067

Query: 162  DDIKAIIKP---QYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQ--LDHLLN 216
              +  + +    Q+       + G  + VG+   L + +    +K +I +L   LD  L+
Sbjct: 1068 KTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVG-LKSFIISLNNGLDSKLD 1126

Query: 217  REIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDV--KQRLNAALIIRSL 267
                LLSGG+ QR  +A   +++  V + DE +S LDV   +++N  +  RSL
Sbjct: 1127 D--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRSL 1177

>Scas_628.13
          Length = 1060

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 34/185 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       + ++I +    + 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFV---DQ 481

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLD 212
            +Y    L   +   +    +  LPR              +  E  Q  V Q ++ L++ 
Sbjct: 482 NDYLHPTLT--VYETVLNSALLRLPRT-------------MSFESKQSRVFQILEELRIF 526

Query: 213 HLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL 267
            + +R IG      +SGGE +R +IA   V    +   DEP+S LD     NA  +I SL
Sbjct: 527 DIKDRIIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSL 583

Query: 268 LEPSK 272
           +  +K
Sbjct: 584 VRLAK 588

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 67/148 (45%), Gaps = 24/148 (16%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQ------ 431
           +I  +MG +G GKTTL+ +LA            K+N ++  +    K  G V Q      
Sbjct: 428 QIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFVDQNDYLHP 487

Query: 432 ---LFFKKIRAQFL----NPQFQT------DVVKPLKIDDIIDQEV-----KHLSGGELQ 473
              ++   + +  L       F++       +++ L+I DI D+ +     + +SGGE +
Sbjct: 488 TLTVYETVLNSALLRLPRTMSFESKQSRVFQILEELRIFDIKDRIIGNDFERGISGGEKR 547

Query: 474 RVAIVLSLGIPADIYLIDEPSAYLDSEQ 501
           RV+I   L     I  +DEP++ LD+  
Sbjct: 548 RVSIACELVTSPLILFLDEPTSGLDANN 575

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 16/161 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRFDDPPEWQEIIKYFRGSEL--QNYFT 157
           +PG +  ++G +G GKS+ L +++G+ K ++  +FD       +    + SEL  +N  +
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSI--MFNDIQVSELMFKNVCS 775

Query: 158 KMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNR 217
            + +DD   +      + L  A    +  + E    RME+  +     I++L L H  N 
Sbjct: 776 YVSQDDDHLLAALTVKETLKYAAALRLHHLTE--AERMERTDNL----IRSLGLKHCENN 829

Query: 218 EIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
            IG      +SGGE +R  + +  + D  + + DEP+S LD
Sbjct: 830 IIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLD 870

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 106/236 (44%), Gaps = 38/236 (16%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYF-- 147
           N+F +  LP+   G V+ ++G +G GK+T L +LA K    L            I+Y   
Sbjct: 46  NTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTH-------NGSIRYVLE 94

Query: 148 -RGSELQNYFTK--MLEDDIKAIIKPQYVDNLPRA-IKGPVQKVGELLK----LRMEKPQ 199
             GSE      K   L+     I K   +  LP+  +  P     E LK    L++   +
Sbjct: 95  DTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE 154

Query: 200 DT----VKQYIKTLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSS 250
            T    V+Q I+ L L    +  +G      LSGGE +R +I    + +  +   DEP++
Sbjct: 155 RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTT 214

Query: 251 YLDVKQRLNAALIIRSLLEPSK-----YVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
            LD     +A L+I++L + +K     +++++    S + +L D VCIL     VY
Sbjct: 215 GLDA---YSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVY 267

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 457 DDIIDQE-VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           ++II  E VK +SGGE +RV + + L     I L+DEP++ LDS       +++ +    
Sbjct: 828 NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCRE 887

Query: 516 NKKTAFIVEH 525
             KT  I  H
Sbjct: 888 QGKTIIITIH 897

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 82/204 (40%), Gaps = 49/204 (24%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD---------------------- 404
           +N  S +     ++ +MG +G+GKTTL+ +LA  I                         
Sbjct: 45  VNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNETE 104

Query: 405 ------DGTSVP---KLNVSMKPQ--TIAPKFPGTVRQLFFKKIRAQF-LNPQFQT---- 448
                 DG   P    + ++  PQ   ++P+   T R+    K  A   LN   +T    
Sbjct: 105 PKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRL--TCRETL--KFAADLKLNSSERTKKLM 160

Query: 449 --DVVKPLKIDDIIDQEV-----KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQ 501
              +++ L + D  D  V     + LSGGE +R++I   +     I  +DEP+  LD+  
Sbjct: 161 VEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYS 220

Query: 502 RIICSKVIRRFILHNKKTAFIVEH 525
             +  K +++    + +T  +  H
Sbjct: 221 AFLVIKTLKKLAKEDGRTFIMSIH 244

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 115/318 (36%), Gaps = 70/318 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ +  P   E+   F    L+     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCFVERALEGEDGSV--D 641

Query: 163 DIKAIIKPQYVDNLPR-AIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGL 221
            +  +     ++N PR  I   ++ VG     R +                      +G 
Sbjct: 642 IVSFLASAPSLENTPRKEIVAALESVGFDADRRAQT---------------------VGS 680

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYV-IAVEHD 280
           LSGG   +  +  + +Q AD+ + DEP+++LDV    N   +   LL  ++   + V HD
Sbjct: 681 LSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSLIVSHD 737

Query: 281 LSVLD----------------YLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPS 324
              LD                Y  +    +   P      TL  S              +
Sbjct: 738 TGFLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDS--------------N 783

Query: 325 ENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDM-KRTQGDFTLNVQSGEFSDSEILVMM 383
             M F    +                  ++YP   K +  D + ++     S S  + ++
Sbjct: 784 AQMHFPAPGILSGVKSNTRAVAKMTDVTFTYPGAPKPSMADVSCSL-----SLSSRVAII 838

Query: 384 GENGTGKTTLIKLLAGAI 401
           G NG GK+TLIKLL G +
Sbjct: 839 GPNGAGKSTLIKLLTGEL 856

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 74/171 (43%), Gaps = 36/171 (21%)

Query: 382 MMGENGTGKTTLIKLLAGA----IPADDGTSVPKLNVSMKPQ----------TIAPKFPG 427
           + G NG GK+TL++ ++       P+ D      +  +++ +            AP    
Sbjct: 595 LCGRNGAGKSTLMRSISNGQLEGFPSQDELKTCFVERALEGEDGSVDIVSFLASAPSLEN 654

Query: 428 TVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADI 487
           T R    K+I A   +  F  D            Q V  LSGG   ++ +  ++   ADI
Sbjct: 655 TPR----KEIVAALESVGFDADRRA---------QTVGSLSGGWKMKLELTRAILQKADI 701

Query: 488 YLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TAFIVEHDFIMATYLADKV 537
            L+DEP+ +LD    +   + +  ++L+N + T+ IV HD    T   DKV
Sbjct: 702 LLLDEPTNHLD----VANVRWLEEYLLNNTEITSLIVSHD----TGFLDKV 744

 Score = 36.2 bits (82), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 219  IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVE 278
            +G LSGG+L +  IA +   +  + + DEP++YLD       A+ IR   E +  V+ + 
Sbjct: 1024 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIR---EWTGGVVMIS 1080

Query: 279  HDLSVLDYLSDFVCILY-GVPSVYGVVTLPSS 309
            H    +  L     I+  G     GVVT+  S
Sbjct: 1081 HSTEFVGALCPEQWIVENGTMVQKGVVTVDQS 1112

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 12/109 (11%)

Query: 467  LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF----ILHNKKTAFI 522
            LSGG+L +V I  ++     + ++DEP+ YLD +     +  IR +    ++ +  T F+
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFV 1086

Query: 523  VEHDFIMATYLADKVIVFDGTPSQNTTATAPESLLT-GCNRFLKNLNVT 570
                        ++ IV +GT  Q    T  +S    G N     LN+T
Sbjct: 1087 -------GALCPEQWIVENGTMVQKGVVTVDQSRFADGGNAEAVGLNIT 1128

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQN 154
           + ++G NG GKST +K+L G+  P  G+ +  P  +  I Y     LQ+
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHPNLR--IGYIAQHALQH 881

>Scas_712.29
          Length = 610

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (43%), Gaps = 27/189 (14%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK   + ++
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVR 482

Query: 166 AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGG 225
                   D  P   +      G+L +  +     TV               ++G LS G
Sbjct: 483 --------DKYPNISQDFQYWRGQLGRYGLTGEGQTV---------------QMGTLSEG 519

Query: 226 ELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLD 285
           +  R   A+  ++  +V + DEP++ LD+    + A  I    E +  V+ V HD  +LD
Sbjct: 520 QRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAIN---EFNGGVVVVSHDFRLLD 576

Query: 286 YLSDFVCIL 294
            ++  + ++
Sbjct: 577 KIAKDIFVV 585

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 89/201 (44%), Gaps = 44/201 (21%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQ 440
           ++GENG GK+T +K LA    P  +   +  L+   +P   +      VR+   +  R +
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSA-LEYVVREAQNELKRLE 170

Query: 441 FLNPQF------QTDVVKPL--KIDDI----------------------IDQEVKHLSGG 470
            L  ++      + ++++PL  ++D +                      I ++ K +SGG
Sbjct: 171 DLVEKYIVEEGPECELLEPLYERMDSLDPDTFESRAAVILIGLGFNSKTILKKTKDMSGG 230

Query: 471 ELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
              RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 231 WKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

Query: 529 ------MATYLADKVIVFDGT 543
                 M    A K+  + G 
Sbjct: 287 NGVCTNMLDMRAQKLTAYGGN 307

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 78/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQE--IIKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQ-DTVKQYIKTLQLDHL 214
             K LED ++  I  +          GP  ++ E L  RM+    DT +     + +   
Sbjct: 166 L-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGLG 214

Query: 215 LNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
            N +  L     +SGG   R A+A +      + + D+P+++LD++
Sbjct: 215 FNSKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 81/204 (39%), Gaps = 45/204 (22%)

Query: 368 NVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT---------------SVPKL 412
           N+  G   DS I  ++G NG GK+TL+K++ G +    G                S  +L
Sbjct: 413 NLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQL 471

Query: 413 NVSMKP-QTIAPKFPGTVRQLFFKKIRAQF----LNPQFQTDVVKPLKIDDIIDQEVKHL 467
           +++    + +  K+P   +   F+  R Q     L  + QT              ++  L
Sbjct: 472 DLTKSALEFVRDKYPNISQD--FQYWRGQLGRYGLTGEGQT-------------VQMGTL 516

Query: 468 SGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 527
           S G+  RV   L      ++ L+DEP+  LD       ++ I  F         +V HDF
Sbjct: 517 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLAEAINEF----NGGVVVVSHDF 572

Query: 528 IMATYLADKVIVFDGTPSQNTTAT 551
            +   +A  + V      +N TAT
Sbjct: 573 RLLDKIAKDIFVV-----ENKTAT 591

>Scas_108.1
          Length = 335

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 11/131 (8%)

Query: 179 AIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGL-----LSGGELQRFAIA 233
           A K P ++V  + K   E  + T + Y     L H  + ++G      +SGGE +R +IA
Sbjct: 1   ACKTPAKRVNNISK--AEYVKTTRELYATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 MSCVQDADVYMFDEPSSYLDVKQRLNAALIIR---SLLEPSKYVIAVEHDLSVLDYLSDF 290
            + V +  VY +D  +  LD    L  A  IR   +LLE + +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 VCILYGVPSVY 301
           V +LY    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 47/85 (55%), Gaps = 10/85 (11%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  +L     +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 522 IVEH---DFIMATYLADKV-IVFDG 542
           +  +   + I  T+  DKV +++DG
Sbjct: 102 VTIYQASENIYETF--DKVTVLYDG 124

>Scas_573.11
          Length = 689

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 3/80 (3%)

Query: 212 DHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPS 271
           D ++   I  LSGG   + A+A + +++AD+ + DEP+++LD    +N A ++  L    
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCG 630

Query: 272 KYVIAVEHDLSVLDYLSDFV 291
              I + HD   LD + +++
Sbjct: 631 ITSITISHDSVFLDSVCEYI 650

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  ++   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 629

Query: 517 KKTAFIVEHDFIMATYLADKVIVFDG 542
             T+  + HD +    + + +I ++G
Sbjct: 630 GITSITISHDSVFLDSVCEYIINYEG 655

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 72/165 (43%), Gaps = 36/165 (21%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFP 426
           LN  SG     EIL +MG +G GKTTL+ +LA      D +   ++N  +  +    K  
Sbjct: 393 LNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLI 452

Query: 427 GTV-------------------------RQLFFKKIRAQFLNPQFQTDVVKPLKIDDIID 461
           G V                         R + F+  +A+  +      V++ L+I DI D
Sbjct: 453 GFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFH------VLEELRIMDIKD 506

Query: 462 QEV-----KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQ 501
           + V     + +SGGE +RV+I   L     +  +DEP++ LD+  
Sbjct: 507 RIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANN 551

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 81/185 (43%), Gaps = 34/185 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--------LGRFDDPPEWQEIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K+K           G+     ++ ++I +    + 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFV---DQ 457

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLD 212
            +Y    L   +   +    +  LPR              +  E  Q  V   ++ L++ 
Sbjct: 458 DDYLLPTLT--VYETVLNSALLRLPRT-------------MSFEAKQARVFHVLEELRIM 502

Query: 213 HLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL 267
            + +R +G      +SGGE +R +IA   V    V   DEP+S LD     NA  +I  L
Sbjct: 503 DIKDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECL 559

Query: 268 LEPSK 272
           +  ++
Sbjct: 560 VRLAR 564

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 84/179 (46%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKP------QTIAPKFPGTVRQL-- 432
           ++GENG GK+T +K +A    P  +   V  L+   +P      + +  +    +++L  
Sbjct: 109 LLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVREAQNELKRLED 168

Query: 433 FFKKI------RAQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVKHLSGGE 471
             +KI       ++ L+P ++  D + P   +                I+++ K +SGG 
Sbjct: 169 LVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTINRKTKDMSGGW 228

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E   ++Y    E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVV-REAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHL- 214
             K LED ++ I+             GP  ++ + L  +M+    +  +    + L  L 
Sbjct: 163 L-KRLEDLVEKILLED----------GPESELLDPLYEKMDSMDPSTFESRAAIILIGLG 211

Query: 215 -----LNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
                +NR+   +SGG   R A+A +      + + D+P+++LD++
Sbjct: 212 FNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 84/188 (44%), Gaps = 27/188 (14%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKA 166
            LVG NG+GKST LKI+ G+  P+ GR       +  + Y + S+ Q   TK   + ++ 
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVRD 480

Query: 167 IIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGE 226
             K  ++    +  +G + + G             +    +T Q+          LS G+
Sbjct: 481 --KYAHISEDFQFWRGQLGRYG-------------LTGEAQTAQM--------ATLSEGQ 517

Query: 227 LQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDY 286
             R   A+  ++  +V + DEP++ LD+    + A  I +    +  V+ V HD  +LD 
Sbjct: 518 RSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIDAF---NGGVVVVSHDFRLLDR 574

Query: 287 LSDFVCIL 294
           ++  + ++
Sbjct: 575 IAKDIYVV 582

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 80/193 (41%), Gaps = 15/193 (7%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMK--PQTIAPKFPGTVRQLFFKKIR 438
            ++G NG GK+TL+K++ G +    G      +V +    Q    +   T   L F + +
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 481

Query: 439 AQFLNPQFQ---TDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSA 495
              ++  FQ     + +     +    ++  LS G+  RV   L      ++ L+DEP+ 
Sbjct: 482 YAHISEDFQFWRGQLGRYGLTGEAQTAQMATLSEGQRSRVVFALLALEQPNVLLLDEPTN 541

Query: 496 YLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPE- 554
            LD       +  I  F         +V HDF +   +A  + V      +N TAT  + 
Sbjct: 542 GLDIPTIDSLADAIDAF----NGGVVVVSHDFRLLDRIAKDIYVV-----ENKTATRWDG 592

Query: 555 SLLTGCNRFLKNL 567
           S+L   N+  KN+
Sbjct: 593 SILDYKNKLAKNV 605

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 84/192 (43%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR              R + ++   +++  +D +
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGRVS------------RHTHVKLGVYSQHSQDQL 469

Query: 165 KAIIKP-QYV-DNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLL 222
                P ++V D  P   +      G+L +  +     T                ++G L
Sbjct: 470 DLTKSPLEFVRDKYPNISQDFQYWRGQLGRYGLTGEAQT---------------SQMGTL 514

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLS 282
           S G+  R   A+  ++  +V + DEP++ LD+    + A  I    E +  V+ V HD  
Sbjct: 515 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIN---EFNGGVVVVSHDFR 571

Query: 283 VLDYLSDFVCIL 294
           +LD ++  + ++
Sbjct: 572 LLDKIAQDIFVV 583

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 80/179 (44%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKPQTI-APKFPGTVRQLFFKKIR- 438
           ++GENG GK+T +K +A    P  +   V  L+   +P  + A  +  T  Q   K++  
Sbjct: 110 LLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNELKRLED 169

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVKHLSGGE 471
                       ++ L P ++  D + P   +                I ++ K +SGG 
Sbjct: 170 LVEKIILEDGPESELLEPLYEKMDSMDPNTFESRAAVILIGLGFNSKTITKKTKDMSGGW 229

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 230 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 284

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 77/165 (46%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P     ++   D+P E  E+    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHL-- 214
            K LED ++ II             GP  ++ E L  +M+       +    + L  L  
Sbjct: 165 -KRLEDLVEKIILED----------GPESELLEPLYEKMDSMDPNTFESRAAVILIGLGF 213

Query: 215 ----LNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
               + ++   +SGG   R A+A +      + + D+P+++LD++
Sbjct: 214 NSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 258

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 83/212 (39%), Gaps = 44/212 (20%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGT---------------SVPKLNVSMKP-Q 419
           DS I  ++G NG GK+TL+K++ G +    G                S  +L+++  P +
Sbjct: 419 DSRI-ALVGPNGVGKSTLLKIMTGQLMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLE 477

Query: 420 TIAPKFPGTVRQLFFKKIRAQF----LNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRV 475
            +  K+P   +   F+  R Q     L  + QT              ++  LS G+  RV
Sbjct: 478 FVRDKYPNISQD--FQYWRGQLGRYGLTGEAQT-------------SQMGTLSEGQRSRV 522

Query: 476 AIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLAD 535
              L      ++ L+DEP+  LD       +  I  F         +V HDF +   +A 
Sbjct: 523 VFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQ 578

Query: 536 KVIVFDGTPSQNTTATAPESLLTGCNRFLKNL 567
            + V +      T      S+L   N+  KN+
Sbjct: 579 DIFVVE----HKTATRWNGSILDYKNKLAKNV 606

>Kwal_26.9480
          Length = 719

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 86/196 (43%), Gaps = 36/196 (18%)

Query: 75  LPTNLESHVTHRYSANSFKLHRLP------TPRPGQVLGLVGTNGIGKSTALKILAGKQK 128
           LP N+ S +  +  +  +   RL       T   G    +VG +G GKST LK++     
Sbjct: 455 LPPNVPSEIVFKNVSFGYDPDRLILKNASFTIPTGSKTAIVGPSGSGKSTILKLVF---- 510

Query: 129 PNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVG 188
               RF DP E + ++    G +++    + L   I  +  PQ       +I   V K G
Sbjct: 511 ----RFYDPIEGRILLD---GKDVRELDIESLRRSIGVV--PQDTPLFNESIWDNV-KFG 560

Query: 189 ELLKLRMEKPQDTVKQYIKTLQLDHLLNR----------EIGLL-SGGELQRFAIAMSCV 237
                R++     +++ I   QL  L+ +          E GL+ SGGE QR AIA   +
Sbjct: 561 -----RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLL 615

Query: 238 QDADVYMFDEPSSYLD 253
           +DA +  FDE +S LD
Sbjct: 616 KDAPIMFFDEATSALD 631

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 93/223 (41%), Gaps = 32/223 (14%)

Query: 382 MMGENGTGKTTLIKL-------LAGAIPADDGTSVPKLNVSMKPQTIA------PKFPGT 428
           ++G +G+GK+T++KL       + G I  D G  V +L++    ++I       P F  +
Sbjct: 494 IVGPSGSGKSTILKLVFRFYDPIEGRILLD-GKDVRELDIESLRRSIGVVPQDTPLFNES 552

Query: 429 VR-QLFFKKIRAQFLNPQFQTDVVK--------PLKIDDIIDQEVKHLSGGELQRVAIVL 479
           +   + F +I A     +   D  +        P   D I+ +    +SGGE QR+AI  
Sbjct: 553 IWDNVKFGRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIAR 612

Query: 480 SLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
            L   A I   DE ++ LD+       + I+       KT+  + H  +     ADK+IV
Sbjct: 613 VLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHR-LRTIADADKIIV 671

Query: 540 FDGTPSQNTTATA-----PESL---LTGCNRFLKNLNVTFRRD 574
            +    +     A     P+SL   L      L +LN    RD
Sbjct: 672 LEHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLNKELERD 714

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 80/179 (44%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKPQTI-APKFPGTVRQLFFKKIR- 438
           ++GENG GK+T +K LA    P  +   +  L+   +P  + A  +  T  Q   K+I  
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHELKRIED 171

Query: 439 ------------AQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVKHLSGGE 471
                       ++ L P ++  D + P   +                I ++ K +SGG 
Sbjct: 172 LVEKTILEDGPESELLEPLYERMDSLDPDTFESRAAIILIGLGFNKKTILKKTKDMSGGW 231

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 232 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 78/165 (47%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E  E+    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQ-DTVKQYIKTLQLDHLL 215
            K +ED ++  I             GP  ++ E L  RM+    DT +     + +    
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 216 NREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
           N++  L     +SGG   R A+A +      + + D+P+++LD++
Sbjct: 216 NKKTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 29/190 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK-MLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK  LE   
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALE--- 479

Query: 165 KAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSG 224
              ++ +Y  N+ +  +      G+L +  +     TV               ++  LS 
Sbjct: 480 --FVRDKY-SNISQDFQF---WRGQLGRYGLTGEGQTV---------------QMATLSE 518

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
           G+  R   A+  ++  +V + DEP++ LD+    + A  I    E +  V+ V HD  +L
Sbjct: 519 GQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIN---EFNGGVVVVSHDFRLL 575

Query: 285 DYLSDFVCIL 294
           D ++  + ++
Sbjct: 576 DKIAQDIFVV 585

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 83/198 (41%), Gaps = 16/198 (8%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMK--PQTIAPKFPGTVRQLF 433
           DS I  ++G NG GK+TL+K++ G +    G      +V +    Q    +   T   L 
Sbjct: 421 DSRI-ALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALE 479

Query: 434 FKKIRAQFLNPQFQ---TDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLI 490
           F + +   ++  FQ     + +     +    ++  LS G+  RV   L      ++ L+
Sbjct: 480 FVRDKYSNISQDFQFWRGQLGRYGLTGEGQTVQMATLSEGQRSRVVFALLALEQPNVLLL 539

Query: 491 DEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTA 550
           DEP+  LD       +  I  F         +V HDF +   +A  + V      +N TA
Sbjct: 540 DEPTNGLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAQDIFVV-----ENKTA 590

Query: 551 TAPE-SLLTGCNRFLKNL 567
           T  + S+L   N+  KN+
Sbjct: 591 TRWDGSILQYKNKLAKNV 608

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 92/213 (43%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLN 216
              L+     +   Q +D    A K P  +V  + K   E        Y     L H  N
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSK--KEYIASRRDLYATIFGLRHTYN 298

Query: 217 REIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR---SLL 268
            ++G      +SGGE +R +IA +      +Y +D  +  LD    L  A  IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 EPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           + + +V   +   ++ +   D V +LY    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR      K TAF+
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFV 364

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 80/202 (39%), Gaps = 55/202 (27%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA +   N+G                          ++ 
Sbjct: 881  PGTMTALMGESGAGKTTLLNTLAQR---NVG--------------------------IIT 911

Query: 162  DDIKAIIKPQYVDNLPRAIKGPVQK----VGEL-------LKLRMEKPQ--------DTV 202
             D+    +P  +D       G VQ+    + EL          RM +PQ        D V
Sbjct: 912  GDMLVNGRP--IDASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQHLPDSEKMDYV 969

Query: 203  KQYIKTLQLDHLLNREIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQR 257
            ++ I+ L ++      +G +  G    + ++ +I +  V   D+ +F DEP+S LD +  
Sbjct: 970  EKIIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSS 1029

Query: 258  LNAALIIRSLLEPSKYVIAVEH 279
                 ++R L +  + ++   H
Sbjct: 1030 WAIIQLLRKLSKAGQSILCTIH 1051

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 32/160 (20%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GAIPADDGTSVPKLNVSMKPQT---------IAPKF 425
            +  +MGE+G GKTTL+  LA    G I  D   +   ++ S + +T         IA   
Sbjct: 884  MTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGRPIDASFERRTGYVQQQDIHIAEL- 942

Query: 426  PGTVRQLFFKKIRAQFLNPQFQTD---------VVKPLKIDDIIDQEVKHLSGG----EL 472
              TVR+    +  A+   PQ   D         +++ L +++  +  V  +  G    + 
Sbjct: 943  --TVRESL--QFSARMRRPQHLPDSEKMDYVEKIIRVLGMEEYAEALVGEVGCGLNVEQR 998

Query: 473  QRVAIVLSLGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 511
            ++++I + L    D+ L +DEP++ LDS+      +++R+
Sbjct: 999  KKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 1038

>Scas_710.50
          Length = 602

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 33/198 (16%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR---------FDDPPEWQEIIKYFRG 149
           T +PG +  ++G +G GKST L +++G+ + +            F+D    +E+ K    
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFK---- 80

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVK--QYIK 207
               N  + + +DD   + K          ++   +   +L    + + Q  +K  + I+
Sbjct: 81  ----NVCSYVSQDDDHLLAK--------LTVRETFKFAADLRLHNLTEEQRVIKSDELIR 128

Query: 208 TLQLDHLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAAL 262
            L L H  N  IG      +SGGE +R  + +  + D  + + DEP+S LD         
Sbjct: 129 ALGLKHCENNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILE 188

Query: 263 IIRSL-LEPSKYVIAVEH 279
           I++ L +E  K +I   H
Sbjct: 189 ILKKLSVEYGKTIIITIH 206

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 79/186 (42%), Gaps = 33/186 (17%)

Query: 371 SGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD-----DGTSVPKLN------------ 413
           +  F    I  +MG +G+GK+TL+ L++G I +        T     N            
Sbjct: 23  NATFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKFATTGSIMFNDVQISEEMFKNV 82

Query: 414 ---VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKI----------DDII 460
              VS     +  K   TVR+ F      +  N   +  V+K  ++          ++II
Sbjct: 83  CSYVSQDDDHLLAKL--TVRETFKFAADLRLHNLTEEQRVIKSDELIRALGLKHCENNII 140

Query: 461 DQE-VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
             E +K +SGGE +RV + + L     I L+DEP++ LDS       +++++  +   KT
Sbjct: 141 GNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSVEYGKT 200

Query: 520 AFIVEH 525
             I  H
Sbjct: 201 IIITIH 206

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 96/216 (44%), Gaps = 24/216 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RFDDPPEWQEIIKYFRGSELQN 154
           R G+++ ++G  G G S+ LK+ AG+     G       +D  P+ +E++K ++   + N
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQ-KEMMKRYKPDVIYN 244

Query: 155 YFTKMLEDDIK-AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDH 213
                 E D+    +  Q   +   A K P ++V ++   R E    T   +     L H
Sbjct: 245 -----GEQDVHFPHLTVQQTLDFAIACKTPSKRVNDV--SREEYIASTRDLHATIFGLRH 297

Query: 214 LLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR--- 265
             + ++G      +SGGE +R +IA + V    +Y +D  +  LD    L  A  IR   
Sbjct: 298 TYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITT 357

Query: 266 SLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           +LL  + +V   +   ++ +   D V +LY    +Y
Sbjct: 358 NLLGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 76/155 (49%), Gaps = 22/155 (14%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GAIPADDGTSVPKLNVSMKPQTIAPKFPG------T 428
            +  +MGE+G GKTTL+  LA    G I  D   +   +++S + +T   +         T
Sbjct: 888  LTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDISFERRTGYVQQQDIHISELT 947

Query: 429  VR---QLFFKKIRAQFLNPQFQTD----VVKPLKIDDIIDQEVKHLSGG----ELQRVAI 477
            VR   Q   +  RAQ +  + + +    ++K L +++  D  V  +  G    + ++++I
Sbjct: 948  VRESLQFSARMRRAQNVPEEEKMEHVERIIKVLDMEEYADALVGDVGRGLNVEQRKKLSI 1007

Query: 478  VLSLGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 511
             + L    D+ L +DEP++ LDS+      +++++
Sbjct: 1008 GVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKK 1042

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  +K IR
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIR 354

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 88/182 (48%), Gaps = 26/182 (14%)

Query: 368 NVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTS---VPKLNVSMKPQTIAPK 424
           ++ + E   S ++ ++G  G GK+T++K + G +P   G +    P+  ++       P+
Sbjct: 636 SIDNFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGNNDHLSPQFQINATTVAYCPQ 695

Query: 425 --------------FPGTVRQLFFKK-IRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSG 469
                         F     + F+K  I+A  L P  +   V P   + ++ ++   LSG
Sbjct: 696 EAWIMNASVKDNILFGHKYDEAFYKATIKACQLLPDIK---VLPDGDETMVGEKGIVLSG 752

Query: 470 GELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIM 529
           G+  R+++  ++   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  + +   ++
Sbjct: 753 GQKTRLSLARAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKSIVL 807

Query: 530 AT 531
           AT
Sbjct: 808 AT 809

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 95/221 (42%), Gaps = 45/221 (20%)

Query: 375  SDSEILVMMGENGTGKTTL----IKLL---AGAIPAD--DGTSVP----KLNVSMKPQTI 421
            S  E + ++G  G GK+TL     +LL   AG I  D  D TS+     + ++++ PQ  
Sbjct: 1301 SPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQD- 1359

Query: 422  APKFPGTVRQLF-----------FKKIRAQFLNPQFQTDVVKPLKID------------- 457
            A  F GT+R              +  I    L    +T + K +  D             
Sbjct: 1360 AQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLET-IAKEINDDSEYSDRSRLESPL 1418

Query: 458  DI-IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
            DI + +   +LS G+ Q + +  +L   + I ++DE +A +D E   I  + IR+     
Sbjct: 1419 DIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEF--A 1476

Query: 517  KKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPESLL 557
             +T   + H  +   + +D++IV DG   +      PE+LL
Sbjct: 1477 DRTILTIAHR-LDTVFDSDRIIVLDGGEVKE--FDKPETLL 1514

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 80/165 (48%), Gaps = 28/165 (16%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK 158
           T  PG+   +VG +G GKST L+++         RF DP + + ++    G +++    +
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVF--------RFYDPQQGRILLD---GKDIR----E 522

Query: 159 MLEDDIKAII------KPQYVDNLPRAIK-GPVQKVGELLKLRMEKPQ--DTVKQYIKTL 209
           +  D+++ I+       P + D +   +K G +      +   +EK Q  D + +  K  
Sbjct: 523 LDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIHKLPKGT 582

Query: 210 QLDHLLNREIGLL-SGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           +    +  E GL+ SGGE QR AIA   ++D  +  FDE +S LD
Sbjct: 583 ET---IVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALD 624

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 93/218 (42%), Gaps = 35/218 (16%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPADDGTSVPKLN-------VSMKPQTIAPKFPG 427
           ++G +G+GK+T+++L+        G I  D G  + +L+       V + PQ   P F  
Sbjct: 487 IVGPSGSGKSTILRLVFRFYDPQQGRILLD-GKDIRELDLDELRRIVGVVPQD-TPLFND 544

Query: 428 TVRQ-LFFKKIRAQFLNPQFQTDVVK----------PLKIDDIIDQEVKHLSGGELQRVA 476
           T+ + + F +I A   + +  T + K          P   + I+ +    +SGGE QR+A
Sbjct: 545 TIWENVKFGRINAT--DNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLA 602

Query: 477 IVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADK 536
           I   L     I   DE ++ LD+       K I+       KT+  + H  +     ADK
Sbjct: 603 IARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHR-LRTIADADK 661

Query: 537 VIVFDGTP-----SQNTTATAPESLLTGCNRFLKNLNV 569
           +IV +        + N     P SL +      +NL++
Sbjct: 662 IIVLENGAVREEGTHNALLANPNSLYSELWNIQENLDM 699

>Kwal_47.19116
          Length = 607

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 78/166 (46%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDPPEWQEI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   D+P E  E   ++Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHL- 214
             K LED ++  I             GP   V E +  RM+    +  +    + L  L 
Sbjct: 163 L-KRLEDLVEKTILED----------GPESDVLEGIYERMDSLDPSTFESRAAVILIGLG 211

Query: 215 -----LNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
                +N++   +SGG   R A+A +      + + D+P+++LD++
Sbjct: 212 FNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 36/179 (20%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKPQTI-APKFPGTVRQLFFKK--- 436
           ++GENG GK+T +K LA    P  +   V  L+   +P    A ++     Q   K+   
Sbjct: 109 LLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVVNEAQNELKRLED 168

Query: 437 -IRAQFLNPQFQTDVVKPL--KIDDI----------------------IDQEVKHLSGGE 471
            +    L    ++DV++ +  ++D +                      I+++ K +SGG 
Sbjct: 169 LVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVILIGLGFNSKTINKKTKDMSGGW 228

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
             RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 229 KMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 283

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 85/195 (43%), Gaps = 17/195 (8%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMK--PQTIAPKFPGTVRQLFFKKI 437
           + ++G NG GK+TL+K++ G +    G      +V +    Q    +   T   L F + 
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVKLGVYSQHSQDQLDLTKSPLEFVRD 480

Query: 438 RAQFLNPQFQ---TDVVKPLKIDDIIDQEVKHLSGGELQRVAI-VLSLGIPADIYLIDEP 493
           +   ++  FQ     + +     +    ++  LS G+  RV   +L+L  P ++ L+DEP
Sbjct: 481 KYSHISHDFQYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAP-NVLLLDEP 539

Query: 494 SAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAP 553
           +  LD       +  I  F         +V HDF +   +A  + V      +N TAT  
Sbjct: 540 TNGLDIATIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVV-----ENKTATRW 590

Query: 554 E-SLLTGCNRFLKNL 567
           + S+L   N+  KN+
Sbjct: 591 DGSILDYKNKLAKNV 605

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 33/192 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG+GKST LKI+ G+     GR              R + ++   +++  +D +
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVS------------RHTHVKLGVYSQHSQDQL 468

Query: 165 KAIIKP-QYVDNLPRAIKGPVQKV-GELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLL 222
                P ++V +    I    Q   G+L +  +     T                ++  L
Sbjct: 469 DLTKSPLEFVRDKYSHISHDFQYWRGQLGRYGLTGEGQT---------------SQMATL 513

Query: 223 SGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLS 282
           S G+  R   A+  +Q  +V + DEP++ LD+    + A  I    E +  V+ V HD  
Sbjct: 514 SEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLADAIN---EFNGGVVVVSHDFR 570

Query: 283 VLDYLSDFVCIL 294
           +LD ++  + ++
Sbjct: 571 LLDKIAKDIFVV 582

>Scas_695.24
          Length = 1288

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 78/171 (45%), Gaps = 28/171 (16%)

Query: 352  AYSYPDMKRTQ--GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD----- 404
             ++YP         D  L + + E    + + ++GE+G+GK+TL+ LL            
Sbjct: 1055 TFAYPSETNVNVYEDLNLEMHASE----KTIGLVGESGSGKSTLMYLLTKLYQVAPHSIY 1110

Query: 405  -DGTSVPK---LNVSMKPQTIAPK---FPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKID 457
             DGT V     +N+  +   +  K   F GTVR+     I    L+ +   D++K + I 
Sbjct: 1111 LDGTDVNDWGLMNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMEL-FDMLKYVGIY 1169

Query: 458  DIIDQ---------EVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
            + ++          + K LSGG+ QR+ I  +L     I ++DE ++ LD+
Sbjct: 1170 EFVESLPFGLDTRIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDA 1220

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 75/169 (44%), Gaps = 28/169 (16%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDD 163
            + +GLVG +G GKST + +L          +   P       Y  G+++ ++    L   
Sbjct: 1079 KTIGLVGESGSGKSTLMYLLTK-------LYQVAPH----SIYLDGTDVNDWGLMNLRTQ 1127

Query: 164  IKAI-IKPQYVD-----NLPRAIKGPV--QKVGELLKLRMEKPQDTVKQYIKTLQLDHLL 215
            I  +  KP   D     NL   I   +   ++ ++LK         + +++++L      
Sbjct: 1128 ISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYV------GIYEFVESLPFGLDT 1181

Query: 216  NREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALII 264
              +  LLSGG+ QR  IA + ++   + + DE +S LD    L+A +II
Sbjct: 1182 RIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDA---LSANIII 1227

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 83/195 (42%), Gaps = 41/195 (21%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTK----MLED 162
            LVG NG+GKST LKI+ G+  P  GR       +  + Y + S+ Q   TK     + D
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGV-YSQHSQDQLDLTKSALEFVRD 483

Query: 163 DIKAIIKP-QYV-DNLPR-AIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREI 219
               I +  QY    L R  + G  QKV                              ++
Sbjct: 484 KYSNISQDFQYWRGQLGRYGLTGDAQKV------------------------------QM 513

Query: 220 GLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEH 279
           G LS G+  R   A+  +++ +V + DEP++ LD+    + A  I    E +  V+ V H
Sbjct: 514 GTLSEGQRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAIN---EFNGGVVVVSH 570

Query: 280 DLSVLDYLSDFVCIL 294
           D  +LD ++  + ++
Sbjct: 571 DFRLLDKIAKDIFVV 585

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 38/180 (21%)

Query: 382 MMGENGTGKTTLIKLLAG-AIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQL-------- 432
           ++GENG GK+T +K LA    P  D   V  L+    P T        VR+         
Sbjct: 112 LLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAP-TEYSALEYVVREAQNELKRVE 170

Query: 433 -FFKKI------RAQFLNPQFQ-TDVVKPLKIDD--------------IIDQEVKHLSGG 470
              +KI       ++ L+P ++  D + P   +                I ++ K +SGG
Sbjct: 171 DLVEKIILEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTILKKTKDMSGG 230

Query: 471 ELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH--DFI 528
              RVA+  +L +   + L+D+P+A+LD E  +   + ++RF     +T  +V H  DF+
Sbjct: 231 WKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLVLVSHSQDFL 286

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRFDDP--PEWQEIIKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA ++ P     ++   D+P  P     ++Y    E QN 
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVV-REAQNE 165

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQ-DTVKQYIKTLQLDHL 214
             K +ED ++ II             GP  ++ + L  RM+     T +     + +   
Sbjct: 166 L-KRVEDLVEKIILED----------GPESELLDPLYERMDGMDPSTFESRAAVILIGLG 214

Query: 215 LNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
            N +  L     +SGG   R A+A +      + + D+P+++LD++
Sbjct: 215 FNSQTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 79/193 (40%), Gaps = 15/193 (7%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMK--PQTIAPKFPGTVRQLFFKKIR 438
            ++G NG GK+TL+K++ G +    G      +V +    Q    +   T   L F + +
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK 484

Query: 439 AQFLNPQFQ---TDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSA 495
              ++  FQ     + +     D    ++  LS G+  RV   L      ++ L+DEP+ 
Sbjct: 485 YSNISQDFQYWRGQLGRYGLTGDAQKVQMGTLSEGQRSRVVFALLALENPNVLLLDEPTN 544

Query: 496 YLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPE- 554
            LD       +  I  F         +V HDF +   +A  + V      ++ TAT  + 
Sbjct: 545 GLDIPTIDSLADAINEF----NGGVVVVSHDFRLLDKIAKDIFVV-----EDKTATRWDG 595

Query: 555 SLLTGCNRFLKNL 567
           S+L    +  KN+
Sbjct: 596 SILDYKKKLAKNV 608

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 96/216 (44%), Gaps = 31/216 (14%)

Query: 352 AYSYPDMKRTQ-GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGA---------- 400
            Y++P  KR+   D +L+V+     + ++LV+ G NG GK+TL+KLL+G           
Sbjct: 14  TYAFPGSKRSAIHDLSLSVEW----NKKVLVV-GNNGAGKSTLLKLLSGKHLCLGGNIKV 68

Query: 401 ------IPADDGTSV---PKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVV 451
                  P +D  SV     L        I  +  G +  L  + I       + + ++V
Sbjct: 69  GNKNPFAPNNDQESVILTTYLGTEWASMAIVHRDIGVLELL--ESIGLSHYRARGE-ELV 125

Query: 452 KPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR 511
           + L++D  I+  +  LS G+ +RV + + L  P  + L+DE +  LD   R    + + R
Sbjct: 126 RILEVD--INWRMFKLSDGQKRRVQLCMGLLKPFKVLLLDEVTVDLDVVARDRLFQFLDR 183

Query: 512 FILHNKKTAFIVEHDFIMATYLADKVIVF-DGTPSQ 546
                + +     H F      AD++I   DGT ++
Sbjct: 184 ETRDRQCSVVYATHIFDGLAPWADEIIHLQDGTITR 219

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 21/153 (13%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAI 167
           +VG NG GKST LK+L+GK     G           IK       +N F     +D +++
Sbjct: 40  VVGNNGAGKSTLLKLLSGKHLCLGGN----------IKVGN----KNPFAP--NNDQESV 83

Query: 168 IKPQYVDNLPRAIKGPVQKVG--ELLK-LRMEKPQDTVKQYIKTLQLDHLLNREIGLLSG 224
           I   Y+     ++    + +G  ELL+ + +   +   ++ ++ L++D  +N  +  LS 
Sbjct: 84  ILTTYLGTEWASMAIVHRDIGVLELLESIGLSHYRARGEELVRILEVD--INWRMFKLSD 141

Query: 225 GELQRFAIAMSCVQDADVYMFDEPSSYLDVKQR 257
           G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 142 GQKRRVQLCMGLLKPFKVLLLDEVTVDLDVVAR 174

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 93/219 (42%), Gaps = 39/219 (17%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRFDDPPEWQEIIKYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   + +II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNLPRAI-----KGPVQKVGELLKLRMEKPQDTVKQYIK 207
                 + E  + + +       LP+A+     K  V KV E L++   K +    ++ +
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKALSFEAKKARVYKVLEELRIIDIKDRIIGNEFDR 528

Query: 208 TLQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL 267
            +             SGGE +R +IA   V    V   DEP+S LD     NA  +I  L
Sbjct: 529 GI-------------SGGEKRRVSIACELVTSPLVLFLDEPTSGLDAS---NANNVIECL 572

Query: 268 LEPSK-----YVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           +  S       V+++    S + YL D + +L     VY
Sbjct: 573 VRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVY 611

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 112/270 (41%), Gaps = 37/270 (13%)

Query: 352 AYSYPDMKRTQGDFT-LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVP 410
            YS P +     + T LN  SG     +IL +MG +G GKTTL+ +LA        +   
Sbjct: 390 TYSVPSINSDGVEETVLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSI 449

Query: 411 KLN-VSMKPQTIAPKFPGTVRQ---------LFFKKIRAQFLN-PQFQTDVVKPLKIDDI 459
           K+N +SM  ++ + K  G V Q         +F   + +  L  P+  +   K  ++  +
Sbjct: 450 KVNGISMDRKSFS-KIIGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKV 508

Query: 460 IDQEV--------------KHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLD-SEQRII 504
           +++                + +SGGE +RV+I   L     +  +DEP++ LD S    +
Sbjct: 509 LEELRIIDIKDRIIGNEFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNV 568

Query: 505 CSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI-------VFDGTPSQNTTATAPESLL 557
              ++R    +N+     +        YL DK++       V+ G   + +     E  +
Sbjct: 569 IECLVRLSSDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYI 628

Query: 558 TGCNRFLKN--LNVTFRRDPNSFRPRINKL 585
              N  + +  +++TF   P   R RI  +
Sbjct: 629 CPDNYNIADYLIDITFEAGPQGKRRRIRNI 658

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 94/217 (43%), Gaps = 20/217 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRFDDPPEWQEIIKYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            +D  P+ +E+++ +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLL 215
               ++     +   Q +D    A K P  +V  +   R E      + Y     L H  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNVS--RAEYITLMRELYATVFGLRHTY 298

Query: 216 NREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR---SL 267
           + ++G      +SGGE +R +IA +   +A VY +D  +  LD    L  A  +R   +L
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNL 358

Query: 268 LEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVYGVV 304
           L+ +  V   +   ++ +     + +  G    +G V
Sbjct: 359 LQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFGDV 395

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 69/157 (43%), Gaps = 26/157 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLA----GAIPAD--------DGT------SVPKLNVSMKPQT 420
            +  +MGE+G GKTTL+  LA    G I  D        D +       V + +V +K  T
Sbjct: 883  LTALMGESGAGKTTLLNTLAQRNVGVITGDMLVNGLPIDASFERRTGYVQQQDVHVKEMT 942

Query: 421  IAPKFPGTVRQLFFKKI-RAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479
            +      + R    + +  A+ +N  +   +++ L + D  D  V     G        L
Sbjct: 943  VRESLQFSARLRRPESVSEAEKMN--YVEKIIEILGMSDFADALVGDAGYGLNVEQRKKL 1000

Query: 480  SLGI-----PADIYLIDEPSAYLDSEQRIICSKVIRR 511
            S+G+     P+ +  +DEP++ LDS+      ++++R
Sbjct: 1001 SIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKR 1037

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
           ++ +SGGE +RV+I  +L   A +Y  D  +  LD+   +  ++ +R
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMR 353

>KLLA0D02156g complement(184520..186085) similar to sgd|S0002468
           Saccharomyces cerevisiae YDR061w, start by similarity
          Length = 521

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 3/84 (3%)

Query: 440 QFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
           ++++P+  T ++K LK+ DI D+    LS G+++R  +  SL    D+ +ID+P   LD 
Sbjct: 132 RYVDPELLTYLLKELKLIDIKDRWAMGLSNGQMRRTRLARSLLKEPDLTIIDDPFLGLDP 191

Query: 500 EQRIICSKVIRRFILHNKKTAFIV 523
               I SK + ++   +K T+ I+
Sbjct: 192 SACSIISKFLSKY---DKGTSVII 212

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 113/251 (45%), Gaps = 46/251 (18%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFP----GTVR- 430
           ++E +++ G  GTGK++L+  LAG +    G+      +++K   +   +P     TV+ 
Sbjct: 601 ENEFIIITGPIGTGKSSLLNALAGFMRRSSGS------MTIKGDLLLCGYPWVQNATVKD 654

Query: 431 QLFFKKIRAQFLNPQFQTDV-VKPLKID-DI--------IDQEVKHLSGGELQRVAIVLS 480
            + F    + F  P++Q  + +  L+ D DI        I +    LSGG+  R+A+  S
Sbjct: 655 NILFG---SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERGITLSGGQKARIALARS 711

Query: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATY---LADKV 537
           +    DIYL D+  + +DS    +C  ++   ++      ++ +   I+AT+   L DK 
Sbjct: 712 VYKDMDIYLFDDVLSAVDSR---VCKHIVDECMM-----GYLKQKTRILATHQLSLIDKA 763

Query: 538 --IVFDGTPSQNTTATAPESLL--TGCNRFLKNLNVTFRR-----DPNSFRPRINKLDSQ 588
             ++F G        T PE L   TG +  ++  N          D  +    I  + SQ
Sbjct: 764 SRVIFLGLDGSFDIGTVPELLKRNTGFSDLMQFQNSAPAEELEDDDTKAQNMEITAISSQ 823

Query: 589 MD--KEQKLSG 597
            D  K+Q LSG
Sbjct: 824 TDISKKQSLSG 834

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 13/114 (11%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLE--PSKYVIAVEH 279
           LSGG+  R A+A S  +D D+Y+FD+  S +D   R+   ++   ++     K  I   H
Sbjct: 698 LSGGQKARIALARSVYKDMDIYLFDDVLSAVD--SRVCKHIVDECMMGYLKQKTRILATH 755

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEA 333
            LS++D  S    I  G+   + + T+P  ++            S+ M+F+  A
Sbjct: 756 QLSLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF-------SDLMQFQNSA 800

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 34/164 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++         RF +P + + ++    G+++++     L  
Sbjct: 461 GMKTAIVGPSGSGKSTILKLVF--------RFYEPEQGRILVG---GTDIRDLDLLSLRK 509

Query: 163 DIKAIIK--PQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNR--- 217
            I  + +  P + D +   +K      G +         D + + I+  QL  LL     
Sbjct: 510 AIGVVPQDTPLFNDTIWENVK-----FGNI-----SSSDDEILRAIEKAQLTKLLQNLPK 559

Query: 218 -------EIGLL-SGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
                  E GL+ SGGE QR AIA   ++DA +  FDE +S LD
Sbjct: 560 GASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALD 603

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P     ++ +    +SGGE QR+AI   L   A +   DE ++ LD+         I++ 
Sbjct: 558 PKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQN 617

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFD 541
              N KT+  V H  +     ADK+IV +
Sbjct: 618 FSSNSKTSVYVAHR-LRTIADADKIIVLE 645

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 72/158 (45%), Gaps = 24/158 (15%)

Query: 356 PDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVS 415
           P+ K    +     + GE S      ++G+ G+GK+  ++ L G +    G +    +V+
Sbjct: 659 PEYKVALKNINYQAKKGELS-----CIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGSVA 713

Query: 416 MKPQTIAPKFPGTVRQ--LFFKKIRAQFLNPQFQTDVVKP--LKID---------DIIDQ 462
              Q +A    GTVR   LF  K      +P+F    +K   L ID          ++ +
Sbjct: 714 YVSQ-VAWIMNGTVRDNVLFGHK-----YDPEFYEKTIKACALTIDLATLVDGDQTLVGE 767

Query: 463 EVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
           +   LSGG+  R+++  ++   AD YL+D+P A +D  
Sbjct: 768 KGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEH 805

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 103/247 (41%), Gaps = 50/247 (20%)

Query: 355  YPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPAD------DGTS 408
            Y    R   D+ L   + E    E + ++G  G GK++L   L   I A       DG  
Sbjct: 1299 YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGILIDGVH 1358

Query: 409  VPKL-------NVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQ---TDVVKPLKIDD 458
            + ++       ++S+ PQ  +  F GT+R+          ++P  Q    D+ + L++  
Sbjct: 1359 INEIGLHDLRHHLSIIPQD-SQVFEGTIRE---------NIDPTNQFTDADIWRALELSH 1408

Query: 459  IIDQEVK---------------HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRI 503
            + +  ++               +LS G+ Q + +  +L +P+ + ++DE +A +D E   
Sbjct: 1409 LKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDK 1468

Query: 504  ICSKVIRRFILHNKKTAFIVEH--DFIMATYLADKVIVFDGTPSQNTTATAPESLLTGCN 561
            +  + IR       +T   + H  + IM     D++IV D    +      PE+LL   N
Sbjct: 1469 VIQETIRTSF--KDRTILTIAHRINTIMDN---DRIIVLD--KGKVVEFDTPEALLKNTN 1521

Query: 562  RFLKNLN 568
                +L+
Sbjct: 1522 SIFYSLS 1528

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 212 DHLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD--VKQRLNAALIIRSLL 268
           D  L  E G+ LSGG+  R ++A +    AD Y+ D+P + +D  V + L   ++  + L
Sbjct: 761 DQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGL 820

Query: 269 EPSKYVIAVEHDLSVL 284
             SK  I   + +SVL
Sbjct: 821 LHSKTRILATNKISVL 836

>Scas_40.1
          Length = 203

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 26/176 (14%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFDDPPEWQEII 144
           +N   +H +    P G ++ +VG +G GK+T L +LA K    L   G ++   +     
Sbjct: 32  SNKTIVHDVSMDLPSGSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADG---- 87

Query: 145 KYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGEL-LKLRMEKPQDTVK 203
               GS  Q+  T        A +  Q V +    ++  +    +L LK   ++ +  V+
Sbjct: 88  ----GSRQQDITT--------AYLAQQDVSSPKLTVRETLSYAADLKLKAPRQERRRLVE 135

Query: 204 QYIKTLQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDV 254
           + I  L L    +  +G      LSGGE +R +I +  + +  +   DEP++ LD 
Sbjct: 136 ELIAELGLKECSDTRVGDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 74/160 (46%), Gaps = 31/160 (19%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIP------------ADDGTSVPK 411
           D ++++ SG      I+ ++G +G+GKTTL+ +LA  I             AD G+    
Sbjct: 39  DVSMDLPSGS-----IMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQD 93

Query: 412 LNVSMKPQ--TIAPKFPGTVRQLFFKKIRAQFLNPQFQ-----TDVVKPLKIDD-----I 459
           +  +   Q    +PK   TVR+        +   P+ +      +++  L + +     +
Sbjct: 94  ITTAYLAQQDVSSPKL--TVRETLSYAADLKLKAPRQERRRLVEELIAELGLKECSDTRV 151

Query: 460 IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
            D E + LSGGE +R++I + +     +  +DEP+  LD+
Sbjct: 152 GDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

>Scas_468.1
          Length = 691

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 5/77 (6%)

Query: 213 HLLNREIG----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLL 268
           H  + +IG    LLSGG+ QR AIA + ++  ++ + DE +S LDV+           L+
Sbjct: 517 HTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLM 576

Query: 269 EP-SKYVIAVEHDLSVL 284
           +  S  ++++ H LS +
Sbjct: 577 KTKSMTIVSIAHRLSTI 593

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 75/178 (42%), Gaps = 39/178 (21%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLL-------AGAIPAD 404
           ++SYP   + Q    LN +    S+   + ++G +G GK+T+  LL       +G I  D
Sbjct: 396 SFSYPTRPQNQIFKNLNFKIEPGSN---VCIVGPSGKGKSTIALLLLHYYNPTSGQILID 452

Query: 405 DGTSVPKLN----------VSMKPQTIAPKFPGTVRQLF------------FKKIRAQFL 442
            G  + K+N          V  +P  ++    G++R                +K+  Q  
Sbjct: 453 -GQDITKMNSKSLRRKLGIVQQEPVLMS----GSIRDNITYGLTYTPTKEEIRKVAKQCF 507

Query: 443 NPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
              F T    P   D  I      LSGG+ QR+AI  +L    +I ++DE ++ LD E
Sbjct: 508 CHNFITKF--PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 86/179 (48%), Gaps = 20/179 (11%)

Query: 368 NVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT--SVP-KLNVSMKPQTIAPK 424
           N+   E    +++ ++G  G GK+T +K + G +P   G+  S+P KL +         +
Sbjct: 656 NIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQ 715

Query: 425 ----FPGTVRQ--LFFKKIRAQFLNPQFQTDVVKP-LKI-----DDIIDQEVKHLSGGEL 472
                  +VR+  LF  K    + +   +   + P LKI     + ++ ++   LSGG+ 
Sbjct: 716 ESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 775

Query: 473 QRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMAT 531
            R+++  ++   ADIYL+D+  + +D+E     SK I  ++L   KTA +     I+ T
Sbjct: 776 ARLSLARAVYSRADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKTIILTT 829

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 78/200 (39%), Gaps = 39/200 (19%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
           + G ++ +VG  G GKST LK + G+     G  D  P                      
Sbjct: 663 KRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPP--------------------- 701

Query: 161 EDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL--------- 211
               K II+   V    +        V E +    +  QD     IK  QL         
Sbjct: 702 ----KLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPD 757

Query: 212 -DHLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDV---KQRLNAALIIRS 266
            D  L  E G+ LSGG+  R ++A +    AD+Y+ D+  S +D    K  +   LI ++
Sbjct: 758 GDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKT 817

Query: 267 LLEPSKYVIAVEHDLSVLDY 286
            L  +K +I   + +S+L +
Sbjct: 818 ALLKNKTIILTTNTVSILKH 837

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 456  IDDIIDQEVK----HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++DI+D ++     +LS G+ Q + +  +L   + I ++DE +A +D E   I    IRR
Sbjct: 1441 VNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRR 1500

Query: 512  FILHNKKTAFIVEHDFIMATYLADKVIVFD 541
                  +T   + H  I     +DK+IV D
Sbjct: 1501 --EFKDRTILTIAHR-IDTVLDSDKIIVLD 1527

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 92/227 (40%), Gaps = 28/227 (12%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPE---------WQEIIKYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  +   E         ++ +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTL 209
             L   F   + D+I   I P+  +   R I+  + K     K     P           
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDR-IRRAIGKA-NCTKFLANFPDG--------- 562

Query: 210 QLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLE 269
            L  ++      LSGG+ QR A+A + + D  V + DE +S LD +     A  ++  +E
Sbjct: 563 -LQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE 621

Query: 270 PSKYVIAVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINI 316
                I++ H LS + + +  + +       +G V    S R+ I I
Sbjct: 622 RGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR 511
           P  +  ++      LSGG+ QR+A+  +  +   + ++DE ++ LDS+   I +K ++R
Sbjct: 560 PDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQR 618

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 88/201 (43%), Gaps = 23/201 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQ-----EIIKYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         RF DP         E I+ F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLK----LRMEKPQDTVKQYIKTLQLD 212
             + ++ +  +     ++N+  A+  P+    +  +    LR+      V  + + LQ  
Sbjct: 507 GIVQQEPV--LFNASILENITYAL--PLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTA 562

Query: 213 HLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSK 272
             +      LSGG+ QR A+A + +QD  + + DE +S LD K     A  +    + +K
Sbjct: 563 --VGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 273 YVIAVEHDLSVLDYLSDFVCI 293
             I++ H  S + + +  + +
Sbjct: 621 ITISIAHRKSTIQHSTRVIVL 641

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 20/85 (23%)

Query: 466 HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE-QRIICSKVIRR--------FILHN 516
            LSGG+ QRVA+  +      I ++DE ++ LDS+ + I+ S +++R         I H 
Sbjct: 569 QLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITISIAHR 628

Query: 517 KKTAFIVEHDFIMATYLADKVIVFD 541
           K T   ++H        + +VIV D
Sbjct: 629 KST---IQH--------STRVIVLD 642

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 74/173 (42%), Gaps = 27/173 (15%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN G  +             G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPN-GSIE-----------IDGIDINRWDTNKL 1148

Query: 161  EDDIKAI-IKPQYVD-----NLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHL 214
               I  +  KPQ+ D     NL   I G V ++     L +   QD V        L   
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFV------FSLPEG 1202

Query: 215  LNREI--GLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR 265
            L+  I   L+SGG+ QR +IA + ++   +   DE +S LD       A +I+
Sbjct: 1203 LDTRIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIK 1255

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 83/189 (43%), Gaps = 41/189 (21%)

Query: 352  AYSYPDMKRTQ--GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-------GAIP 402
            ++SYP    T       L+V SGE      + ++GE+G+GK+TL  L++       G+I 
Sbjct: 1080 SFSYPSAPSTAIYKGLKLDVFSGE-----TIAVVGESGSGKSTLTLLISALYEVPNGSIE 1134

Query: 403  ADDGTSVPKLN----------VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQ----- 447
              DG  + + +          V  KPQ     F GTV +     I  +    Q +     
Sbjct: 1135 I-DGIDINRWDTNKLRTIISVVEQKPQF----FDGTVGENLLYGISGRVTQIQVKEALCL 1189

Query: 448  ---TDVV--KPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQR 502
                D V   P  +D  ID  +  +SGG+ QR++I  ++     I  +DE ++ LD+   
Sbjct: 1190 AGVQDFVFSLPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNT 1247

Query: 503  IICSKVIRR 511
               + +I++
Sbjct: 1248 HAIANLIKK 1256

>Kwal_56.22747
          Length = 1538

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 96/224 (42%), Gaps = 39/224 (17%)

Query: 351  RAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTL-IKLLAGAIPAD----- 404
            R  +Y    R   D  L     E    E + ++G  G GK+TL + L     P++     
Sbjct: 1290 RFKNYSTRYRANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDI 1349

Query: 405  DGTSVPKL-------NVSMKPQTIAPKFPGTVR-----------QLFFKKIRAQFLNP-- 444
            DG  + K+       N+S+ PQ  A  F GTVR           +  +K +    L P  
Sbjct: 1350 DGVDISKIGLKDLRSNLSIIPQD-AQAFEGTVRTNLDPFEQYSDEEIWKALELSHLKPHI 1408

Query: 445  -QFQTDVVKPLKIDDIIDQEVK----HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
             +   D   P K +D++  ++     +LS G+ Q + +  +L   + I ++DE +A +DS
Sbjct: 1409 LKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDS 1468

Query: 500  EQRIICSKVIRRFILHNKKTAFIVEH--DFIMATYLADKVIVFD 541
            E   +  + IR       +T   + H  D +M +   DK++V D
Sbjct: 1469 ETDRLIQETIRAEF--KDRTILTIAHRIDTVMDS---DKIMVLD 1507

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/189 (17%), Positives = 80/189 (42%), Gaps = 40/189 (21%)

Query: 368 NVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPG 427
           N+   +    +++ ++G  G GK+T ++ L G +P           +S  P   +P    
Sbjct: 645 NIDGFQVFKGQLVCVVGRVGAGKSTFLQALLGQLPC----------ISNSPSHASPTVHF 694

Query: 428 TVRQLFFKKIRAQFLNPQFQTDVVKPLKIDD-------------------------IIDQ 462
               +     ++  +N   + +V+   + D+                         ++ +
Sbjct: 695 RANSVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPDLEILADGDETLVGE 754

Query: 463 EVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFI 522
           +   LSGG+  R+++  ++   +D+YL+D+  + +D+E   +C ++I + +  +KKT  +
Sbjct: 755 KGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAE---VCKRIIEQVL--SKKTGLL 809

Query: 523 VEHDFIMAT 531
                I+ T
Sbjct: 810 KNKTVILTT 818

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 84/198 (42%), Gaps = 39/198 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLED 162
           GQ++ +VG  G GKST L+ L G Q P +    + P       +FR + +       L  
Sbjct: 654 GQLVCVVGRVGAGKSTFLQALLG-QLPCIS---NSPSHASPTVHFRANSVA------LCS 703

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL----------D 212
               I+     DN+             L   R ++   T K  ++  QL          D
Sbjct: 704 QQSWIMNASVKDNV-------------LFGHRFDEA--TYKATLEACQLVPDLEILADGD 748

Query: 213 HLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDV---KQRLNAALIIRSLL 268
             L  E G+ LSGG+  R ++A +    +DVY+ D+  S +D    K+ +   L  ++ L
Sbjct: 749 ETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGL 808

Query: 269 EPSKYVIAVEHDLSVLDY 286
             +K VI   + +SVL +
Sbjct: 809 LKNKTVILTTNSISVLKH 826

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 169  KPQYVD-----NLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREI--GL 221
            KP++ D     NL   +K  V       +LR       +  +++TL  D  LN  +  GL
Sbjct: 1117 KPKFFDGTVRENLVYGLKRNVSNS----ELRSVLKSVDLLSFVQTLPND--LNTRVHDGL 1170

Query: 222  LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHD 280
            +SGG+ QR +IA + ++   + + DE +S LD       A +IR++L+    VI + H 
Sbjct: 1171 MSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKNVT-VIVITHS 1228

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 89/195 (45%), Gaps = 25/195 (12%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG------TSVPKLNVSMKPQT 420
             N  S E   +E + ++GE+G+GK+TL  LL    P   G        + K +     +T
Sbjct: 1051 FNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRT 1110

Query: 421  IA-----PKF-PGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHL------- 467
            I+     PKF  GTVR+     ++    N + ++ V+K + +   +      L       
Sbjct: 1111 ISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRS-VLKSVDLLSFVQTLPNDLNTRVHDG 1169

Query: 468  --SGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
              SGG+ QR++I  +L     I ++DE ++ LD+      +++IR  +L N     I   
Sbjct: 1170 LMSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKNVTVIVITHS 1228

Query: 526  DFIMATYLADKVIVF 540
            + +M   + D+V+V 
Sbjct: 1229 EQLMQ--ICDRVLVL 1241

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 211 LDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQR 257
           +D LL R    LSGG+ QR A+A + +++  V + DE  S LD+  R
Sbjct: 485 IDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSR 531

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P  ID ++ +    LSGG+ QRVA+  +      + ++DE  + LD   R +  + IR +
Sbjct: 482 PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHW 541

Query: 513 ILHNKKTAFIVEHDF 527
                KT  I+ H++
Sbjct: 542 --RKGKTTIILTHEY 554

>Scas_643.1
          Length = 1289

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 81/177 (45%), Gaps = 25/177 (14%)

Query: 354 SYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLN 413
           S+ ++  T GD  L      F  S +  +MGE+G GKTTL+ +LA  I  + G    +L 
Sbjct: 746 SWKNINYTIGDKKLINNVSGFIGSGLTALMGESGAGKTTLLNVLAQRI--ESGVVTGELL 803

Query: 414 VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSG-GEL 472
           +  KP T    F  ++  +  + +    L  +   ++   L+ D     ++K+L     L
Sbjct: 804 IDGKPLTNENAFRRSIGFVQQQDLHLDLLTVKESLEISCRLRGDG----DMKYLETISSL 859

Query: 473 QRVAI-------------VLSLGI-----PADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++ +             +LS+G+     P+ +  +DEP++ LDSE  +   K +++
Sbjct: 860 LKLPMNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKK 916

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 204 QYIKTLQLDHLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
           + ++   L H+++  +G      +SGGE +R +I  + + +  VY++D  +  LD    L
Sbjct: 160 ELLREFGLSHVMDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTAL 219

Query: 259 NAALIIRSLLEPSKYV 274
           +   I++ + E +K V
Sbjct: 220 DFLSILKKMTEATKSV 235

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 456 IDDIIDQE-VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
           +D ++  + V+ +SGGE +R++I+ +      +YL D  +  LDS   +    ++++   
Sbjct: 171 MDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTE 230

Query: 515 HNKKTAFI--------VEHDFIMATYLADKVIVFDGT 543
             K    +        + + F     L+D   VF GT
Sbjct: 231 ATKSVNLVKISQASDKIVNKFDKILMLSDSYQVFYGT 267

>Scas_693.42
          Length = 1512

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 71/153 (46%), Gaps = 14/153 (9%)

Query: 356 PDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVS 415
           P+ K    +     + GE +      ++G+ G+GK+ +I+ + G +    G +    NV+
Sbjct: 637 PEYKVALKNINFQAKKGELT-----CIVGKVGSGKSAMIQSILGDLFRVKGFATIHGNVA 691

Query: 416 MKPQTIAPKFPGTVRQ--LFFKKIRAQFLNPQFQT-----DVVKPLKIDD-IIDQEVKHL 467
              Q +A    GTV++  LF  K    F     +      D+   +  D  ++ ++   L
Sbjct: 692 YVSQ-VAWIMNGTVKENILFGHKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISL 750

Query: 468 SGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
           SGG+  R+++  ++   AD YL+D+P A +D  
Sbjct: 751 SGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 783

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 85/201 (42%), Gaps = 34/201 (16%)

Query: 382  MMGENGTGKTTLIKLLAGAIPADDGT----SVP---------KLNVSMKPQTIAPKFPGT 428
            ++G  G GK++L   L   I A  G     +VP         +  +S+ PQ  +  F GT
Sbjct: 1302 IVGRTGAGKSSLTLALFRIIEASSGRIVIDNVPINEIGLYDLRHKLSIIPQD-SQVFEGT 1360

Query: 429  VRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIID-----------QEVKHLSGGELQRVAI 477
            VR+        ++ + Q    +      D II            +   +LS G+ Q + +
Sbjct: 1361 VRENI--DPTNEYTDEQIWNVLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCL 1418

Query: 478  VLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKV 537
              +L +P+ I L+DE +A +D E   +  + IR       +T   + H  I     +D++
Sbjct: 1419 ARALLVPSKILLLDEATAAVDVETDKVIQETIRTAF--KDRTILTIAHR-INTIMDSDRI 1475

Query: 538  IVFD-GTPSQNTTATAPESLL 557
            IV D GT  +     +PE LL
Sbjct: 1476 IVLDNGTIKE---FDSPEKLL 1493

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 199 QDTVKQYIKTLQL------DHLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSY 251
           Q T+K    T+ L      D  L  E G+ LSGG+  R ++A +    AD Y+ D+P + 
Sbjct: 720 QKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAA 779

Query: 252 LD 253
           +D
Sbjct: 780 VD 781

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 81/213 (38%), Gaps = 64/213 (30%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDDIKAIIKPQYVDNLPRA--------------IKGPVQKVGELLKLR--MEKPQDT--- 201
               +  +    +VD LPR               + G  Q V + LK    + +PQ     
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 202  -----VKQYIKTLQLDHLLNREIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSY 251
                 V+  I+ L+++   +  +G+   G    + +R  I +  V   ++ +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVL 284
            LD +   +   ++R L    + V+   H  S +
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAI 1058

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 68/165 (41%), Gaps = 29/165 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GAIPAD-------DGTSVPKLNVSMKPQTIAPKFP 426
            +  +MG +G GKTTL+ +LA     G +  D        G S  + N     Q       
Sbjct: 885  LTALMGSSGAGKTTLLDVLANRVRVGVVTGDMFVDGLPRGASFQR-NTGYCQQQDLHGCT 943

Query: 427  GTVRQLFFKKIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEVKHLSGG----ELQ 473
             TVR     K  A    PQ         +  D+++ L+++   D  V     G    + +
Sbjct: 944  QTVRDAL--KFSAYLRQPQSVSEAEIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRK 1001

Query: 474  RVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 1002 RLTIGVELVAKPELLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQ 1046

>Kwal_23.5161
          Length = 1489

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 78/166 (46%), Gaps = 28/166 (16%)

Query: 371  SGEFSDSEILVMMGENGTGKTTLIKLLA----GAIPAD---DG----TSVPKLNVSMKPQ 419
            SG  +   +  +MGE+G GKTTL+  LA    G I  D   +G     S  +    ++ Q
Sbjct: 868  SGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGKPIDASFERRTGYVQQQ 927

Query: 420  TIAPKFPGTVRQLFFKKIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEVKHLSGG 470
             +  K   TVR+ F  +  A+   PQ         +   +++ L ++D  +  +  +  G
Sbjct: 928  DVHVK-EMTVRESF--QFAARMRRPQSIPESEKLAYVEKIIEILDMEDYAEALIGDVGYG 984

Query: 471  ----ELQRVAIVLSLGIPADIYL-IDEPSAYLDSEQRIICSKVIRR 511
                + ++V+I + L    D+ L +DEP++ LDS+      +++RR
Sbjct: 985  LNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRR 1030

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 2/81 (2%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  +L     IY  D  +  LD+   +  ++ IR      K  A + 
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALVT 355

Query: 524 EHDFIMATY-LADKV-IVFDG 542
            +      Y   DKV +++DG
Sbjct: 356 IYQASENIYECFDKVTVLYDG 376

>Kwal_14.2052
          Length = 523

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 85/224 (37%), Gaps = 19/224 (8%)

Query: 206 IKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR 265
           ++TL+L HL NR    LS G+++R  +A S ++D D  + ++P   LD      A  II 
Sbjct: 141 LRTLKLKHLENRWAMGLSNGQMRRARLARSLLKDPDFTLIEDPFLGLDP----TATGIIS 196

Query: 266 SLL---EPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVYG----VVTLPSSVREGINIFL 318
             L        VI + +   + ++ +   C+     S  G    V  L   VR   N  +
Sbjct: 197 EFLGNYTRCSIVIGLRYQDPIPEWCTHVCCVDADGISFQGEKSAVQKLIDQVRNDFNQQI 256

Query: 319 D----GHIPSENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEF 374
           D      I  +++                       R  S     R +G+   +      
Sbjct: 257 DSMPVSRISVDDLISMHPLSALSVHDIVKMPDVIELRGLSV----RYKGEPIFDNLCWSV 312

Query: 375 SDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKP 418
           S      + G+NGTGK+TL  L+    P    + V +  V  KP
Sbjct: 313 SPKTTWHIRGDNGTGKSTLFSLITADHPQSWNSRVVENGVPRKP 356

>Kwal_56.23844
          Length = 1494

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 9/129 (6%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQ--LFFK 435
           E+  ++G+ G+GK+ LI+ + G +    G +    +++   Q +     GTV++  LF  
Sbjct: 642 ELTCIVGKVGSGKSALIQGILGDLFRVKGFASVHGSIAYVSQ-VPWIMNGTVKENILFGH 700

Query: 436 KIRAQFLNPQFQTDVVK------PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYL 489
           K  A F +   +   +       P   + ++ ++   LSGG+  R+++  ++   AD YL
Sbjct: 701 KYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYL 760

Query: 490 IDEPSAYLD 498
           +D+P A +D
Sbjct: 761 LDDPLAAVD 769

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 99/225 (44%), Gaps = 26/225 (11%)

Query: 354  SYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT----SV 409
            +Y    R + D +L   + +    E + ++G  G GK++L   L   I A +G      V
Sbjct: 1256 NYSARYRPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAEGRIIIDGV 1315

Query: 410  PKLNVSMKPQ----TIAPK----FPGTVRQ------LFFKKIRAQFLNPQFQTDVVKPL- 454
            P  ++ ++      +I P+    F GTVR+       +  +     L      D +K L 
Sbjct: 1316 PTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTDEEIWHALELAHLKDHIKSLG 1375

Query: 455  --KIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
              +++ ++ +   +LS G+ Q + +  +L IP  I ++DE +A +D E   +  + IR  
Sbjct: 1376 KDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETDQVIQETIR-- 1433

Query: 513  ILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPESLL 557
                 +T   + H  I     +D+++V D    +     +PE+LL
Sbjct: 1434 TAFKNRTILTIAHR-INTILDSDRILVLD--SGKIAEFDSPEALL 1475

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 212 DHLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD--VKQRLNAALIIRSLL 268
           D  L  E G+ LSGG+  R ++A +    AD Y+ D+P + +D  V + L   ++    L
Sbjct: 727 DETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGL 786

Query: 269 EPSKYVIAVEHDLSVLDYLSDFVCIL 294
             SK  +   + +SVL  ++D + +L
Sbjct: 787 LSSKVKVLATNKISVLS-IADHISLL 811

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
           factor, member of the ATP-binding cassette (ABC)
           superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 95/225 (42%), Gaps = 46/225 (20%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAP 423
           D   +++ GEF     +++ G  GTGK++L+  +AG++   DG       V +    +  
Sbjct: 606 DLNFDIKKGEF-----IMITGPIGTGKSSLLNAMAGSMRKTDG------KVEVNGDLLMC 654

Query: 424 KFP----GTVRQLFFKKIRAQFLNPQFQTDVVK--PLKID-DI--------IDQEVKHLS 468
            +P     +VR      I     N +   +VV+   LK D DI        I +    LS
Sbjct: 655 GYPWIQNASVRD---NIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLS 711

Query: 469 GGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFI 528
           GG+  R+ +  S+    DIYL D+  + +DS         + + I+    T  +     I
Sbjct: 712 GGQKARINLARSVYKKKDIYLFDDVLSAVDSR--------VGKHIMDECLTGMLANKTRI 763

Query: 529 MATY------LADKVIVFDGTPSQNTTATAPESLLTGCNRFLKNL 567
           +AT+       A +VIV  GT  Q    T  E  L   N+ L NL
Sbjct: 764 LATHQLSLIERASRVIVL-GTDGQVDIGTVDE--LKARNQTLINL 805

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 76/172 (44%), Gaps = 30/172 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKIL-------AGK------QKPNLGRFDDPPEWQEIIK-- 145
            + G+ +G+ G  G GKST +  L       AGK          LG FD   +   I +  
Sbjct: 1238 KSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDP 1297

Query: 146  -YFRGSELQNY--FTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKP-QDT 201
              FRG+  +N   F +  +D++         D L R   G + K  +L +++++KP ++ 
Sbjct: 1298 VLFRGTIRKNLDPFNERTDDEL--------WDALVRG--GAIAK-DDLPEVKLQKPDENG 1346

Query: 202  VKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
                +    LD  +  E    S GE Q  A+  + V+ + + + DE +S +D
Sbjct: 1347 THGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVD 1398

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSL--LEPSKYVIAVEH 279
           LSGG+  R  +A S  +  D+Y+FD+  S +D   R+   ++   L  +  +K  I   H
Sbjct: 710 LSGGQKARINLARSVYKKKDIYLFDDVLSAVD--SRVGKHIMDECLTGMLANKTRILATH 767

Query: 280 DLSVLDYLSDFVCI 293
            LS+++  S  + +
Sbjct: 768 QLSLIERASRVIVL 781

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 212 DHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPS 271
           D ++     LLSGG+ QR AIA + ++   + + DE +S LDV+        +  L+   
Sbjct: 587 DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK 646

Query: 272 KY-VIAVEHDLSVLDYLSDFVCI 293
           +  ++++ H LS +    + V +
Sbjct: 647 EITIVSIAHRLSTIRRSENIVVL 669

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   D +I      LSGG+ QR+AI  +L     I ++DE ++ LD E     +  + R 
Sbjct: 583 PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 642

Query: 513 ILHNKKTAFIVEH 525
           +   + T   + H
Sbjct: 643 MRSKEITIVSIAH 655

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
           Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
           Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 95/218 (43%), Gaps = 33/218 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  + +E++K ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQ--DTVK-QYIKTLQ 210
            +F K+    +K  I      +     K P  ++      RM + Q  D ++  +     
Sbjct: 237 FHFPKI---TVKETI------DFALKCKTPRVRID-----RMTRKQYVDNIRDMWCTVFG 282

Query: 211 LDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIR 265
           L H    ++G      +SGGE +R ++  +   +A +Y +D  +  LD    L  A  IR
Sbjct: 283 LRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

Query: 266 SL--LEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVY 301
           +   +  +  ++A+      +  L D   +LY    +Y
Sbjct: 343 TATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIY 380

 Score = 33.9 bits (76), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 80/193 (41%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDD---------PPEWQEIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  +     Y   ++
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNSQSLPASFNRSCGYVAQAD 929

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQL 211
                   M E  ++  ++       PR++              +E+  + V++ I  L +
Sbjct: 930  -----NHMAELSVRESLRFAAELRQPRSVP-------------LEEKYEYVEKIIALLGM 971

Query: 212  DHLLNREIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQRLNAALIIRS 266
             +     +G    G    + ++ +I +  V    + +F DEP+S LD +   +    +R+
Sbjct: 972  QNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1031

Query: 267  LLEPSKYVIAVEH 279
            L +  + ++   H
Sbjct: 1032 LADSGQSILCTIH 1044

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 36/174 (20%)

Query: 371 SGEFSDSEILVMMGENGTGKTTLIKLLAGAIP---------ADDGTSVPKLNVSMKPQTI 421
           +G     E+L ++G  G G +TL+K ++G            + DG    ++  + K   I
Sbjct: 171 TGVVESGEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVI 230

Query: 422 -APK----FPG-TVRQLFFKKIRAQFLNPQFQTD-VVKPLKIDDIIDQE----------- 463
             P+    FP  TV++     ++ +   P+ + D + +   +D+I D             
Sbjct: 231 YCPELDFHFPKITVKETIDFALKCK--TPRVRIDRMTRKQYVDNIRDMWCTVFGLRHTYA 288

Query: 464 -------VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
                  V+ +SGGE +RV++V +  + A IY  D  +  LD+   +  ++ IR
Sbjct: 289 TKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 220 GLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKY-VIAVE 278
            LLSGG+ QR AIA + ++  ++ + DE +S LDV+        +  L++     +I++ 
Sbjct: 611 ALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIA 670

Query: 279 HDLSVL 284
           H LS +
Sbjct: 671 HRLSTI 676

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 467 LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
           LSGG+ QR+AI  +L    +I ++DE ++ LD E
Sbjct: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVE 646

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 87/202 (43%), Gaps = 19/202 (9%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRFDDPPEWQEIIKYFRGSELQ 153
           T RPG+ + +VG +G GKST   +L      G  +  LG         + I+ F   + +
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG--------NDNIRDFNLRKYR 503

Query: 154 NYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTL--QL 211
                + ++ +  +     +DN+  A+  P + V +  ++     Q    +++      L
Sbjct: 504 RLLGVVQQEPM--LFSGTILDNITYAV--PQELVNDETRISRAIGQANCTKFLANFPDGL 559

Query: 212 DHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPS 271
              +      LSGG+ QR A+A + + D  + + DE +S LD +     A  ++      
Sbjct: 560 QTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARG 619

Query: 272 KYVIAVEHDLSVLDYLSDFVCI 293
           K  I++ H +S + + S  + +
Sbjct: 620 KTTISIAHRVSTIQHSSRVIVL 641

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 466 HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            LSGG+ QR+A+  +  +   I ++DE ++ LDS+   + ++ +++     K T  I   
Sbjct: 569 QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTTISIAHR 628

Query: 526 DFIMATYLADKVIVFD 541
             +     + +VIV +
Sbjct: 629 --VSTIQHSSRVIVLN 642

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 221 LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEP-SKYVIAVEH 279
           LLSGG+ QR AIA + ++   + + DE +S LDV+           L++  S  ++++ H
Sbjct: 585 LLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 644

Query: 280 DLSVL 284
            LS +
Sbjct: 645 RLSTI 649

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 129/321 (40%), Gaps = 72/321 (22%)

Query: 224 GGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALI----IRSLLEPSKYVIAVEH 279
           G EL R+ +A+      D++   + +++ + K     +L+      ++L    Y++ ++ 
Sbjct: 327 GNELSRYNVAIR-----DIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLV-LQS 380

Query: 280 DLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGIN----IF-LDGHIPS----ENMRFR 330
            LS+ D  +  +   Y   +V+G+ T  S + +G      +F L    PS       +++
Sbjct: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440

Query: 331 TE--ALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGT 388
            +   ++F+              ++SYP     Q    LN +    S    + ++G +G 
Sbjct: 441 PDRGVIEFKDV------------SFSYPTRPSVQIFKNLNFKIAPGSS---VCIVGPSGR 485

Query: 389 GKTTLIKLL-------AGAIPADDGTSVPKLN----------VSMKPQTIAPKFPGTVRQ 431
           GK+T+  LL        G I  D+   + KLN          V  +P  ++    GT+R 
Sbjct: 486 GKSTIALLLLRYYNPTTGTITIDN-QDISKLNCKSLRRHIGIVQQEPVLMS----GTIRD 540

Query: 432 LF------------FKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVL 479
                          + +  Q     F T    P   D +I      LSGG+ QR+AI  
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKF--PNTYDTVIGPHGTLLSGGQKQRIAIAR 598

Query: 480 SLGIPADIYLIDEPSAYLDSE 500
           +L     I ++DE ++ LD E
Sbjct: 599 ALIKKPTILILDEATSALDVE 619

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 86/179 (48%), Gaps = 14/179 (7%)

Query: 382 MMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQ--LFFKKIRA 439
           ++G+ G+GKT L+  + G +    G +    +V+   Q +     GTV++  LF  +  A
Sbjct: 661 IVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQ-VPWIMNGTVKENILFGHRYDA 719

Query: 440 QFLNPQFQT-----DVVKPLKIDD-IIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEP 493
           +F     +      D+   +  D  ++ ++   LSGG+  R+++  ++   AD YL+D+P
Sbjct: 720 EFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDP 779

Query: 494 SAYLDSE-QRIICSKVIR-RFILHNKKTAFIVEHDFIMATYLADKVIVFD-GTPSQNTT 549
            A +D    R +   V+    +LH K    ++  + + A  +AD + + D G  +Q  T
Sbjct: 780 LAAVDEHVARHLIEHVLGPNGLLHTKTK--VLATNKVSALSIADSIALLDNGEITQQGT 836

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 92/218 (42%), Gaps = 42/218 (19%)

Query: 354  SYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVP--- 410
            +Y    R + D  L   +     +E + ++G  G GK++L   L   I A +G  V    
Sbjct: 1276 NYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNI 1335

Query: 411  ----------KLNVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKI---- 456
                      +  +S+ PQ  +  F GTVR+          +N      + + L++    
Sbjct: 1336 AINEIGLYDLRHKLSIIPQD-SQVFEGTVRE------NIDPINQYTDEAIWRALELSHLK 1388

Query: 457  -------DDIIDQEVK----HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIIC 505
                   +D +D ++     +LS G+ Q + +  ++ +P+ I ++DE +A +D E   + 
Sbjct: 1389 EHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVV 1448

Query: 506  SKVIRRFILHNKKTAFIVEH--DFIMATYLADKVIVFD 541
             + IR       +T   + H  + IM +   D++IV D
Sbjct: 1449 QETIRT--AFKDRTILTIAHRLNTIMDS---DRIIVLD 1481

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 172 YVDNLPRAIKGPVQK---VGELLKLRMEKPQDTVKQYIKTLQL------DHLLNREIGL- 221
           YV  +P  + G V++    G   +   E  + T+K    T+ L      D  L  E G+ 
Sbjct: 695 YVSQVPWIMNGTVKENILFGH--RYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGIS 752

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           LSGG+  R ++A +    AD Y+ D+P + +D
Sbjct: 753 LSGGQKARLSLARAVYARADTYLLDDPLAAVD 784

>KLLA0F14575g complement(1351796..1354351) some similarities with
           sp|P47068 Saccharomyces cerevisiae YJL020c singleton,
           hypothetical start
          Length = 851

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 386 NGTGKTTLIKLLAGAI---PADDGTSVPKLNVSMKP--QTIAPKF-PGTVRQLFFKKIRA 439
           N   +   I+ + GA    PA   ++ P++  S +P  +T   KF PGT+ +L F K   
Sbjct: 566 NAPQRRPSIQTIPGAANSSPATPSSAAPQIPASFQPLRRTTTAKFEPGTIPELEFSKQST 625

Query: 440 QFLNPQFQTDVVKPLKIDDIIDQE 463
            +L    Q D VKP K+  I + +
Sbjct: 626 WWLTKTVQADTVKPSKVKYIWESQ 649

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 439  AQFLNPQFQTDVVKPLKIDDIIDQE--VKHLSGGELQRVAIVLSLGI----PADIYLIDE 492
            A+ LN    T V   +  +   D++  V+ LSGG+    AI L L I    PA  YL DE
Sbjct: 1146 AEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDE 1205

Query: 493  PSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFD 541
              A LD + RI  ++ I+        TA      FI  T+  D + V D
Sbjct: 1206 IDAALDKQYRIAVARTIKNL----SDTA-----QFICTTFRTDMINVAD 1245

>Scas_622.9
          Length = 1657

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 91/216 (42%), Gaps = 36/216 (16%)

Query: 362 QGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG-TSVPKLNVSMKPQT 420
           + DF L   + EF    + V++G  G+GKT+L+  L G +  + G   VP LN   +   
Sbjct: 724 EEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPALNP--RQDL 781

Query: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDV-----------------------VKPLKID 457
           +  KF G    + +    A  LN   + ++                       +K LK  
Sbjct: 782 VIDKF-GLTNSIAYCSQAAWLLNETVRNNILFNSPYNEERYNAVIDACGLRRDLKILKAS 840

Query: 458 DI--IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           D+  I ++   LSGG+ QRV++  +L   +   L+D+  + +DS   +          L 
Sbjct: 841 DMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLM 900

Query: 516 NKKTAFIVEHDFIMATYLADKVIVFD-------GTP 544
           + +T  +V H+  +    A+ V++ +       GTP
Sbjct: 901 SGRTCILVSHNIALTLKNAELVVILENGRVKDQGTP 936

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 221 LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKY-VIAVEH 279
           LLSGG+ QR AIA + +    + + DE +S LDV+        +  L++  +  +I++ H
Sbjct: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670

Query: 280 DLSVL 284
            LS +
Sbjct: 671 RLSTI 675

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 31/199 (15%)

Query: 352 AYSYPDMKRTQ--GDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLL-------AGAIP 402
           ++SYP  K  Q   D    ++ G       + ++G +G GK+T+  LL       +G I 
Sbjct: 478 SFSYPTRKTNQIFKDLNFTIEPGSN-----VCIVGPSGRGKSTIASLLLRYYNPTSGKIL 532

Query: 403 ADDGTSVPKLNV-SMKPQ-TIAPKFP----GTVRQLFFKKIRAQFLNPQFQTDVVK---- 452
            D G  + KL+  S++ Q  +  + P    GT+R+     +  Q    + ++   K    
Sbjct: 533 VD-GQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCH 591

Query: 453 ------PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICS 506
                 P   + II      LSGG+ QR+AI  +L     I ++DE ++ LD E     +
Sbjct: 592 AFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAIN 651

Query: 507 KVIRRFILHNKKTAFIVEH 525
             + R +   + T   + H
Sbjct: 652 YTLGRLMKSKELTIISIAH 670

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 25/137 (18%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPK---LNVSMKPQTIAPKFPGTVRQ--L 432
           E+  ++G+ G+GK+ LI+ L G +    G +       NVS  P  +     GTV+   L
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHGDVANVSQVPWIM----NGTVKDNIL 709

Query: 433 FFKKIRAQFLNPQFQTDVVKP--LKID---------DIIDQEVKHLSGGELQRVAIVLSL 481
           F  K      +P+F    +K   L ID          ++ ++   LSGG+  R+++  ++
Sbjct: 710 FGHK-----YDPEFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAV 764

Query: 482 GIPADIYLIDEPSAYLD 498
              AD YL+D+P A +D
Sbjct: 765 YSRADTYLLDDPLAAVD 781

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 212 DHLLNREIGL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           D  L  E G+ LSGG+  R ++A +    AD Y+ D+P + +D
Sbjct: 739 DQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVD 781

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 221 LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKY-VIAVEH 279
           LLSGG+ QR AIA + ++   + + DE +S LDV+           L++  +  ++++ H
Sbjct: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667

Query: 280 DLSVL 284
            LS +
Sbjct: 668 RLSTI 672

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 457 DDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSE 500
           D +I      LSGG+ QR+AI  +L     I ++DE ++ LD E
Sbjct: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642

>Kwal_14.2435
          Length = 1247

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 36/83 (43%), Gaps = 13/83 (15%)

Query: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197

Query: 520  AFIVEHDFIMATYLADKVIVFDG 542
                   FI  T+  D + V D 
Sbjct: 1198 -------FICTTFRTDMLQVADS 1213

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, start by
           similarity
          Length = 1568

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 72/152 (47%), Gaps = 25/152 (16%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAIP---ADDGTSV-PKLNVSMKPQTIAPKFPGTV--- 429
           +++  ++G  G+GK+T ++ + G +P   +D  + V PK+ +        P+ P  +   
Sbjct: 653 AQLTCIVGRVGSGKSTFLQAILGQLPCVSSDSASGVKPKVVIRADNLAYCPQQPWIMNAS 712

Query: 430 ------------RQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAI 477
                         ++ K I+A  L P  +   + P     ++ ++   LSGG+  R+++
Sbjct: 713 LKDNILFGYKYDEAMYKKTIKACQLLPDLE---ILPDGDQTLVGEKGISLSGGQKARLSL 769

Query: 478 VLSLGIPADIYLIDEPSAYLDSEQRIICSKVI 509
             ++   AD+YL+D+  + +DS    +C  +I
Sbjct: 770 ARAVYSRADLYLLDDVLSAVDSH---VCKSII 798

>Scas_711.39
          Length = 1227

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
               V   FI  T+  D + V D
Sbjct: 1172 -LSVNAQFICTTFRTDMLQVAD 1192

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 367 LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA----GAIPADDGTSVPKLNVSMKPQTIA 422
           L+  SG      +  ++GE+G GKTTL+  LA    G I  D       ++ S K +T  
Sbjct: 748 LDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTITGDMLVDGLPMDASFKRRT-- 805

Query: 423 PKFPGTVRQ-------LFFK---KIRAQFLNPQFQTDVVKPLKIDDIID----QEVKHLS 468
               G V+Q       L  K   +  A+   PQ   D  K   ++ II     QE     
Sbjct: 806 ----GYVQQQDLHVAELTVKESLQFSARMRRPQSIPDAEKMEYVEKIISILEMQEFSEAL 861

Query: 469 GGEL---------QRVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
            GE+         ++++I + L G P  +  +DEP++ LDS+      K+++R  L
Sbjct: 862 VGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVVKMLKRLAL 917

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
           +  +SGGE +RV+I  +L     IY  D  +  LDS   +  ++ IR
Sbjct: 177 ISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIR 223

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 36.2 bits (82), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 88/217 (40%), Gaps = 39/217 (17%)

Query: 352 AYSYPDMKR-TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG---- 406
            YS+P   + +  + TLN+     +     +++G NG GK+TL+KLL+G     +G    
Sbjct: 11  TYSFPHTTKPSLANITLNIPWNTRT-----LVVGSNGAGKSTLLKLLSGKHLCLNGRILV 65

Query: 407 --------TSVPK----------LNVSMKPQTIAPKFPGTVRQL---FFKKIRAQFLNPQ 445
                   TS+ K          L       +I  +  G +  L    F+  R +     
Sbjct: 66  NGLDPFSPTSMQKDAEDCQITTYLGTEWCHMSIINRDIGILELLNSIGFEHYRER----- 120

Query: 446 FQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIIC 505
              +++  L ID  ++  +  LS G+ +RV + + L  P  + L+DE +  LD   R   
Sbjct: 121 -GEELISILDID--LEWRMHRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVARSKL 177

Query: 506 SKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFDG 542
              + +     + +     H F   ++  D+VI   G
Sbjct: 178 LDFLEKETRTRRCSVVYATHIFDGLSHWPDRVIHIKG 214

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 69/156 (44%), Gaps = 24/156 (15%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRF----DDPPEWQEIIKYFRGSELQNYFTKMLED- 162
           +VG+NG GKST LK+L+GK     GR      DP         F  + +Q    K  ED 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDP---------FSPTSMQ----KDAEDC 83

Query: 163 DIKAIIKPQYVDNLPRAIKGPVQKVGELLK-LRMEKPQDTVKQYIKTLQLDHLLNREIGL 221
            I   +  ++      +I      + ELL  +  E  ++  ++ I  L +D  L   +  
Sbjct: 84  QITTYLGTEWCH---MSIINRDIGILELLNSIGFEHYRERGEELISILDID--LEWRMHR 138

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQR 257
           LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 139 LSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVAR 174

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 79/199 (39%), Gaps = 36/199 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L +LA + +                    G    N F    
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRV-------------------GVVTGNIFVDGH 909

Query: 161  EDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLR--MEKPQDT--------VKQYIKTLQ 210
              D     K  Y     + + G  Q V + LK    + +PQ          V+  IK L 
Sbjct: 910  LRDTSFQRKTGYCQQ--QDLHGRTQTVRDALKFSAYLRQPQSISRAEKNAYVEDIIKLLG 967

Query: 211  LDHLLNREIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQRLNAALIIR 265
            ++   +  +G+   G    + +R  I +  V   ++ +F DEP+S LD +   +   +I+
Sbjct: 968  MEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIK 1027

Query: 266  SLLEPSKYVIAVEHDLSVL 284
             L+   + ++   H  S +
Sbjct: 1028 KLVNHGQAILCTIHQPSAI 1046

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 29/165 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----TSVPKLNVSMKPQTIAPKFP 426
            +  +MG +G GKTTL+ +LA     G +  +   DG    TS  +     + Q +  +  
Sbjct: 873  LTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGHLRDTSFQRKTGYCQQQDLHGR-T 931

Query: 427  GTVRQLFFKKIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEV----KHLSGGELQ 473
             TVR     K  A    PQ         +  D++K L ++   D  V    + L+  + +
Sbjct: 932  QTVRDAL--KFSAYLRQPQSISRAEKNAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRK 989

Query: 474  RVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            R+ I + L   P  +  +DEP++ LDS+      ++I++ + H +
Sbjct: 990  RLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

>Kwal_56.22329
          Length = 776

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKY-VIAVEHD 280
           LSGG+ QR AIA + ++   + + DE +S LDV+        +  L++  +  +I++ H 
Sbjct: 628 LSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHR 687

Query: 281 LSVL 284
           LS +
Sbjct: 688 LSTI 691

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 5/142 (3%)

Query: 453 PLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   D II      LSGG+ QR+AI  +L     I ++DE ++ LD E     +  + + 
Sbjct: 614 PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKL 673

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPESLLTGCNRFLKNLNVTFR 572
           +   + T   + H  +     ++ VIV     S        +      +   K LN   R
Sbjct: 674 MKSKELTIISIAHR-LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKR 732

Query: 573 RDPNSFRPRINKLDSQMDKEQK 594
             P    PR+   D + D+EQ+
Sbjct: 733 DKPT---PRVQS-DPEKDREQE 750

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
           Saccharomyces cerevisiae YLL048c YBT1 yeast bile
           transporter, start by similarity
          Length = 1650

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 87/208 (41%), Gaps = 29/208 (13%)

Query: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG-TSVPKLNVSMKP 418
           +   DF L   + +F   ++ V++G  G+GKT+L+  L G +   +G   VP LN     
Sbjct: 710 KNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFVPSLN---PR 766

Query: 419 QTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVV--------------------KPLKIDD 458
           + +  +  G    + +    A  LN   + +++                    +  +I  
Sbjct: 767 EELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPYNENRYNAVISACGLKRDFEILS 826

Query: 459 IIDQ-EVKH----LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 513
             DQ E+      LSGG+ QRV++  SL   +   L+D+  + +DS   +   +      
Sbjct: 827 AGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGP 886

Query: 514 LHNKKTAFIVEHDFIMATYLADKVIVFD 541
           L   +T  +V H+  +    AD VI+ +
Sbjct: 887 LMEGRTCVLVSHNVALTLKNADWVIIME 914

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
           required for weak organic acid resistance, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 41/186 (22%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK L+G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 174 GEMLFVVGRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVIYCPELD 233

Query: 154 NYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQ--- 210
            +F K+    +K  I      +     K P        ++R++K   T KQY+  ++   
Sbjct: 234 FHFPKI---TVKETI------DFALKCKTP--------RVRIDKM--TRKQYVDNIRDMW 274

Query: 211 -----LDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNA 260
                L H    ++G      +SGGE +R ++  +   +A +Y +D  +  LD    L  
Sbjct: 275 CTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEF 334

Query: 261 ALIIRS 266
           A  IR+
Sbjct: 335 AQAIRT 340

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 88/209 (42%), Gaps = 45/209 (21%)

Query: 371 SGEFSDSEILVMMGENGTGKTTLIKLLAGAIP---------ADDGTSVPKLNVSMKPQTI 421
           +G     E+L ++G  G G +T +K L+G            + DG    ++    K   I
Sbjct: 168 TGVVESGEMLFVVGRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVI 227

Query: 422 -APK----FPG-TVRQLFFKKIRAQFLNPQFQTD-VVKPLKIDDIIDQE----------- 463
             P+    FP  TV++     ++ +   P+ + D + +   +D+I D             
Sbjct: 228 YCPELDFHFPKITVKETIDFALKCK--TPRVRIDKMTRKQYVDNIRDMWCTVFGLRHTYA 285

Query: 464 -------VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
                  V+ +SGGE +RV++V +  + A IY  D  +  LD+   +  ++ IR      
Sbjct: 286 TKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR------ 339

Query: 517 KKTAFIVEHDFIMATYLADKVI--VFDGT 543
                +V +  I+A Y A + I  +FD T
Sbjct: 340 -TATNMVNNSAIVAIYQAGENIYELFDKT 367

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 2/32 (6%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG 132
           +PG++  L+G +G GK+T L +LA  Q+ N+G
Sbjct: 869 KPGKMTALMGESGAGKTTLLNVLA--QRINMG 898

>AGL346W [3966] [Homologous to ScYGR281W (YOR1) - SH]
           complement(61232..65434) [4203 bp, 1400 aa]
          Length = 1400

 Score = 36.2 bits (82), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 36/204 (17%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGT----------SVPKL- 412
           D   +++ GEF     ++++G  GTGKT+L+  +AG +    G+           VP + 
Sbjct: 553 DLLFSIKKGEF-----IIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLLFCGVPWIQ 607

Query: 413 NVSMKPQTIAPKFPGTVRQLFFKK-IRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGE 471
           N +++   I   F  +  Q  + + + A  L   F+   + P      + +    LSGG+
Sbjct: 608 NATIRDNII---FGSSFDQTRYDEVVNACALEADFK---IFPAGDKTEVGERGITLSGGQ 661

Query: 472 LQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILH--NKKTAFIVEHDFIM 529
             R+++  ++    DIYL D+  + +D+    + + + ++ +L     +T  +  H   +
Sbjct: 662 KARISLARAIYKDRDIYLFDDIISAVDAN---VAAHITQKCLLDRLQNRTRILATHQLAL 718

Query: 530 ATYLADKVIV------FD-GTPSQ 546
               A +VI       FD GTP++
Sbjct: 719 VQE-ASRVIFLGQDGSFDMGTPAE 741

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLD 253
           LSGG+  R ++A +  +D D+Y+FD+  S +D
Sbjct: 657 LSGGQKARISLARAIYKDRDIYLFDDIISAVD 688

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 29/177 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DGTS---------- 408
            LN   G      +  +MG +G GKTTL+  LA     G I  +   DG            
Sbjct: 876  LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSFARSIG 935

Query: 409  -VPKLNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV- 464
               + ++ +K  T+  + +F   +RQ     I  +    Q+  DV+K L+++   D  V 
Sbjct: 936  YCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEK---NQYVEDVIKILEMEQYADAVVG 992

Query: 465  ---KHLSGGELQRVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 993  VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1049

>Scas_714.42
          Length = 1520

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 80/177 (45%), Gaps = 29/177 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----TSVPK--- 411
            LN   G      +  +MG +G GKTTL+  LA     G I  D   +G     S P+   
Sbjct: 889  LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVNGRPRDQSFPRSIG 948

Query: 412  ----LNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV- 464
                 ++ +K  T+  + +F   +RQ     I  +    Q+  DV+K L+++   D  V 
Sbjct: 949  YCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEK---NQYVEDVIKILEMEAYADAVVG 1005

Query: 465  ---KHLSGGELQRVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1006 VAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLADHGQ 1062

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
           Saccharomyces cerevisiae YPL058c PDR12 multidrug
           resistance transporter, start by similarity
          Length = 1518

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 75/171 (43%), Gaps = 32/171 (18%)

Query: 372 GEFSDSEILVMMGENGTGKTTLIKLLAGA------IPAD---DGTSVPKLNVSMKPQTI- 421
           G     E+L ++G  G G +TL+K ++G       +  D   DG S  ++    K   I 
Sbjct: 170 GVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQAEMMEKFKGYVIY 229

Query: 422 APK----FPG-TVRQLF-------FKKIRAQFLNPQFQTDVVKPLKID----------DI 459
            P+    FP  TV++           ++R   L+     D ++ L             ++
Sbjct: 230 CPELDFHFPKITVKETIDFALKCKTPRVRIDHLSRNQYVDNMRDLWCTVFGLRHTYATNV 289

Query: 460 IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
            +  V+ +SGGE +RV++V +L + A IY  D  +  LD+   +  ++ IR
Sbjct: 290 GNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

>Scas_567.1
          Length = 810

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 35/183 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRFD-DPPEWQEIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G F  D  +  E++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKM-LEDDIKAIIKPQY----VDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKT 208
            +F K+ +++ I   +K +     +DN+ RA                E        +   
Sbjct: 240 FHFPKITVKETIDFALKCKTPRTRIDNMSRA----------------EYVDSLRDMWCTV 283

Query: 209 LQLDHLLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALI 263
             L H    ++G      +SGGE +R ++  +    A +Y +D  +  LD    L  A  
Sbjct: 284 FGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQA 343

Query: 264 IRS 266
           IR+
Sbjct: 344 IRT 346

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V +  + A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 23/114 (20%)

Query: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +++       K 
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL----SKN 1178

Query: 520  AFIVEHDFIMATYLADKVIVFDG---TPSQNTTATAPE-------SLLTGCNRF 563
            A      FI  T+  D + V D       +N  +T  E         + G N+F
Sbjct: 1179 A-----QFICTTFRTDMLQVADKFFRVKYENKISTVIEVNREEAIGFIRGSNKF 1227

>YIL013C (PDR11) [2652] chr9 complement(328205..332440) Membrane
           transporter of the ATP-binding cassette (ABC)
           superfamily, plays a role in sterol uptake and anaerobic
           growth [4236 bp, 1411 aa]
          Length = 1411

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 81/173 (46%), Gaps = 17/173 (9%)

Query: 354 SYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLN 413
           S+ ++  T GD  L   +  +  S +  +MGE+G GKTTL+ +L+     + G    +L 
Sbjct: 752 SWKNINYTIGDKKLINDASGYISSGLTALMGESGAGKTTLLNVLSQR--TESGVVTGELL 809

Query: 414 VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKID---DII---------- 460
           +  +P T    F  ++  +  + +  + L  +   ++   L+ D   D +          
Sbjct: 810 IDGQPLTNIDAFRRSIGFVQQQDVHLELLTVRESLEISCVLRGDGDRDYLGVVSNLLRLP 869

Query: 461 -DQEVKHLSGGELQRVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++ V  LS  + + ++I + L   P+ +  +DEP++ LD+E  +   + +++
Sbjct: 870 SEKLVADLSPTQRKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKK 922

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 194 RMEKPQDTVKQY-IKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYL 252
           R+E   + +K++ +  ++  ++ N  +  +SGGE +R +I  + + +  VY++D  +  L
Sbjct: 143 RIEMRDELLKEFGLSHVKKTYVGNDYVRGVSGGERKRISIIETFIANGSVYLWDNSTKGL 202

Query: 253 DVKQRLNAALIIRSLLEPSKYV 274
           D    L    I + + + ++ V
Sbjct: 203 DSATALEFLSITQKMAKATRSV 224

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   +  +++        
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQ-------- 1174

Query: 520  AFIVEHDFIMATYLADKVIVFD 541
                +  FI  T+  D + V D
Sbjct: 1175 -LSSQAQFICTTFRGDMIAVAD 1195

>CAGL0G05093g complement(483230..484864) similar to sp|Q12298
           Saccharomyces cerevisiae YDR061w, hypothetical start
          Length = 544

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%)

Query: 450 VVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVI 509
           +V+ LK++++ ++    LS G+++R  +  SL    D+ L+D+P   LD     I SK +
Sbjct: 142 LVRELKLEELQNRWAMGLSNGQMRRARLARSLLKQPDLILVDDPFLGLDPTATAIISKFL 201

Query: 510 RRFILHNKKTAF 521
             +    K+ ++
Sbjct: 202 SNWGGAGKENSY 213

>Kwal_27.9666
          Length = 1474

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 27/164 (16%)

Query: 379  ILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKF-----------PG 427
            +  +MG +G GKTTL+  LA  +     T    +N + +  + A                
Sbjct: 858  LTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQDLHLQTA 917

Query: 428  TVRQLFFKKIRAQFLNPQ---------FQTDVVKPLKIDDIIDQEVKHLSGG----ELQR 474
            TVR+    +  A    PQ         +  +V+K L+++   D  V     G    + +R
Sbjct: 918  TVRESL--RFAAHLRQPQSVPSSEKDKYVDEVIKILEMEKYADAVVGVAGEGLNVEQRKR 975

Query: 475  VAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            + I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 976  LTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQ 1019

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 80/197 (40%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFD-------DPPEWQEIIKYFRGSELQ 153
            +PG +  L+G +G GK+T L  LA +    +   D           +   I Y +  +L 
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNKRDASFARSIGYCQQQDL- 912

Query: 154  NYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLK-LRMEKPQDTVKQYIKTLQLD 212
            +  T  + + ++     +   ++P + K   + V E++K L MEK  D V          
Sbjct: 913  HLQTATVRESLRFAAHLRQPQSVPSSEKD--KYVDEVIKILEMEKYADAV---------- 960

Query: 213  HLLNREIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQRLNAALIIRSL 267
                  +G+   G    + +R  I +       + +F DEP+S LD +   +   ++R L
Sbjct: 961  ------VGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKL 1014

Query: 268  LEPSKYVIAVEHDLSVL 284
                + ++   H  S L
Sbjct: 1015 ANHGQAILCTIHQPSAL 1031

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
           similarity to mammalian ATP-dependent bile acid
           transporter, member of the ATP-binding cassette (ABC)
           superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 89/207 (42%), Gaps = 35/207 (16%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKP-QTIA 422
           DF L   + EF   ++ V++G  G+GKT+L+  L G +   +G  V     +++P Q + 
Sbjct: 709 DFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVP---ALEPRQELI 765

Query: 423 PKFPGTVRQLFFKKIRAQFLNPQFQTDVV-----------------------KPLKIDDI 459
               GT   + +    A  LN   + +++                       + LK  D+
Sbjct: 766 VDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDL 825

Query: 460 --IDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI---L 514
             I ++   LSGG+ QRV++  +L   A   L+D+  + +DS      S +    I   L
Sbjct: 826 TEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHT---ASWIYDNCITGPL 882

Query: 515 HNKKTAFIVEHDFIMATYLADKVIVFD 541
              +T  +V H+  +    A+ V++ +
Sbjct: 883 MEDRTCILVSHNIALTLRNAELVVLLE 909

>Scas_627.18
          Length = 533

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%)

Query: 442 LNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQ 501
           +N +    ++K LK+ ++ D+    LS G+++R  +  +L    D+ L+D+P   LD   
Sbjct: 132 VNMELYNKLIKSLKLVELQDRYAMGLSNGQMRRARLTHTLLKEPDLLLVDDPFLGLDPTA 191

Query: 502 RIICSKVIRRF 512
             I SK +  +
Sbjct: 192 TSIISKFLATY 202

>CAGL0F01419g complement(142623..146819) highly similar to tr|Q08409
           Saccharomyces cerevisiae YOR011w AUS1, start by
           similarity
          Length = 1398

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 73/159 (45%), Gaps = 23/159 (14%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKK 436
           S +  +MGE+G GKTTL+ +L+     + G    ++ +  KP T    F  ++  +  + 
Sbjct: 780 SGLTALMGESGAGKTTLLNVLSQR--TESGVVSGEILIDGKPLTNENAFRRSIGFVQQQD 837

Query: 437 IRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAI-------------VLSLGI 483
           I  + L  +   ++   L+ D   D E    S  EL ++ +             +LS+G+
Sbjct: 838 IHLELLTVKESLEISSELRGDG--DMEYVE-SISELLKLPLDSLVRELNPTQRKLLSIGV 894

Query: 484 -----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
                P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 895 ELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 933

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 196 EKPQDTVKQYIKTLQLDHLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSS 250
           E+ ++   + ++   L H+ +  +G      +SGGE +R +I  + + +  VY++D  + 
Sbjct: 150 EERENMRNELLREFGLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGSVYLWDNSTK 209

Query: 251 YLDVKQRLNAALIIRSLLEPSKYV 274
            LD    L+   I++ +   ++ V
Sbjct: 210 GLDSSTALDFLTILQKMARTTRSV 233

>Scas_472.1*
          Length = 393

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 11/87 (12%)

Query: 464 VKHLSGGELQRVAIVLSLGIPADIYLI--DEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ LSGG  Q+V +VL+ G     +LI  DEP+ YLD +     SK ++ F    +    
Sbjct: 243 IRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF----EGGVI 296

Query: 522 IVEHDFIMATYLADKVI-VFDG--TPS 545
           I+ H       L ++V  V DG  TPS
Sbjct: 297 IITHSAEFTKNLTEEVWAVKDGKMTPS 323

>Scas_717.6*
          Length = 1400

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 82/180 (45%), Gaps = 18/180 (10%)

Query: 354 SYPDMKRT-QGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKL 412
           S+ ++  T +GD  L      F  S +  +MGE+G GKTTL+ +L+  + + + T   +L
Sbjct: 748 SWRNINYTVEGDKQLINDCSGFISSGLTALMGESGAGKTTLLNVLSQRVTSGEVTG--EL 805

Query: 413 NVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKID---DIIDQEVKHLSG 469
            +  +P T    F  ++  +  + +    L  +   ++   L+ D   D +    K L  
Sbjct: 806 LIDGQPLTNIAAFRRSIGFVQQQDVHLDLLTVKESLEISCILRGDGDRDYLGTVAKLLKL 865

Query: 470 GELQRVA-------IVLSLGI-----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
                VA        +LS+G+     P+ +  +DEP++ LD+E  +   + +++  L  +
Sbjct: 866 PANTLVADLTPTEKKLLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVQFLKKLSLQGQ 925

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 195 MEKPQDTVKQYIKTLQLDHLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPS 249
           +E+      + +    L H+++  +G      +SGGE +R +I  + + +  VY++D  +
Sbjct: 146 LEERNQMRDELLNGFGLSHVVDTFVGNDYVRGVSGGERKRISIIETFIANGSVYLWDNST 205

Query: 250 SYLDVKQRLNAALIIRSLLEPSKYV 274
             LD    L    I++++   ++ V
Sbjct: 206 KGLDSSTALEFLSILQTMARTTRSV 230

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 10/82 (12%)

Query: 428 TVRQLFFKKIRAQFLNP-----QFQTDVVKPLKIDDIID-----QEVKHLSGGELQRVAI 477
           TVRQ     +  +F  P     Q + +++    +  ++D       V+ +SGGE +R++I
Sbjct: 129 TVRQTIDFALSCKFHIPLEERNQMRDELLNGFGLSHVVDTFVGNDYVRGVSGGERKRISI 188

Query: 478 VLSLGIPADIYLIDEPSAYLDS 499
           + +      +YL D  +  LDS
Sbjct: 189 IETFIANGSVYLWDNSTKGLDS 210

>Scas_707.8
          Length = 294

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 73/167 (43%), Gaps = 16/167 (9%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRF----DDPPEWQEIIKYFRGSE 151
           +L  P   + L +VG NG GKST LK+LAGK     G+      DP        +   S 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKHLCLNGKILVNGLDP--------FSPLSM 77

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNLPRAIKGPVQKVGELLK-LRMEKPQDTVKQYIKTLQ 210
            Q+      ED    +      +    +I      V ELL+ + +   +D   + I+ L 
Sbjct: 78  YQDNDKTTAEDKDWQVTTYLGTEWCHMSIINRDIGVLELLESIGLAHYRDRGNKLIEILD 137

Query: 211 LDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQR 257
           ++  +N  +  LS G+ +R  +AM  ++   V + DE +  LDV  R
Sbjct: 138 IN--INWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIAR 182

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 381 VMMGENGTGKTTLIKLLAG 399
           +++G NG GK+TL+KLLAG
Sbjct: 37  LVVGANGAGKSTLLKLLAG 55

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 29/177 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----TSVPK--- 411
            LN   G      +  +MG +G GKTTL+  LA     G I  +   DG     S P+   
Sbjct: 903  LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDESFPRSIG 962

Query: 412  ----LNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKI----DDIID 461
                 ++ +K  T+  + +F   +RQ     I  +    ++  +V+K L++    D ++ 
Sbjct: 963  YCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEK---NRYVEEVIKILEMQQYSDAVVG 1019

Query: 462  QEVKHLSGGELQRVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 1020 VAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKLATHGQ 1076

>Scas_612.11*
          Length = 1506

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 64/153 (41%), Gaps = 33/153 (21%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG----------TSVPKL- 412
           D    ++ GEF     ++M+G  GTGKT+L+   AG +    G             P + 
Sbjct: 651 DLNFEIKKGEF-----IIMVGPIGTGKTSLLNAFAGFMNKVSGRIQINGDLLLCGYPWIQ 705

Query: 413 NVSMKPQTI------APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKH 466
           N S+K   I        K+   +R    K             D++    + +I ++ +  
Sbjct: 706 NASVKDNIIFGSPYNKAKYDEVIRVCSLKS----------DLDILPAGDLTEIGERGIT- 754

Query: 467 LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDS 499
           LSGG+  R+ +  S+    DIYL D+  + +DS
Sbjct: 755 LSGGQKARINLARSVYKQKDIYLFDDVLSAVDS 787

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLE--PSKYVIAVEH 279
           LSGG+  R  +A S  +  D+Y+FD+  S +D   R+   ++    L     K  I   H
Sbjct: 755 LSGGQKARINLARSVYKQKDIYLFDDVLSAVD--SRVGKHIMDECFLGLLKDKTRILATH 812

Query: 280 DLSVLDYLSDFVCI 293
            LS+L+  S  + +
Sbjct: 813 QLSLLERASRVIVL 826

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 47/112 (41%), Gaps = 16/112 (14%)

Query: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   ++ I +  L N   
Sbjct: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQ--LSNN-- 1167

Query: 520  AFIVEHDFIMATYLADKVIV---FDGTPSQNTTATAPESLLTGCNRFLKNLN 568
                   FI  T+ +D V     F     +N  ++  E       RF+K  N
Sbjct: 1168 -----AQFICTTFRSDMVDAANKFYRVKYENKQSSVIEVTKEEAKRFIKGGN 1214

>Scas_586.3
          Length = 1531

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 29/171 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DGT----SVPK--- 411
            LN   G      +  +MG +G GKTTL+  LA     G I  D   +G     S P+   
Sbjct: 886  LNNIDGWVKPGTLTALMGASGAGKTTLLDCLAQRVTVGTITGDVFVNGCLRDESFPRSIG 945

Query: 412  ----LNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV- 464
                 ++ +K  T+  + +F   +RQ F   +  +    ++  +++K L+++   D  V 
Sbjct: 946  YCQQQDLHLKTSTVRESLRFSAYLRQPFDVPVEEK---NKYVEEIIKTLEMETYADAVVG 1002

Query: 465  ---KHLSGGELQRVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRR 511
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++
Sbjct: 1003 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKK 1053

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 95/228 (41%), Gaps = 27/228 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +   D          +  G    N F + +
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGD---------MFVNGHLRDNSFPRSI 937

Query: 161  EDDIKAIIKPQYVDNLPRAIKGPVQKVGELLK---LRMEKPQDTVKQYIKTLQLDHLLNR 217
                    + Q +      ++  ++    L +   + +E+  + V+  I  L++    + 
Sbjct: 938  -----GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINILEMQQYADA 992

Query: 218  EIGLLSGG----ELQRFAIAMSCVQDADVYMF-DEPSSYLDVKQRLNAALIIRSLLEPSK 272
             +G+   G    + +R  I +       + +F DEP+S LD +   +   ++R L +  +
Sbjct: 993  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

Query: 273  YVIAVEHDLSVLDYLSDFVCILY---GVPSVYGVVTLPSSVREGINIF 317
             ++   H  S L  + +F  +L+   G  +VY    L    +E IN F
Sbjct: 1053 AILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYF 1098

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 29/165 (17%)

Query: 379  ILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----TSVPK---------LNVSMK 417
            +  +MG +G GKTTL+  LA     G I  D   +G     S P+         L++S  
Sbjct: 891  LTALMGSSGAGKTTLLDCLASRVTMGVITGDMFVNGHLRDNSFPRSIGYCQQQDLHLSTS 950

Query: 418  PQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV----KHLSGGELQ 473
                + +F   +RQ     I  +     +  DV+  L++    D  V    + L+  + +
Sbjct: 951  TVRESLRFSAYLRQPSSVSIEEK---NNYVEDVINILEMQQYADAVVGVAGEGLNVEQRK 1007

Query: 474  RVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            R+ I + L   P  +  +DEP++ LDS+      +++R+   H +
Sbjct: 1008 RLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 7/56 (12%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNV----SMKPQTIAPKFPGTV 429
           ++LV++G  G+G TTL+K ++  I   DG +V + +V     + P+TI   F G V
Sbjct: 175 DLLVVLGRPGSGCTTLLKTISSNI---DGYNVDENSVISYNGLDPRTIKKHFRGEV 227

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 21/181 (11%)

Query: 354 SYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLN 413
           S+ ++  T G   L   +  F  S +  +MGE+G GKTTL+ +L+  +  + G    ++ 
Sbjct: 752 SWKNINYTVGTKKLINNASGFISSGLTALMGESGAGKTTLLNVLSQRV--ETGVVSGEIL 809

Query: 414 VSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKID------DIIDQEVKHL 467
           +   P T    F  ++  +  + +    L+ +   ++   L+ D      D +   +K  
Sbjct: 810 IDGHPLTDEDAFKRSIGFVQQQDLHLDLLSVKESLEISCLLRGDGDRAYLDTVSNLLKLP 869

Query: 468 SG------GELQRVAIVLSLGI-----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           S          QR   +LS+G+     P+ +  +DEP++ LD+E  +   K +++  L  
Sbjct: 870 SDILVADLNPTQRK--LLSIGVELVTKPSLLLFLDEPTSGLDAEAALTIVKFLKQLSLQG 927

Query: 517 K 517
           +
Sbjct: 928 Q 928

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 206 IKTLQLDHLLNREIGL-----LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNA 260
           ++   L H+L   +G      +SGGE +R +I  + + +  VY++D  +  LD    L+ 
Sbjct: 151 LREFGLSHVLKTIVGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDF 210

Query: 261 ALIIRSLLEPSKYV 274
             I+R + + ++ V
Sbjct: 211 LEILRKMAKATRSV 224

>Scas_455.1
          Length = 925

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 85/199 (42%), Gaps = 23/199 (11%)

Query: 364 DFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG-TSVPKLN------VSM 416
           DF L   + +F   ++ V++G  G+GKT+L+  L G +   +G   VP L+      V  
Sbjct: 727 DFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLDPREDLVVDE 786

Query: 417 KPQTIAPKFPGTVRQLFFKKIRAQFL-----NPQFQTDVVKP---------LKIDDI--I 460
              T +  +      L    +R   L     N    T V++          LK  D+  I
Sbjct: 787 NGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEARYTSVIEACGLKRDFEILKAGDMTEI 846

Query: 461 DQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
            ++   LSGG+ QRV++  ++   +   L+D+  + +DS   +          L + +T 
Sbjct: 847 GEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNCITGPLMDGRTC 906

Query: 521 FIVEHDFIMATYLADKVIV 539
            +V H+  +    AD V++
Sbjct: 907 ILVSHNIALTLKNADLVVI 925

>Scas_552.4
          Length = 720

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 80/196 (40%), Gaps = 39/196 (19%)

Query: 382 MMGENGTGKTTLIKLL-------AGAIPAD--DGTSVPKLNVSMKPQTIAPK----FPGT 428
           ++G  G GK+T+I  L        G I  D  D TS+  LN   +   I P+    F GT
Sbjct: 483 IVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSI-NLNKLRRSINIIPQDPTLFTGT 541

Query: 429 VR-----------QLFFKKIRAQFLNPQ-----------FQTDVVKPLKIDDIIDQEVKH 466
           ++           +  F  +R   L P+              +V K L +++ I +   +
Sbjct: 542 IKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNNEISEGGSN 601

Query: 467 LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LS G+ Q V +  SL     I L+DE +A +D        + IR+    N  T   + H 
Sbjct: 602 LSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHR 659

Query: 527 FIMATYLADKVIVFDG 542
            + +    DK++V D 
Sbjct: 660 -LRSVIDYDKILVMDA 674

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
           Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
           cassette transporter protein, hypothetical start
          Length = 1477

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEP--SKYVIAVEH 279
           LSGG+  R  +A S  ++ D+Y+FD+  S +D   R+   ++    L+   SK  I   H
Sbjct: 723 LSGGQKARINLARSVYKNKDIYLFDDVLSAVD--SRVGKHIMDECFLQTLQSKTRILATH 780

Query: 280 DLSVLD 285
            LS+++
Sbjct: 781 QLSLIE 786

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
           cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 24/209 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKY--FRGSELQNYFTKM 159
           PG++L ++G  G G +T LK ++     N   F   P+   II Y  F   E++N++   
Sbjct: 205 PGELLVVLGRPGAGCTTLLKSIS----VNTHGFKISPD--TIITYNGFSNKEIKNHYRGE 258

Query: 160 L----EDDIK--AIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDH 213
           +    E DI    +   Q +  + R +K P  ++  + +    K    V   + T  L H
Sbjct: 259 VVYNAESDIHIPHLTVFQTLYTVAR-LKTPRNRIKGVDRDTFAKHMTEVA--MATYGLSH 315

Query: 214 LLNREIG-----LLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLN--AALIIRS 266
             + ++G      +SGGE +R +IA   +  +    +D  +  LD    L    AL  ++
Sbjct: 316 TADTKVGNDFVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIKALKTQA 375

Query: 267 LLEPSKYVIAVEHDLSVLDYLSDFVCILY 295
            +  S   +A+         L D VC+LY
Sbjct: 376 TITKSAATVAIYQCSKDAYDLFDKVCVLY 404

>Scas_587.8
          Length = 715

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 83/185 (44%), Gaps = 35/185 (18%)

Query: 352 AYSYPD--MKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLL-------AGAIP 402
           +++YP         + ++++Q GE      + ++G +G+GK+T+  LL        G+I 
Sbjct: 449 SFAYPTRPTHSILNNLSISIQPGEH-----VCIVGPSGSGKSTVSSLLLRYYDVSTGSIK 503

Query: 403 ADDGTSVPKLNVSMKPQTIAPK------FPGTVR-QLFFKKIRAQFLNPQF--------Q 447
            D G ++ + N+    + +         F GT+   + +  +  + L            Q
Sbjct: 504 ID-GQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQ 562

Query: 448 TDVVKPLK-----IDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQR 502
            +  K LK     ++ ++      LSGG+ QR+A+  +  +   + ++DE ++ LDS+  
Sbjct: 563 ANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSE 622

Query: 503 IICSK 507
            I +K
Sbjct: 623 EIVAK 627

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL 281
           LSGG+ QR A+A + +    + + DE +S LD +     A  +   +E     I++ H L
Sbjct: 587 LSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVELGLTTISIAHRL 646

Query: 282 SVLDYLSDFVCI 293
           S + + +  + +
Sbjct: 647 STIKHSTRVIVL 658

>KLLA0E19074g complement(1691643..1692623) highly similar to
           sp|P52920 Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 326

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKI 437
           +IL++ G+ G GK+T   +L+ A+ AD+   V  +++ +   ++ P   G VR+   +  
Sbjct: 72  KILILSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCVRETIHESN 130

Query: 438 RAQFLNPQFQTDVVKPLKI 456
                 P + TD +  + I
Sbjct: 131 TG--WTPVYVTDNLATMSI 147

>Scas_716.82
          Length = 675

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 70/155 (45%), Gaps = 26/155 (16%)

Query: 381 VMMGENGTGKTTLIKLLA----GAIPADDGTSVPKLNVSMKPQT---------IAPKFPG 427
            +MGE+G GKTTL+  LA    G I  D   +   ++ S + +T         IA     
Sbjct: 61  AVMGESGAGKTTLLNTLAQRNVGIITGDMLINGRPIDASFERRTGYVQQQDVHIAELTVR 120

Query: 428 TVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIID-QEVKHLSGGELQRVAIV-----LSL 481
              Q   +  RAQ +  + +   V+  KI  ++D QE      GE+ R   V     LS+
Sbjct: 121 ESLQFSARMRRAQAIPDEEKMAYVE--KIIHVLDMQEYAEALVGEIGRGLNVEQRKKLSI 178

Query: 482 GI-----PADIYLIDEPSAYLDSEQRIICSKVIRR 511
           G+     P  +  +DEP++ LDS+      +++R+
Sbjct: 179 GVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRK 213

>Scas_469.1
          Length = 609

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 4/44 (9%)

Query: 355 YPDMKRTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLI 394
           Y D+ + + D  ++ Q  EF     +++I+V +GE G+GKTT I
Sbjct: 120 YFDILKIRRDLPVHAQRAEFLKIYQENQIMVFVGETGSGKTTQI 163

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 80/177 (45%), Gaps = 29/177 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DGT----SVPK--- 411
            LN   G      +  +MG +G GKTTL+  LA     G I  D   +G     S P+   
Sbjct: 888  LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIPRDKSFPRSIG 947

Query: 412  ----LNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV- 464
                 ++ +K  T+  + +F   +RQ     I  +    ++  +V+K L+++   D  V 
Sbjct: 948  YCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEK---NRYVEEVIKILEMEKYADAVVG 1004

Query: 465  ---KHLSGGELQRVAIVLSL-GIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1005 VAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1061

>CAGL0H03091g complement(292976..293980) highly similar to sp|P52920
           Saccharomyces cerevisiae YGL091c NBP35
           nucleotide-binding protein, start by similarity
          Length = 334

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSM 416
           +ILV+ G+ G GK+T   +L+ A+ ADD   V  +++ +
Sbjct: 80  KILVLSGKGGVGKSTFTTMLSWALSADDNLQVGAMDLDI 118

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 29/177 (16%)

Query: 367  LNVQSGEFSDSEILVMMGENGTGKTTLIKLLA-----GAIPAD---DG----TSVPK--- 411
            LN   G      +  +MG +G GKTTL+  LA     G I  D   +G    TS  +   
Sbjct: 904  LNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDTSFSRSIG 963

Query: 412  ----LNVSMKPQTI--APKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEV- 464
                 ++ +K  T+  + +F   +RQ     I  +    ++   V+K L+++   D  V 
Sbjct: 964  YCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEK---NEYVEAVIKILEMETYADAVVG 1020

Query: 465  ---KHLSGGELQRVAIVLSLGI-PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
               + L+  + +R+ I + L   P  +  +DEP++ LDS+      +++++   H +
Sbjct: 1021 VPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKLANHGQ 1077

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 82/197 (41%), Gaps = 40/197 (20%)

Query: 382  MMGENGTGKTTLIKLL-------AGAIPADDGTSVPKLNVSM--KPQTIAPK----FPGT 428
            ++G  G GK+T+I  L        G I  D G  + K+++    +  TI P+    F GT
Sbjct: 1355 IVGRTGAGKSTIITALFRLLEPITGCIKID-GQDISKIDLVTLRRSITIIPQDPILFAGT 1413

Query: 429  VR-----------QLFFKKIR----------AQFLNPQ--FQTDVVKPLKIDDIIDQEVK 465
            ++           +  FK +            + LN +  F +   K L +   I +   
Sbjct: 1414 IKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGL 1473

Query: 466  HLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +LS GE Q + I  SL     I L+DE ++ +D +   +   +IR     NK T   + H
Sbjct: 1474 NLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRS--EFNKSTILTIAH 1531

Query: 526  DFIMATYLADKVIVFDG 542
              + +    D++IV D 
Sbjct: 1532 R-LRSVIDYDRIIVMDA 1547

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 89/198 (44%), Gaps = 20/198 (10%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RFDDPPEWQEIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  L    +P  G  + D     Q+I K      L+   T +
Sbjct: 1349 PQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDG----QDISK-IDLVTLRRSITII 1403

Query: 160  LED------DIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDH 213
             +D       IK+ + P Y +   + I   + +V  +     E+  ++ +++  T     
Sbjct: 1404 PQDPILFAGTIKSNVDP-YDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFL 1462

Query: 214  LLNREI---GL-LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLE 269
             L+ EI   GL LS GE Q   IA S +++  + + DE +S +D         IIRS   
Sbjct: 1463 NLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFN 1522

Query: 270  PSKYVIAVEHDL-SVLDY 286
             S  ++ + H L SV+DY
Sbjct: 1523 KST-ILTIAHRLRSVIDY 1539

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
           cerevisiae YLL048c YBT1 yeast bile transporter,
           hypothetical start
          Length = 1648

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 91/211 (43%), Gaps = 32/211 (15%)

Query: 365 FTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG-TSVPKLNVSMKPQTIAP 423
           F L     EF   ++ V++G  G+GKT+++  L G +   +G   VP L+   + Q+ A 
Sbjct: 722 FVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAG 781

Query: 424 ------KFPGTVRQLFFKKIRAQFL-NPQF---QTDVV----------KPLKIDDI--ID 461
                  +      L    +R   L N  F   + D V          + LK  D   I 
Sbjct: 782 VINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYDAVVEACSLKRDFQILKAGDSTEIG 841

Query: 462 QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTA 520
           ++   LSGG+ QRV++  +L   A   L+D+  + +DS   + I  K I   ++   +T 
Sbjct: 842 EKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTC 900

Query: 521 FIVEHDFIMATYLADKVIVFD-------GTP 544
            +V H+  +    AD V++ +       GTP
Sbjct: 901 ILVTHNIALTMKNADFVVMIEDGKVKEKGTP 931

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           ++G+NG GKST LK+L+GK 
Sbjct: 37  IIGSNGAGKSTLLKLLSGKH 56

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/19 (57%), Positives = 17/19 (89%)

Query: 381 VMMGENGTGKTTLIKLLAG 399
           +++G NG GK+TL+KLL+G
Sbjct: 36  LIIGSNGAGKSTLLKLLSG 54

>YGL091C (NBP35) [1892] chr7 complement(342057..343043) Putative
           nucleotide-binding protein, has similarity to bacterial
           partitioning ATPases [987 bp, 328 aa]
          Length = 328

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 3/81 (3%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFK 435
           + +ILV+ G+ G GK+T   +L+ A+ AD+   V  +++ +   ++ P   G +++   +
Sbjct: 72  EHKILVLSGKGGVGKSTFAAMLSWALSADEDLQVGAMDLDICGPSL-PHMLGCIKETVHE 130

Query: 436 KIRAQFLNPQFQTDVVKPLKI 456
                   P + TD +  + I
Sbjct: 131 SNSG--WTPVYVTDNLATMSI 149

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 39  VVGANGAGKSTLLKLLSGKH 58

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 381 VMMGENGTGKTTLIKLLAGAIPADDG 406
           +++G NG GK+TL+KLL+G     DG
Sbjct: 38  LVVGANGAGKSTLLKLLSGKHLCLDG 63

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 17/20 (85%)

Query: 380 LVMMGENGTGKTTLIKLLAG 399
           +++ G NG GK+TL+KLL+G
Sbjct: 37  MLLCGSNGAGKSTLLKLLSG 56

>YER013W (PRP22) [1436] chr5 (178840..182277) Pre-mRNA splicing
           factor of DEAH box family, required for release of
           mature mRNA from the spliceosome [3438 bp, 1145 aa]
          Length = 1145

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 20/136 (14%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFK 435
           D++ LV++GE G+GKTT I         ++G S    N  M    I    P  V  +   
Sbjct: 498 DNQFLVIVGETGSGKTTQITQYLD----EEGFS----NYGM----IGCTQPRRVAAVSVA 545

Query: 436 KIRAQFLNPQFQTDVVKPLKIDDII--DQEVKHLSGGELQRVAIVLSLGIPADIYLIDEP 493
           K  A+ +  +   DV   ++ +D+   D  +K+++ G LQR A++        + ++DE 
Sbjct: 546 KRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREALLDPEMSKYSVIMLDE- 604

Query: 494 SAYLDSEQRIICSKVI 509
                + +R + + V+
Sbjct: 605 -----AHERTVATDVL 615

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 69/162 (42%), Gaps = 20/162 (12%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRFD----DPPEWQEIIKYFRGSELQN--YFTKMLE 161
           +VG NG GKST LK+L+GK     G       DP     +      + ++N   F    E
Sbjct: 38  VVGANGAGKSTLLKLLSGKHLCLTGNIKVNGLDPFSPLSMTTSIDNTLIENDDGFGNKGE 97

Query: 162 DDIKAIIKPQY----VDNLPRAIKGPVQKVG-ELLKLRMEKPQDTVKQYIKTLQLDHLLN 216
             +   +  ++    + N    +   +  +G +  K R ++        I  L +D  +N
Sbjct: 98  CQVSTYLGTEWCHMSIINRDIGVLELLDSIGYQFFKQRGDR-------LIDILDID--VN 148

Query: 217 REIGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRL 258
             +  LS G+ +R  +AM  ++   V + DE +  LDV  R+
Sbjct: 149 WRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIARM 190

>Kwal_34.15770
          Length = 1436

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 70/164 (42%), Gaps = 43/164 (26%)

Query: 382  MMGENGTGKTTLIKLL-------AGAIPAD--DGTSVPKLNVSMKPQTIAPK----FPGT 428
            ++G  G GK+T+I  L       +G I  D  D TSV +L    +  TI P+    F GT
Sbjct: 1192 IVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSV-ELKRLRQSITIIPQDPTLFTGT 1250

Query: 429  VR------------QLFFKKIRAQFLNPQ---------------FQTDVVKPLKIDDIID 461
            V+            Q+F    R   L  +                  +V K L++D+ I 
Sbjct: 1251 VKSNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLRLDNEIT 1310

Query: 462  QEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLD--SEQRI 503
            +   +LS G+ Q V +  SL     + L+DE +A +D  S+ RI
Sbjct: 1311 EGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARI 1354

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 85/208 (40%), Gaps = 29/208 (13%)

Query: 360 RTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDG-TSVPKLNVSMKP 418
           R   DF L   S EF   ++ V++G  G+GKT+L+  L G +   +G    P L+     
Sbjct: 486 RKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLD---PR 542

Query: 419 QTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDVV-----KPLKIDDII-------DQEVKH 466
           + +  +  G    + +    A  LN   + +++        + D ++       D E+  
Sbjct: 543 EDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYDAVVEACGLKRDFEILS 602

Query: 467 -------------LSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRRFI 513
                        LSGG+ QRV++  +L   +   L+D+  + +DS   +   +      
Sbjct: 603 AGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGP 662

Query: 514 LHNKKTAFIVEHDFIMATYLADKVIVFD 541
           L   +T  +V H+  +    AD V+  +
Sbjct: 663 LMEGRTCILVSHNVALTLKNADWVVFME 690

>Sklu_2062.2 YGL091C, Contig c2062 3197-4183
          Length = 328

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQ 431
           ++LV+ G+ G GK+T   +L+ A+ AD+   V  +++ +   ++ P+  G V++
Sbjct: 74  KVLVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDICGPSL-PRMLGCVKE 126

>Kwal_27.11147
          Length = 323

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 25/41 (60%)

Query: 376 DSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSM 416
           D ++LV+ G+ G GK+T   LL  A+ +D+   V  +++ +
Sbjct: 67  DHKVLVLSGKGGVGKSTFTSLLCWALSSDEDLQVGAMDLDI 107

>YGL120C (PRP43) [1866] chr7 complement(281638..283941) Pre-mRNA
           splicing factor required for release of the
           lariat-intron from the spliceosome, member of the
           DEAH-box RNA helicase family [2304 bp, 767 aa]
          Length = 767

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 6/61 (9%)

Query: 355 YPDMKRTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLIK--LLAGAIPADDGTS 408
           Y D+ + + +  ++ Q  EF     +++I+V +GE G+GKTT I   +L   +P  + T 
Sbjct: 83  YVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQ 142

Query: 409 V 409
           V
Sbjct: 143 V 143

>CAGL0K06281g complement(608987..609544) highly similar to sp|P15454
           Saccharomyces cerevisiae YDR454c Guanylate kinase, start
           by similarity
          Length = 185

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQTIAPK 424
           +V+ G +GTGK+TL+K L    P   G SV     S +P  +  K
Sbjct: 5   IVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPGEVHGK 49

>CAGL0M02387g 280372..282942 similar to sp|P41909 Saccharomyces
           cerevisiae YPL147w PXA1 Peroxisomal long-chain fatty
           acid import protein 2, hypothetical start
          Length = 856

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 78/177 (44%), Gaps = 29/177 (16%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDG---TSVP-KLNVSMKPQTIAPKFP--GTVR-QL 432
           L+++G N  GKT++ +++A   P  +     S+P + N+   PQ   P F   GT+R QL
Sbjct: 627 LLILGPNSCGKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQ--KPYFTRGGTLRDQL 684

Query: 433 FFKKIRAQFLNPQFQ----TDVVKPLKID------------DIIDQEVKHLSGGELQRVA 476
            +     +F +  F+      ++  +K+D            D +      LSGGE QRV 
Sbjct: 685 IYPMSSDEFFDRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVN 744

Query: 477 IVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIM 529
               +       ++DE +  + ++       +++R    FI  +++   I  HD ++
Sbjct: 745 FARIMFHRPLFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLL 801

>Kwal_23.4045
          Length = 761

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 373 EFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVP-KLNVSMKPQTIAP 423
           E    + L+++G NG GK++L ++L G  P     + P KL+  + P  + P
Sbjct: 465 ELKHGDHLLIIGPNGCGKSSLFRVLGGLWPVMKSFTHPEKLSKLIMPPRVGP 516

>Kwal_26.9532
          Length = 1471

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVK 255
           LSGG+  R  +A S  +  D+Y+FD+  S +D +
Sbjct: 700 LSGGQKARINLARSVYKKKDIYLFDDVLSAVDAR 733

>CAGL0F07139g complement(698363..700669) highly similar to sp|P53131
           Saccharomyces cerevisiae YGL120c PRP43, start by
           similarity
          Length = 768

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query: 355 YPDMKRTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLI 394
           Y  + + + D  ++ Q  EF     +++I+V +GE G+GKTT I
Sbjct: 86  YFGILKVRKDLPVHAQRAEFLKIYQENQIMVFVGETGSGKTTQI 129

>Kwal_26.8730
          Length = 831

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 79/178 (44%), Gaps = 31/178 (17%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGT---SVPK----LNVSMKPQTIAPKFPGTVR-Q 431
           ++++G NG+GKT++ +++A   P  +     SVP     + +  KP  I     GT R Q
Sbjct: 604 MLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSVPAERELICIPQKPYFIQ---GGTFREQ 660

Query: 432 LFFKKIRAQFLNPQFQ----TDVVKPLKID------------DIIDQEVKHLSGGELQRV 475
           + +     Q+ +  ++      V+K +K++            D + +    LSGGE QR+
Sbjct: 661 IIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDVLSGGERQRM 720

Query: 476 AIVLSLGIPADIYLIDEPSAYLDSEQRIICSKVIRR----FILHNKKTAFIVEHDFIM 529
                +       ++DE +  + ++       +++R    FI  +++ + I  HD  +
Sbjct: 721 NFARIMFHKPKFVVLDEATNAISADMEDYLFNMLKRYRFNFITISQRPSLIKYHDLAL 778

>Kwal_56.23638
          Length = 4922

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 21/25 (84%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAI 401
           SE ++++GE GTGKTT+++ +A A+
Sbjct: 649 SEPVLLVGETGTGKTTVVQQVAKAV 673

>Kwal_14.1724
          Length = 770

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 4/44 (9%)

Query: 355 YPDMKRTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLI 394
           Y D+ + + +  ++ Q  EF     +++++V +GE G+GKTT I
Sbjct: 85  YFDILKIRRELPVHAQRNEFLKIYQENQVMVFVGETGSGKTTQI 128

>Scas_717.58
          Length = 186

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAIPADDGTSV 409
           S ++V+ G +GTGK+TL+K L    P   G SV
Sbjct: 2   SSVIVISGPSGTGKSTLLKKLFAEYPDTFGFSV 34

>Kwal_33.13308
          Length = 706

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 222 LSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL 281
           LSGG+ QR A+A + + D D+ + DE +S LD +     A  + S     K  I++ H +
Sbjct: 582 LSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYSRSTRGKTTISIAHRV 641

Query: 282 SVLDYLSDFVCI 293
           S + + S  + +
Sbjct: 642 STIQHSSRVIVL 653

>Scas_720.7
          Length = 332

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 378 EILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSM 416
           +ILV+ G+ G GK+T   +L+ A+ AD+   V  +++ +
Sbjct: 78  KILVLSGKGGVGKSTFTTMLSWALSADEDLQVGAMDLDI 116

>Sklu_1859.2 YDL148C, Contig c1859 1033-3507 reverse complement
          Length = 824

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 553 PESLLTGCNRFLKNLNVTFRR-DPNSFRPRINKLDSQMDKEQKLS 596
           P S+ T   +F +N N   +  DPN  R  INK+ +Q+ KE+K +
Sbjct: 721 PVSIPTYAPKFEENFNPDKKSYDPNRTRSEINKMKAQVKKERKFT 765

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 209  LQLDHLLNREIGLLSGGELQRFAIAMSCV------QDADVYMFDEPSSYLDVKQRLNAAL 262
            ++L +L    +  LSGG  QR  IA+S +      + A +Y+ DE  + LD+    N   
Sbjct: 1071 VKLGNLWKESLVELSGG--QRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 263  IIRSLLEPSKYVI 275
            +I++  + S++++
Sbjct: 1129 LIKTRFKGSQFIV 1141

>YPL147W (PXA1) [5300] chr16 (273254..275866) Protein required for
           long-chain fatty acid transport across the peroxisomal
           membrane, member of the ATP-binding cassette (ABC)
           superfamily, has similarity to a human gene associated
           with adrenoleukodystrophy [2613 bp, 870 aa]
          Length = 870

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 25/119 (21%)

Query: 380 LVMMGENGTGKTTLIKLLAGAIPADDGT---SVP-KLNVSMKPQTIAPKFP--GTVR-QL 432
           L+++G NG GK+++ +++A   P  +     S+P + N+   PQ   P F   GT+R Q+
Sbjct: 641 LLILGPNGCGKSSIQRIIAEIWPVYNKNGLLSIPSENNIFFIPQ--KPYFSRGGTLRDQI 698

Query: 433 FFKKIRAQFLNPQFQ----TDVVKPLKID------------DIIDQEVKHLSGGELQRV 475
            +     +F +  F+      ++  +K+D            D I      LSGGE QRV
Sbjct: 699 IYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKDLLSGGEKQRV 757

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 55/239 (23%), Positives = 95/239 (39%), Gaps = 40/239 (16%)

Query: 70  ITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKP 129
           + + NL      H +      SFK+      + G  +G+VG  G GKS+   I+A     
Sbjct: 33  VELKNLSLRYSPHSSKALDNVSFKV------KAGTKVGIVGRTGAGKSS---IIAA---- 79

Query: 130 NLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIK-PQYVDNLPRAIKGP----- 183
            + R  D   W+         ++++   + L + I  I + P   D   R+   P     
Sbjct: 80  -IYRLSD---WENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYS 135

Query: 184 -VQKVGELLKLRMEKPQDTV----KQYIKTLQLDHLLNREIGL----------LSGGELQ 228
            VQ  G L K+ + +  D +    +Q         L NR I L          LS G+ Q
Sbjct: 136 DVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQ 195

Query: 229 RFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDL-SVLDY 286
              +A S +   ++ + DE ++ +D          IR  ++ +  ++ + H L SV+DY
Sbjct: 196 LLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>AAR180C [368] [Homologous to ScYGL120C (PRP43) - SH]
           (665711..668011) [2301 bp, 766 aa]
          Length = 766

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 354 SYPDMKRTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLI 394
           +Y  + + + D  ++ Q  EF     +++++V +GE G+GKTT I
Sbjct: 82  NYVKILKVRRDLPVHAQRDEFLKMYQENQVMVFVGETGSGKTTQI 126

>CAGL0B00418g 26584..28815 similar to sp|P25375 Saccharomyces
           cerevisiae YCL057w PRD1 proteinase yscD, hypothetical
           start
          Length = 743

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 191 LKLRMEKPQDTVKQYIKTL--QLDHLLNREIGLLSGGELQRFAIAMSCVQDADVYMFD 246
           L ++M K  DTV  ++  L  +L     +E+ +L   + Q F    + V D D Y++D
Sbjct: 333 LDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWD 390

>Scas_713.33
          Length = 4934

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 75/174 (43%), Gaps = 19/174 (10%)

Query: 256 QRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREG-- 313
            RL+A     ++++P + + +  +D S+    SD  C    +  V  +  L   + E   
Sbjct: 527 HRLDALFANNNIIKPDQLIESSIYD-SIFAEASD--CFAGAISEVKALEPLIHCIGESLE 583

Query: 314 -----INIFLDGHIPS-ENMRFRTEALQFRXXXXXXXXXXXXTRAYSYPDMKRTQGDFTL 367
                I++FL  H+P  ENM    + ++               R+ +      T     L
Sbjct: 584 IASSRISLFLSKHVPKFENM---NDQIRIGRSLLPKAKLSIQKRSMNSTSFALTNHSLRL 640

Query: 368 NVQ-SGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420
             Q +     +E ++++GE GTGKTT+++ +A  +      ++  +NVS + +T
Sbjct: 641 MEQIAVSIQMTEPVLLVGETGTGKTTVVQQVAKMM----NKTLTVINVSQQTET 690

>KLLA0B00561g 42284..44587 highly similar to sp|P53131 Saccharomyces
           cerevisiae YGL120c PRP43 involved in spliceosome
           disassembly, start by similarity
          Length = 767

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%), Gaps = 4/39 (10%)

Query: 360 RTQGDFTLNVQSGEF----SDSEILVMMGENGTGKTTLI 394
           + + D  ++ Q  EF     +++I+V +GE G+GKTT I
Sbjct: 87  KVRRDLPVHAQRDEFLKIYQENQIMVFVGETGSGKTTQI 125

>Sklu_2035.3 YBR186W, Contig c2035 2344-3764 reverse complement
          Length = 474

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 352 AYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPK 411
           +Y+   +K +Q   T ++ S   +++++L++ G  GTGKTT+ K L   +      S+  
Sbjct: 226 SYATISLKMSQMS-TKSISSTLIANNKLLLVHGPPGTGKTTVCKALCQKLAIRQNESIDS 284

Query: 412 LNVSMKPQTI 421
           L  +  P  I
Sbjct: 285 LKTNCHPTII 294

>YLR106C (MDN1) [3521] chr12 complement(349007..363739) Nuclear
           protein that may act as a chaperone [14733 bp, 4910 aa]
          Length = 4910

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 377 SEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420
           +E ++++GE GTGKTT+++ LA  +       +  +NVS + +T
Sbjct: 646 TEPVLLVGETGTGKTTVVQQLAKML----AKKLTVINVSQQTET 685

>Scas_167.1*
          Length = 279

 Score = 29.3 bits (64), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 65/146 (44%), Gaps = 26/146 (17%)

Query: 379 ILVMMGENGTGKTTLIKLLA----GAIPADDGTSVPKLNVSMKPQT---------IAPKF 425
           +  +MGE+G GKTTL+  LA    G I  D   +   ++ S + +T         IA   
Sbjct: 128 LTALMGESGAGKTTLLNTLAQRNVGIITGDMLINGHPIDASFERRTGYVQQQDIHIAELT 187

Query: 426 PGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQE-VKHLSGGELQRVAIV-----L 479
                Q   +  RAQ +  + +   V+  KI  ++D E       GE+ R   V     L
Sbjct: 188 VRESLQFSARMRRAQAIPDEEKMAYVE--KIIQVLDMEYYAEALVGEIGRGLNVEQRKKL 245

Query: 480 SLGI-----PADIYLIDEPSAYLDSE 500
           S+G+     P  +  +DEP++ LDS+
Sbjct: 246 SIGVELVAKPDLLLFLDEPTSGLDSQ 271

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,574,969
Number of extensions: 875605
Number of successful extensions: 3600
Number of sequences better than 10.0: 194
Number of HSP's gapped: 3511
Number of HSP's successfully gapped: 439
Length of query: 598
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 491
Effective length of database: 12,891,983
Effective search space: 6329963653
Effective search space used: 6329963653
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)