Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G08019g31631114780.0
Scas_636.1332131210091e-138
YDR090C3103159181e-124
KLLA0D02178g2832798511e-114
Kwal_23.65652492568121e-109
Kwal_14.73991512176e-22
AFR605C31549974e-04
CAGL0L06710g32941910.002
Sklu_1971.229076890.004
Scas_518.331049890.004
YBR147W29641880.004
CAGL0I07689g30949860.008
Sklu_2437.130549850.009
KLLA0C03762g30649830.016
Scas_628.230549810.029
Kwal_56.2262330849810.031
Kwal_55.2153829447780.084
KLLA0F19294g570168740.30
YDR352W31768730.35
ACL106C27333710.53
CAGL0D01364g114850710.77
KLLA0E21736g31933681.2
CAGL0A02508g31647681.4
Scas_658.1531173681.5
YDR284C (DPP1)28974653.2
YOL092W30896635.0
Scas_720.9727032626.7
CAGL0M06985g24931627.4
Scas_495.261653629.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G08019g
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G08019g complement(756917..757867) similar to tr|Q03193 Sac...   573   0.0  
Scas_636.13                                                           393   e-138
YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein ...   358   e-124
KLLA0D02178g 186452..187303 some similarities with sgd|S0002497 ...   332   e-114
Kwal_23.6565                                                          317   e-109
Kwal_14.739                                                            88   6e-22
AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH] (1...    42   4e-04
CAGL0L06710g complement(756297..757286) similar to tr|Q12010 Sac...    40   0.002
Sklu_1971.2 YDR352W, Contig c1971 2812-3684                            39   0.004
Scas_518.3                                                             39   0.004
YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing...    39   0.004
CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces c...    38   0.008
Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement         37   0.009
KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyce...    37   0.016
Scas_628.2                                                             36   0.029
Kwal_56.22623                                                          36   0.031
Kwal_55.21538                                                          35   0.084
KLLA0F19294g complement(1784664..1786376) similar to sgd|S000252...    33   0.30 
YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein contain...    33   0.35 
ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [8...    32   0.53 
CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces c...    32   0.77 
KLLA0E21736g complement(1931058..1932017) similar to sgd|S000276...    31   1.2  
CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces c...    31   1.4  
Scas_658.15                                                            31   1.5  
YDR284C (DPP1) [1113] chr4 complement(1030542..1031411) Diacylgl...    30   3.2  
YOL092W (YOL092W) [4728] chr15 (144203..145129) Protein containi...    29   5.0  
Scas_720.97                                                            28   6.7  
CAGL0M06985g complement(710622..711371) similar to sp|P17261 Sac...    28   7.4  
Scas_495.2                                                             28   9.0  

>CAGL0G08019g complement(756917..757867) similar to tr|Q03193
           Saccharomyces cerevisiae YDR090c, start by similarity
          Length = 316

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/311 (93%), Positives = 290/311 (93%)

Query: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60
           MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS
Sbjct: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAXXXXXXXXXXXXXXXXXXXXXFILWLR 120
           KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLA                     FILWLR
Sbjct: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAVRKIVAIVVGIIVVDIGMEVGFILWLR 120

Query: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180
           PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII
Sbjct: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180

Query: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVKDTQ 240
           SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVKDTQ
Sbjct: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVKDTQ 240

Query: 241 YDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPSHMERFSQKVHAVH 300
           YDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPSHMERFSQKVHAVH
Sbjct: 241 YDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPSHMERFSQKVHAVH 300

Query: 301 GVVMQRPEQVY 311
           GVVMQRPEQVY
Sbjct: 301 GVVMQRPEQVY 311

>Scas_636.13
          Length = 321

 Score =  393 bits (1009), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 231/312 (74%), Gaps = 7/312 (2%)

Query: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60
           MISE AAT LAT++T+CWCVQLIPQI  NW+RKDCTGLPP+MMFLWV+SGIPFAIYFCVS
Sbjct: 1   MISERAATALATVSTICWCVQLIPQIYSNWKRKDCTGLPPVMMFLWVISGIPFAIYFCVS 60

Query: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAXXXXXXXXXXXXXXXXXXXXXFILWLR 120
           KGNV LQ+QPHLFMFFCGISFVQ+CYYPP  L                      FILWLR
Sbjct: 61  KGNVTLQVQPHLFMFFCGISFVQTCYYPPTKLPVWKIIVIVSLIIATDIGMEVGFILWLR 120

Query: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180
           PLYSRGI WPDLIFGIIAT+LLA+GLLPPYFELAKR GRVVGINF+FLFIDSLGAWL+I 
Sbjct: 121 PLYSRGIHWPDLIFGIIATILLAVGLLPPYFELAKRKGRVVGINFLFLFIDSLGAWLAIA 180

Query: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNH----DPEETDAVSEEKSV 236
           SV+VGNMDTMGIILY+ IAG+ELGIF SHFIWCCRFKWF  +    D E+ +  S ++  
Sbjct: 181 SVIVGNMDTMGIILYAFIAGMELGIFASHFIWCCRFKWFSKNKFVDDEEQKEGNSTQEKE 240

Query: 237 KDTQYDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPSHMERFS--Q 294
           + ++ ++ +    K  +G +   +  +E++E D   D  SSF  D+   P   ER +   
Sbjct: 241 ELSEKNQHEIENLKGTVGMERGGTTIQELSEEDLADDVNSSFSDDI-GVPDISERATVLG 299

Query: 295 KVHAVHGVVMQR 306
            VHAVHGV+++R
Sbjct: 300 SVHAVHGVILKR 311

>YDR090C (YDR090C) [942] chr4 complement(625060..625992) Protein
           containing two PQ loop repeat domains, has high
           similarity to uncharacterized C. albicans Orf6.6869p
           [933 bp, 310 aa]
          Length = 310

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 224/315 (71%), Gaps = 14/315 (4%)

Query: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60
           MISE AAT LATIATVCWCVQLIPQIIYNW++KDCTGLPPLMMFLWVVSGIPFAIYFCVS
Sbjct: 1   MISEKAATALATIATVCWCVQLIPQIIYNWKKKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60

Query: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAXXXXXXXXXXXXXXXXXXXXXFILWLR 120
           KGNV+LQ+QPHLFMFFC ISFVQSCYYPP S+A                     FILWLR
Sbjct: 61  KGNVILQVQPHLFMFFCSISFVQSCYYPPISMARSKIVMIVAAIIAADVGMEVGFILWLR 120

Query: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180
           PLY +G+ WPDLIFGI A+VLLA+GLLPPYFELAKR GRV+GINF FLFIDSLGAWLSII
Sbjct: 121 PLYEKGVKWPDLIFGISASVLLAVGLLPPYFELAKRKGRVIGINFAFLFIDSLGAWLSII 180

Query: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVKDTQ 240
           SV++GNMD MGIILYS++AG+ELGIF SHFIW CRF++    +  + ++   +K   D +
Sbjct: 181 SVILGNMDIMGIILYSIVAGMELGIFASHFIWWCRFRFLAKGNTFDEESGQAQKEEPDEK 240

Query: 241 YDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSSFDYDLERRPS----HMERFSQKV 296
            ++      +N   ++        ++    P DD SSF  D     S     + R +Q +
Sbjct: 241 IEQDISKSDRNVTNYN--------LDNCSIP-DDASSFADDFNIYDSTDGGTLSR-AQTL 290

Query: 297 HAVHGVVMQRPEQVY 311
           HAVHGVV++     Y
Sbjct: 291 HAVHGVVVRTDPDRY 305

>KLLA0D02178g 186452..187303 some similarities with sgd|S0002497
           Saccharomyces cerevisiae YDR090c, hypothetical start
          Length = 283

 Score =  332 bits (851), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 168/279 (60%), Positives = 197/279 (70%), Gaps = 9/279 (3%)

Query: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60
           MISE AA  LAT+ TVCWCVQLIPQIIYN+ RKDCTG PP MMFLWVVSG+PF IYF ++
Sbjct: 1   MISEKAAYALATLGTVCWCVQLIPQIIYNYIRKDCTGFPPSMMFLWVVSGVPFGIYFLIT 60

Query: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAXXXXXXXXXX-XXXXXXXXXXXFILWL 119
           +GN++LQIQPHLFMFFC +S+VQS YYPP SL+                      F LWL
Sbjct: 61  RGNIILQIQPHLFMFFCSLSWVQSLYYPPYSLSVKKILLRCILPMILFIVSFEIGFTLWL 120

Query: 120 RPLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSI 179
           RP+Y  G  WP L+ GIIAT+LLA GL+PPYFELAKR GRVVGINFIFLF+DSLGAW SI
Sbjct: 121 RPVYDHGTHWPALVIGIIATILLAAGLIPPYFELAKRQGRVVGINFIFLFVDSLGAWCSI 180

Query: 180 ISVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPE-ETDAVSEEKSVKD 238
            SV+VGNMD MGI+LY+V+A LELGIF SHFIWCCRFKWFGN   E + D V    S   
Sbjct: 181 ASVIVGNMDIMGIVLYAVVAALELGIFASHFIWCCRFKWFGNGTGEFDDDDVGSTSSSVG 240

Query: 239 TQYDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVSS 277
            + +  DG  ++     D +F+     NE D  +DD+ S
Sbjct: 241 IEINGIDGDSAE-----DGIFAGPYINNEQD--KDDIGS 272

>Kwal_23.6565
          Length = 249

 Score =  317 bits (812), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/256 (59%), Positives = 183/256 (71%), Gaps = 8/256 (3%)

Query: 1   MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVS 60
           MISE  AT LA + TVCWCVQLIPQII+N+RRK+C G PP+MMFLW +SGIPFAIYF V+
Sbjct: 1   MISEKGATALAIMGTVCWCVQLIPQIIFNYRRKNCEGFPPIMMFLWTISGIPFAIYFMVT 60

Query: 61  KGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAXXXXXXXXXXXXXXXXXXXXXFILWLR 120
             N++LQIQPHLFM F GIS+ Q  +YPP                         F LWL+
Sbjct: 61  NANLILQIQPHLFMVFSGISYAQCLHYPPVKWNKWRIIQVLVALVAIDVGLETGFTLWLK 120

Query: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180
           PLY RG+ WP LIFGIIA+VLL IGLLPPYFEL KR GRV+GI+F+FLFIDS+GAWLSII
Sbjct: 121 PLYLRGVHWPSLIFGIIASVLLGIGLLPPYFELMKRQGRVIGIDFLFLFIDSMGAWLSII 180

Query: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVKDTQ 240
           S+++GNMD MGI LY VIAGLE+GIFLSHFIWCCRFKWF + D    D   +++ V D+ 
Sbjct: 181 SIILGNMDVMGIALYCVIAGLEIGIFLSHFIWCCRFKWFNDQDTSVED---DQQEVADS- 236

Query: 241 YDEKDGSLSKNKMGHD 256
               D  LS  ++ + 
Sbjct: 237 ----DKELSVQELNNQ 248

>Kwal_14.739
          Length = 91

 Score = 88.2 bits (217), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/51 (74%), Positives = 46/51 (90%)

Query: 155 KRNGRVVGINFIFLFIDSLGAWLSIISVVVGNMDTMGIILYSVIAGLELGI 205
           KR GRV+GINF+FLFIDS+GAWLS IS+++GN+D MGI LY VIAGLE+GI
Sbjct: 2   KRQGRVIGINFLFLFIDSMGAWLSFISIILGNLDVMGIALYCVIAGLEVGI 52

>AFR605C [3797] [Homologous to ScYOL092W - SH; ScYBR147W - SH]
          (1530918..1531865) [948 bp, 315 aa]
          Length = 315

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          SE  +    +I+  CW +  +PQI  N+RRK   GL  L + LW+   I
Sbjct: 8  SETISGITGSISIACWVIVFVPQIYENFRRKSAEGLSLLFVVLWLAGDI 56

>CAGL0L06710g complement(756297..757286) similar to tr|Q12010
          Saccharomyces cerevisiae YOL092w or sp|P38279
          Saccharomyces cerevisiae YBR147w, start by similarity
          Length = 329

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 11 ATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
           +I+  CW V   PQI  N+RRK   GL  + + LW++  I
Sbjct: 18 GSISIACWVVVFAPQIYENFRRKSSDGLSLMFIILWLIGDI 58

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 13  IATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPF 53
           ++ V +    IPQI+ N++RK C G+  L      +  I F
Sbjct: 242 LSAVLYLGSRIPQILLNFKRKSCEGVSLLFFLFACLGNINF 282

>Sklu_1971.2 YDR352W, Contig c1971 2812-3684
          Length = 290

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 5   GAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYF------- 57
           G    L+ +  +C+    IPQ+I N++RK   GL P +    +++ I +A+         
Sbjct: 173 GVGIALSWVGAMCYVCARIPQLIKNYKRKSTDGLSPFLFINTLLTNITYALSIFTSCDYL 232

Query: 58  -CVSKGNVVLQIQPHL 72
            C  K + VL   P L
Sbjct: 233 DCEDKKSFVLNELPFL 248

>Scas_518.3
          Length = 310

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          SE  +     I+  CW V  +PQI  N+ RK   GL  L + LW++  I
Sbjct: 10 SENVSGITGCISISCWIVVFVPQIYENFTRKSSDGLSLLFIILWLLGDI 58

>YBR147W (YBR147W) [332] chr2 (536531..537421) Protein containing
          two PQ loop repeat domains, has low similarity to S.
          pombe Stm1p, which is a G protein-coupled receptor that
          acts as a nutrient sensor for sexual diffentiation and
          stress response pathways [891 bp, 296 aa]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 11 ATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
           +I+  CW V  +PQI  N+RR+   GL  L + LW++  I
Sbjct: 18 GSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDI 58

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 7   ATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           A  L  ++ + +    IPQI+ N++RK C G+  L      +    F I
Sbjct: 208 AQILGYLSAILYLGSRIPQIVLNFKRKSCEGVSFLFFLFACLGNTSFII 256

>CAGL0I07689g 738658..739587 similar to tr|Q12010 Saccharomyces
          cerevisiae YOL092w, hypothetical start
          Length = 309

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          S+  +    +++  CW V  +PQI  N+ RK   GL  L + LW+   +
Sbjct: 11 SQAVSGIAGSVSIACWVVVFVPQIYENFYRKSADGLSLLFVVLWLAGDV 59

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 23/49 (46%)

Query: 7   ATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           A +   ++ V +    +PQI+ N++RK C G+  L      +    F I
Sbjct: 206 AQSFGYLSAVLYLGSRVPQILLNFKRKSCEGISFLFFLFACLGNTTFII 254

>Sklu_2437.1 YOL092W, Contig c2437 3219-4136 reverse complement
          Length = 305

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          S+  +    +I+  CW +  +PQI  N+ RK   GL  L + LW+   I
Sbjct: 8  SQTVSGITGSISIACWVIVFVPQIYENFYRKSAEGLSLLFVVLWLAGDI 56

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%)

Query: 7   ATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           A     ++ V +    +PQI+ N++RK C G+  L      +    F I
Sbjct: 201 AQAFGYLSAVLYLGSRVPQILLNFKRKSCEGISFLFFLFACLGNTTFII 249

>KLLA0C03762g 342637..343557 similar to sgd|S0005452 Saccharomyces
          cerevisiae YOL092w, start by similarity
          Length = 306

 Score = 36.6 bits (83), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          S+  +    +I+  CW +  +PQI  N+ RK   GL  + + LW+   I
Sbjct: 10 SQTVSGITGSISIACWIIVFVPQIYENFYRKSAEGLSLMFVVLWLAGDI 58

 Score = 29.6 bits (65), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 7   ATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           A +   ++ V +    IPQI+ N++RK C G+  L      +    F I
Sbjct: 205 AQSFGYLSAVLYLGSRIPQILLNYQRKSCEGVSFLFFLFACLGNTTFII 253

>Scas_628.2
          Length = 305

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          ++  +    +I+  CW +  +PQI  N+ RK   GL  L + LW+   +
Sbjct: 10 AQNVSGMAGSISIACWVIVFMPQIYENFYRKSADGLSLLFVVLWLAGDV 58

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 23  IPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           IPQI+ N++R+ C G+  L      +  I F +
Sbjct: 222 IPQILLNFQRRSCEGISFLFFLFACIGNITFIV 254

>Kwal_56.22623
          Length = 308

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 3  SEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          S+  +    +I+  CW +  +PQI  N+ R    GL  L + LW++  I
Sbjct: 8  SQTVSGITGSISIACWIIVFVPQIYENFYRHSADGLSLLFVVLWLLGDI 56

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 13  IATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           ++ V +    +PQI+ N++RK C G+  L      +    F I
Sbjct: 214 LSAVLYLGSRVPQILLNFQRKSCEGISFLFFLFACIGNTTFII 256

>Kwal_55.21538
          Length = 294

 Score = 34.7 bits (78), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 9   TLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           TL+ I  +C+    IPQ+  N+ RK   GL P +    +++ I + +
Sbjct: 170 TLSWIGALCYVGARIPQLFKNYNRKSTDGLSPFLFINTLIANITYTV 216

>KLLA0F19294g complement(1784664..1786376) similar to sgd|S0002524
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 570

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 69/168 (41%), Gaps = 30/168 (17%)

Query: 141 LLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSIISVVVGNMDTMGIILYSVIAG 200
           L+  G +PP+    KR G +VGI        S    L + ++ +  MD  GI    VI  
Sbjct: 109 LMLPGTVPPFPSNVKR-GSIVGI-------ASTKDPLLVKAIGIAEMDLCGI--SHVIGT 158

Query: 201 LELGIFLSHFIWCCRFKWFG----------NHDPEETDAVSEEKSVKDTQYDEKDGSLSK 250
             + + + H++    FK F           N +P ET A+  + S    Q DE+   L +
Sbjct: 159 KGIAVRVVHYLDDGLFKAFKLELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLER 218

Query: 251 NKMGHDAMFSKTEEVNETDEPRDDVSSFDYD--LERRPSHMERFSQKV 296
           +        S    VNE  +  +++S  D D  L R   +  +F  K+
Sbjct: 219 S--------SSQSPVNEIADELEEMSIEDVDHMLMRAVKYSIKFDDKI 258

>YDR352W (YDR352W) [1179] chr4 (1181790..1182743) Protein
          containing two PQ loop repeat domains, has low
          similarity to S. pombe Stm1p, which is a G
          protein-coupled receptor that acts as a nutrient sensor
          for sexual diffentiation and stress response pathways
          [954 bp, 317 aa]
          Length = 317

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 20 VQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVVLQIQPHLFMFFCGI 79
          + L PQII  +R K   GL P  +  W+   I   I   ++ G ++ QI   ++ F    
Sbjct: 25 ISLFPQIIETYRDKSVDGLSPYFLLAWLCGDITSLIGAKLT-GQLLFQILLAIY-FLLND 82

Query: 80 SFVQSCYY 87
          SFV   YY
Sbjct: 83 SFVCGQYY 90

>ACL106C [943] [Homologous to ScYDR352W - SH] (153775..154596) [822
           bp, 273 aa]
          Length = 273

 Score = 32.0 bits (71), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 23  IPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           IPQ+I N+RRK   GL PL+    + + + + +
Sbjct: 172 IPQLIKNYRRKSTDGLSPLLFLAALTANLTYCV 204

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 17/32 (53%)

Query: 20 VQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
          V  IPQ++  ++ K   GL PL +  W+   I
Sbjct: 29 VASIPQVVETYKEKSVDGLSPLCLLCWISGDI 60

>CAGL0D01364g 152033..155479 similar to sp|P14922 Saccharomyces
            cerevisiae YBR112c CYC8 general repressor of
            transcription, hypothetical start
          Length = 1148

 Score = 32.0 bits (71), Expect = 0.77,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 222  HDPEETDAVSEEKSVKDTQYDEKD-GSLSKNKMGHDAMFSKTEEVNETDE 270
            +DP   D ++EE   +D+  DE D GS+ +NK   +  F K +E   TDE
Sbjct: 996  NDP--ADNMTEESHGQDSTIDEADKGSIEENKDTPNEDFQKLQEGTSTDE 1043

>KLLA0E21736g complement(1931058..1932017) similar to sgd|S0002760
           Saccharomyces cerevisiae YDR352w, start by similarity
          Length = 319

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%)

Query: 23  IPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           IPQ+I N++RK   GL PL+    +++ + + +
Sbjct: 210 IPQLIKNYKRKSTDGLSPLLFISTLIANVTYTL 242

>CAGL0A02508g 264398..265348 similar to tr|Q06328 Saccharomyces
           cerevisiae YDR352w, start by similarity
          Length = 316

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 9   TLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAI 55
           TL+ +    +    IPQ+I N++RK   GL P +    ++  I + I
Sbjct: 198 TLSWLGASFYVGARIPQLIKNYQRKSTDGLSPFLFATTLLGNITYNI 244

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 24 PQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVVLQIQPHLFMFFCGISFVQ 83
          PQII  ++ K   GL PL +  W +SG   ++   +  G +  QI   ++  F  + FV 
Sbjct: 29 PQIIETYKDKTVEGLSPLFLMCW-LSGDITSLIGALMTGQLKFQIALAIYFLFNDL-FVC 86

Query: 84 SCYY 87
            YY
Sbjct: 87 CQYY 90

>Scas_658.15
          Length = 311

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 6/73 (8%)

Query: 11 ATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNVVLQIQP 70
           +IA V   + L+PQI+  +  K   GL P  +  W+   I  ++   +    ++ QI  
Sbjct: 16 GSIAFVSSFISLLPQILETYHDKTVVGLSPWFLLAWLCGDIT-SLTGAILTNQLMFQIVL 74

Query: 71 HLF-----MFFCG 78
           ++     MF CG
Sbjct: 75 AIYFLLNDMFVCG 87

>YDR284C (DPP1) [1113] chr4 complement(1030542..1031411)
           Diacylglycerol pyrophosphate phosphatase [870 bp, 289
           aa]
          Length = 289

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 1/74 (1%)

Query: 179 IISVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKWFGNHDPEETDAVSEEKSVK- 237
           II  ++ +   +  ILY+ + GL L  F + F       W G   P+  D     + +  
Sbjct: 81  IIGSILADRRHLIFILYTSLLGLSLAWFSTSFFTNFIKNWIGRLRPDFLDRCQPVEGLPL 140

Query: 238 DTQYDEKDGSLSKN 251
           DT +  KD   +KN
Sbjct: 141 DTLFTAKDVCTTKN 154

>YOL092W (YOL092W) [4728] chr15 (144203..145129) Protein containing
           two PQ loop repeat domains, has low similarity to S.
           pombe Stm1p, which is a G protein-coupled receptor that
           acts as a nutrient sensor for sexual diffentiation and
           stress response pathways [927 bp, 308 aa]
          Length = 308

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 121 PLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRVVGINFIFLFIDSLGAWLSII 180
           P+    I W   IFG ++  LL +G   P   L  +     GI+F+F     LG    I 
Sbjct: 202 PVPELQINWMAQIFGYLSA-LLYLGSRIPQILLNFKRKSCEGISFLFFLFACLGNTTFIF 260

Query: 181 SVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRF 216
           SV+V ++D   +I+ +      +G     F+   +F
Sbjct: 261 SVIVISLDWKYLIMNASWLVGSIGTLFMDFVIFSQF 296

>Scas_720.97
          Length = 270

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 20  VQLIPQIIYNWRRKDCTGLPPLMMFLWVVSGI 51
           V+ IPQ++YN+ RK   G     +FL V  G+
Sbjct: 169 VKYIPQVVYNFDRKTMVGFAIQGVFLDVTGGV 200

>CAGL0M06985g complement(710622..711371) similar to sp|P17261
          Saccharomyces cerevisiae YCR075c ERS1, hypothetical
          start
          Length = 249

 Score = 28.5 bits (62), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 14/31 (45%)

Query: 10 LATIATVCWCVQLIPQIIYNWRRKDCTGLPP 40
          L  I    W + + P +  NW+RK    + P
Sbjct: 7  LGVIYVTAWSISMYPPLYINWKRKSARAISP 37

>Scas_495.2
          Length = 616

 Score = 28.5 bits (62), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 14  ATVCWCVQLI--PQIIYNWRRKDCTGLPPLMMFLWVVSGIPFAIYFCVSKGNV 64
           A +C C+ L   P  + +      T L    +FL  ++G+ FA YF V KG +
Sbjct: 429 AYICTCISLAICPWDLMSSSSTFTTALSAYAVFLSAIAGVIFADYFIVRKGYI 481

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.142    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,271,165
Number of extensions: 371762
Number of successful extensions: 1930
Number of sequences better than 10.0: 52
Number of HSP's gapped: 1955
Number of HSP's successfully gapped: 63
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)