Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G07755g68567431650.0
Scas_716.266866838901e-110
YGR099W (TEL2)6886808511e-104
Kwal_55.205296916657275e-86
AAR090W6596706757e-79
KLLA0D15158g6662495373e-59
CAGL0C00627g36449800.13
KLLA0A09185g43770702.5
CAGL0B05049g147081676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G07755g
         (674 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces c...  1223   0.0  
Scas_716.26                                                           347   e-110
YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in ...   332   e-104
Kwal_55.20529                                                         284   5e-86
AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH] complement(5...   264   7e-79
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...   211   3e-59
CAGL0C00627g 65389..66483 similar to sp|P38270 Saccharomyces cer...    35   0.13 
KLLA0A09185g 804448..805761 highly similar to sp|P00924 Saccharo...    32   2.5  
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    30   6.5  

>CAGL0G07755g 736112..738169 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect, hypothetical start
          Length = 685

 Score = 1223 bits (3165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/674 (90%), Positives = 610/674 (90%)

Query: 1   MGNGLEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVIL 60
           MGNGLEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVIL
Sbjct: 1   MGNGLEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVIL 60

Query: 61  KLNWFFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRT 120
           KLNWFFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRT
Sbjct: 61  KLNWFFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRT 120

Query: 121 KELILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASL 180
           KELILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASL
Sbjct: 121 KELILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASL 180

Query: 181 CDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNA 240
           CDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNA
Sbjct: 181 CDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNA 240

Query: 241 QLVHHXXXXXXXXXXXXVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYES 300
           QLVHH            VQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYES
Sbjct: 241 QLVHHILGTLGIGKLILVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYES 300

Query: 301 DNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHK 360
           DNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHK
Sbjct: 301 DNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHK 360

Query: 361 IDYESDFTIDIGKSIAHENYEVPESDWXXXXXXXXXXXXXXXXXXXXXXXXHALEALNLX 420
           IDYESDFTIDIGKSIAHENYEVPESDW                        HALEALNL 
Sbjct: 361 IDYESDFTIDIGKSIAHENYEVPESDWSLILNSVNSNVNTNSSDTNISTSTHALEALNLD 420

Query: 421 XXXXXXXXXXXQLKYVFLKDLTAALENKSQRGLTNILKNTVKLVRQKKLFRSEVAYYAGA 480
                      QLKYVFLKDLTAALENKSQRGLTNILKNTVKLVRQKKLFRSEVAYYAGA
Sbjct: 421 DSDDEEDEEGDQLKYVFLKDLTAALENKSQRGLTNILKNTVKLVRQKKLFRSEVAYYAGA 480

Query: 481 MIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXXXXXXXXX 540
           MIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAE             
Sbjct: 481 MIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAELSLQQRLSLLLSV 540

Query: 541 XXXARELRGYDDKQILKPQFDFPTSMLPWDRRQENNRIEEIDDNGSDNTSGGKVLWKSSK 600
              ARELRGYDDKQILKPQFDFPTSMLPWDRRQENNRIEEIDDNGSDNTSGGKVLWKSSK
Sbjct: 541 SMSARELRGYDDKQILKPQFDFPTSMLPWDRRQENNRIEEIDDNGSDNTSGGKVLWKSSK 600

Query: 601 LTKNTEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHD 660
           LTKNTEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHD
Sbjct: 601 LTKNTEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHD 660

Query: 661 FEDMTTTMDTILQD 674
           FEDMTTTMDTILQD
Sbjct: 661 FEDMTTTMDTILQD 674

>Scas_716.26
          Length = 686

 Score =  347 bits (890), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 230/683 (33%), Positives = 358/683 (52%), Gaps = 27/683 (3%)

Query: 5   LEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNW 64
           + ++K L    +   +   L  +  E D+ T ++V L +I++V+  +  + K        
Sbjct: 1   MSDFKVLKDHPDAQVIEDVLQQLSNETDAPT-LEVCLLIIQHVIPIYPSLSKHTRDLTQS 59

Query: 65  FFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELI 124
             + S    SQL+ + S +   + E  +Y  ++ + L +    L NYLI  + +R ++  
Sbjct: 60  LVSRSFTFMSQLVNYASTVMKDKPEGKLYRNFIKEVLATQPECLHNYLIHMSSSRMEKNY 119

Query: 125 LKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDK--------LDSRSGDFHKYLGNH 176
           LK  F GS VFN +   ++ +EY+ELL +Q    LD         LDS       +LG  
Sbjct: 120 LKTLFFGSRVFNSLGNDIDIIEYLELLRSQWKSVLDDDILIETLVLDS-------FLGEL 172

Query: 177 IASLCDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCS 236
           + S    +  +A D++    FL  +     L+  +   S   + ++  K+LLPYL+ + +
Sbjct: 173 LVSSLILNPTYAMDLLFGDLFLSTETYATILNKIILNASNLDQQRLVNKFLLPYLEPLTN 232

Query: 237 DTNAQLVHHXXXXXXXXXXXXVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSI 296
            +N +  +H            +  I R+ S  LQ+ I+  + S+   S++  L+ KF ++
Sbjct: 233 TSNFKSTNHILRELPLHKCITLDVILRMKSHILQEIIIRQM-SEFASSIIPSLISKFGTL 291

Query: 297 EYESDNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIA 356
           +   D + C + V +LK +LN+  + ++ H   FL+AITKRLS ++   RER+M+IAK+A
Sbjct: 292 DESQDEDICIIFVMVLKFNLNEEQREQLAHDGNFLDAITKRLSHKNSEFRERTMFIAKLA 351

Query: 357 SNHKIDYESDFTIDIGKSIAHENYEVPESDWXXXXXXXXXXXXXXXXXXXXXXXXHALEA 416
           SN++++Y+SDF I +   +   N E  E D                           L+ 
Sbjct: 352 SNNELEYDSDFVIKL-PDLDITNNEKIEIDPALFKRSSSGVSASKVSRISSGFHEMVLQE 410

Query: 417 LNLXXXXXXXXXXXXQLKYVFLKDLTAALENKSQRGLTN---ILKNTVKLVRQKKLFRSE 473
            +             ++  VFLKDL    E     G      +LK T+ LVRQK+ F  E
Sbjct: 411 DSDDEVQDDEQEIINRI--VFLKDLVKEFEKNGNDGPAESIPLLKKTITLVRQKEHFPLE 468

Query: 474 VAYYAGAMIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXX 533
           V YY   ++ NI  LNN+L+E  FEE R+NALVS+LVVVPEK+ EL+K+  ++E      
Sbjct: 469 VDYYFSGLLTNIAYLNNNLEESNFEEWRINALVSLLVVVPEKVQELIKIFLSSELSLQQR 528

Query: 534 XXXXXXXXXXARELRGYDDKQILKPQFDFPTSMLPWDRR-QENNRIEEIDDNGSDNTS-- 590
                     ARELRG DDK I KP+ DFPTS LPWD++ +E +  + I + G+ N++  
Sbjct: 529 MSILSSLGLSARELRGMDDKVITKPKLDFPTSRLPWDKKTKEQHDKKRITELGNSNSTLI 588

Query: 591 GGKVLWKSSKLT-KNTEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLK 649
             K  WKS KLT    E+  NRFREYA+ FFYPLA+ WLNGID+GTFD LFK ++L+TL+
Sbjct: 589 ETKTTWKSKKLTLAAKEDKPNRFREYATLFFYPLAHIWLNGIDVGTFDDLFKNHFLTTLR 648

Query: 650 TVYNCAYLVHDFEDMTTTMDTIL 672
            +Y CA+ VHD+E MT  M+ I+
Sbjct: 649 IIYMCAHPVHDYESMTQLMEQII 671

>YGR099W (TEL2) [2059] chr7 (687901..689967) Protein involved in
           controlling telomere length and telomere position effect
           [2067 bp, 688 aa]
          Length = 688

 Score =  332 bits (851), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 216/680 (31%), Positives = 346/680 (50%), Gaps = 19/680 (2%)

Query: 5   LEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNW 64
           LE  K+     ++ E +  LD+  +E     ++D  + +IK+V+  +  +P+   + L  
Sbjct: 3   LETLKQGLDSSQIHEALIQLDSYPREP---VDLDASMVLIKFVIPVYPSLPERSKVILRR 59

Query: 65  FFAHSLIGFSQLIKFGSDIDAKQSEQ--LIYIEYVTQFLKSSTTYLQNYLIECTENRTKE 122
             + S     Q++ F   I  +   Q   IY E +   +      L  YL   T ++   
Sbjct: 60  LASKSFTFLCQIVTFSRTISGRDGLQEIRIYQEILEDIISFEPGCLTFYLKASTTSKADR 119

Query: 123 LILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCD 182
             +K  F GS +FN +  +++  +Y+  L  Q  F L+   S   D   +LG  + S   
Sbjct: 120 DSIKALFFGSKLFNVLANRIDMAKYLGYLRLQWKFLLE---SNETDPPGFLGEWLVSSFL 176

Query: 183 FHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQL 242
            + + A D++L + FL+K+    +    +  +S   + ++  K+LLPY+  + +  N   
Sbjct: 177 LNPVLAADMLLGELFLLKESYFFSFQKIISASSLIDQKRLIAKFLLPYIQVIVTLENLND 236

Query: 243 VHHXXXXXXXXXXXXVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSI-EYESD 301
           V              +  +F + S  L++ I+ ++ +      +  L+ KF    + E D
Sbjct: 237 VRKILRRFDLDKIISLSVLFEIQSLPLKEVIVRLMSNHSSTKFVSALVSKFADFTDEEVD 296

Query: 302 NNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKI 361
             TC+L+V    ++LN S + ++ H ++FLN +TK L   ++  RER+M+IAK+ S   +
Sbjct: 297 TKTCELLVLFAVHNLNHSQREEIAHDERFLNGVTKHLGSNEREARERAMFIAKLLSGGHL 356

Query: 362 DYESDFTIDIGKSIAHENYEVPESDWXXXXXXXXXXXXXXXXXXXXXXXXHALEALNLXX 421
            YESDF I+I       N +    D+                          +++L L  
Sbjct: 357 KYESDFKINIPNVKFESNSDDKIIDFQSLKNPSICNTQTDVGKDKITEVSGHVQSLTLDC 416

Query: 422 XXXXXXXXXXQL----KYVFLKDLTAALENKSQR---GLTNILKNTVKLVRQKKLFRSEV 474
                     +     + VFLKDL    E   +     L  +LK TVKL+RQK  F+ EV
Sbjct: 417 SDSDDEDENDEREIVKRIVFLKDLMKEYEKTGESRKAPLIPLLKQTVKLIRQKADFQLEV 476

Query: 475 AYYAGAMIRNIVILNNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXXX 534
            YYA  ++ +IV LNN+ DE  FE+ R+NAL SILVV+PEK++  + +LF +E       
Sbjct: 477 GYYAQGILSSIVCLNNEFDEPLFEQWRINALTSILVVLPEKVNGAINILFNSELSLQQRM 536

Query: 535 XXXXXXXXXARELRGYDDKQILKPQFDFPTSMLPWD-RRQENNRIEEIDDNGSDNTSGGK 593
                    ARELRG DD  I+KP+FDFPT+ LPWD +   N+R+ E+ ++ S      K
Sbjct: 537 SLLSALGLSARELRGLDDPTIVKPKFDFPTNRLPWDDQSHHNSRLVEVQESTS-MIKKTK 595

Query: 594 VLWKSSKLTKNTEE-INNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVY 652
            +WKS KL K+ E+   NRFR+YA  FFYPLA+GWLNGID+GT+++LFK++YL+TL+ +Y
Sbjct: 596 TVWKSRKLGKDREKGTQNRFRKYAGLFFYPLAHGWLNGIDVGTYNQLFKSHYLTTLRIIY 655

Query: 653 NCAYLVHDFEDMTTTMDTIL 672
           +CA  VHDFE MT  M+ I+
Sbjct: 656 SCANPVHDFESMTELMNHII 675

>Kwal_55.20529
          Length = 691

 Score =  284 bits (727), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 202/665 (30%), Positives = 330/665 (49%), Gaps = 27/665 (4%)

Query: 19  ELVTTLDTVFQEKDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGFSQLIK 78
           E++    +V Q + SLT ++    + +YV+  +  +P +  + L   F  S +    ++ 
Sbjct: 24  EVIQECLSVIQSQASLT-VESAAVLARYVIPVYTSLPSASKMLLFTIFEESFLLLGHVLN 82

Query: 79  FGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGSTVFNFV 138
           F   +  K SE  IY  ++ + L  +   +  Y I   E+ T+  +L+  F GS + N V
Sbjct: 83  FIKLLQ-KSSEAKIYKRFLIEGLSHNHGCIYKY-IRGAEHITELQMLRSAFFGSKILNSV 140

Query: 139 KGKLNPLEYIELLNNQLVFALDKLDSRSGDFH-KYLGNHIASLCDFHNIFAPDVILSKTF 197
             +++   Y++++  Q  F  D+    +  F  K   + + +    H++ AP+V+     
Sbjct: 141 GDEIDIENYLDIVRAQFKFIFDQ----TPQFEDKVYADFLCAFISLHSLLAPEVVFGGLV 196

Query: 198 LIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHXXXXXXXXXXXX 257
           L  ++        ++  S  ++ K+ +K L+ +LD   S  N     +            
Sbjct: 197 LSSEDHFSKFVQILRCASLLSQKKL-VKALIFFLDSRVSQANTDSAFNIFQRVGVELLS- 254

Query: 258 VQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILKNHLN 317
              + ++++  L   ++  L  ++   +   LL+ FH  E ESD   C L+   L+  L 
Sbjct: 255 TDILLKVHNEILSAVLVRNLTEEQALKLYHSLLVFFHRHEAESDGTACFLLCLALQR-LP 313

Query: 318 DSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGKSIAH 377
            S K ++ H+++FLNA+T RL+ QD  IRER+MYIAK  +N   +YESDFTI+       
Sbjct: 314 HSVKAELGHAEEFLNAVTFRLTSQDAAIRERTMYIAKKITNDSFEYESDFTIET------ 367

Query: 378 ENYEVPESDWXXXXXXXXXXXXXXXXXXXXXXXXHALEALNLXXXXXXXXXXXXQLKYVF 437
            + + P+S                           +L+   +             +  VF
Sbjct: 368 PHIKTPKSSIIDFSTLQAVKPLHDHERNFKPSA--SLDNTMVRLSLSESETDENGVTLVF 425

Query: 438 LKDLTAALENKSQRGLT--NILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVILNNDLDEK 495
           LKDL    E  S +  +  ++LK+TV+L+RQKK F  E++ Y+  ++  I  L N+L+E 
Sbjct: 426 LKDLIREFELLSNQTASRLHLLKSTVRLIRQKKDFTLEISTYSPQLLAVITSLANNLEEP 485

Query: 496 QFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXXXXXXXXXXXXARELRGYDDKQI 555
            FEE R+NALVSIL   PEK+ EL+K+LF  E                ARELRG DD  I
Sbjct: 486 AFEEWRINALVSILFAAPEKVIELIKILFGQELSLQQRMSILSALSLAARELRGIDDSVI 545

Query: 556 LKPQFDFPTSMLPWDRRQ----ENNRIEEIDDNGSDNTSGGKVLWKSSKLTKNTEEI--N 609
           +K Q DFPT  LPWD+ +    +N+++              K  WKS KLT + ++I   
Sbjct: 546 MKLQVDFPTKRLPWDKGKPEGMKNDKLSASVPTSKSLLQENKTTWKSKKLTTSAKDILSE 605

Query: 610 NRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDMTTTMD 669
           NRFR+ A+KFF+PLA+GWLNGI++GT+D +FK +YL+T++ V + AY  H+F  M   M 
Sbjct: 606 NRFRKVAAKFFFPLAHGWLNGINMGTYDLMFKKHYLTTMQMVLSAAYPHHEFNSMCQQMA 665

Query: 670 TILQD 674
            I+QD
Sbjct: 666 IIVQD 670

>AAR090W [276] [Homologous to ScYGR099W (TEL2) - SH]
           complement(506082..508061) [1980 bp, 659 aa]
          Length = 659

 Score =  264 bits (675), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 199/670 (29%), Positives = 309/670 (46%), Gaps = 35/670 (5%)

Query: 15  LEVDELVTTLDTVFQE-KDSLTNIDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGF 73
           LE    V  ++ V  E + S    +  L V++ VV+ ++ +P  +   L      S +  
Sbjct: 6   LETTSNVEVMEQVLSELEQSPMAPEAALVVLQRVVTAYESLPSRLQAMLRRLCGKSSVLM 65

Query: 74  SQLIKFGSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGST 133
           SQ++     +  +  E  IY   + + L+     L + L       T+  ++   F GS 
Sbjct: 66  SQVVVAAQQVRGR-PEAGIYQRVLRETLEREPGALAHQL--AGGGPTQRRLVTALFFGSR 122

Query: 134 VFNFVKGKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCDFHNIFAPDVIL 193
           VFN +   L+   Y+ LL  QL    +K      D        + +L  FH   A D ++
Sbjct: 123 VFNVLAHTLSAAAYVSLLTPQLQTWFEKGAGAPED-----AEVLVALLRFHPTQAADALV 177

Query: 194 SKTFLIKQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHXXXXXXXX 253
               ++ + R +       +     + ++   +LL  L ++   +N Q  +         
Sbjct: 178 D--LVLCEVRWQIFCKICNQRVGVVQRQLVNGFLLRTLGRLVEASNVQAAYDLLLTLDYR 235

Query: 254 XXXXVQDIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILK 313
               + ++ ++NS  LQ  I+ +L     ++++   L  F + + + D   C L   IL 
Sbjct: 236 LFNLL-ELHKVNSVHLQSAIVQVLPESGCEALLKICLGMFGTPDTD-DEKRCNLF-AILI 292

Query: 314 NHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGK 373
             +      K+ H  QFL+A+T RL+ +D  +R+R+M IAK  +   + YE+        
Sbjct: 293 ARMAGPELEKIVHDQQFLSAVTFRLASEDGAVRDRTMSIAKAVAGESLKYEA-------- 344

Query: 374 SIAHENYEVPESDWXXXXXXXXXXXXXXXXXXXXXXXXHALEALNLXXXXXXXXXXXXQL 433
             AH    VP                              L AL L            + 
Sbjct: 345 --AHIKLPVPPLRPKGTICFEEITTPRASAYVNNSAVEPQLGALTLEDSDDSDVDSDGER 402

Query: 434 K---YVFLKDLTAALENK--SQRGLTNILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVIL 488
           +    VFLKDL   LE    S+RG   +LK T+KLVRQK+ F SEV++YA AM+  +  +
Sbjct: 403 RGREIVFLKDLLVELEAPDLSERGPLRLLKLTIKLVRQKQAFVSEVSFYAPAMLTAVATI 462

Query: 489 NNDLDEKQFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXXXXXXXXXXXXARELR 548
           +N   E+ FEE R+NALVS+LV VPEK+ +LL +LF A+                ARELR
Sbjct: 463 SNSQSEQDFEEYRINALVSLLVAVPEKVTDLLHLLFQADLSLQQRMAILSALALAARELR 522

Query: 549 GYDDKQILKPQFDFPTSMLPWDRRQENNRIEEIDDNGSDN---TSGGKVLWKSSKL-TKN 604
           G +DK +LKP FDFPT  LP  R    +R  E  ++G+ +    S    +W+S KL +  
Sbjct: 523 GLEDKYVLKPVFDFPTRRLP--RNDAPSRALESRESGTSSEGTISAHHTVWRSRKLDSAP 580

Query: 605 TEEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDM 664
             E  N FR++A  FF+PLA+ WLNGIDLGTFD LFK +YLSTL+ +   A    +F+ M
Sbjct: 581 APERPNAFRKHAPAFFFPLAHAWLNGIDLGTFDALFKKHYLSTLRLILAAANPHAEFDRM 640

Query: 665 TTTMDTILQD 674
           +  M  +LQD
Sbjct: 641 SELMSYVLQD 650

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
           cerevisiae YGR099w TEL2 involved in controlling telomere
           length and position effect singleton, start by
           similarity
          Length = 666

 Score =  211 bits (537), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 113/249 (45%), Positives = 159/249 (63%), Gaps = 16/249 (6%)

Query: 436 VFLKDLTAALEN--KSQRGLTNILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVILNNDLD 493
           +FLKDL    E   K+      +LK TVKLVRQKK F +EV++Y+  +++ I  ++N  D
Sbjct: 415 LFLKDLLLEFEKVIKNDGSELRLLKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFD 474

Query: 494 EKQFEELRVNALVSILVVVPEKIDELLKMLFTAEXXXXXXXXXXXXXXXXARELRGYDDK 553
           EK FEE + NALVSILVV P+KI +L  +LF  E                ARELRG+DD+
Sbjct: 475 EKSFEEWKANALVSILVVCPDKIVDLYAILFNNELSLQQRMVILTSAALSARELRGFDDE 534

Query: 554 QILKPQFDFPTSMLPWD-----RRQENNRIEEIDDNGSDNTSGGKVLWKSSKL---TKNT 605
            ++KP++DFPT+ LPWD     ++ ENN+I++I +      +G KV W+S +L   +K T
Sbjct: 535 FVVKPKYDFPTNRLPWDESATEQQPENNKIQDITE-----ITGSKVTWRSKRLETDSKIT 589

Query: 606 EEINNRFREYASKFFYPLANGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDMT 665
           ++ NN FR+YA+ FFYPLA+ WLNGI+LG FDK+FK +Y+S LK +  CA   ++ E+M 
Sbjct: 590 QQQNN-FRKYATLFFYPLAHAWLNGINLGAFDKVFKRHYISMLKIILTCASPHYELEEMQ 648

Query: 666 TTMDTILQD 674
             M  IL D
Sbjct: 649 ILMQEILSD 657

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 165/354 (46%), Gaps = 14/354 (3%)

Query: 25  DTVFQEKDSLTN-----IDVILTVIKYVVSHHQVMPKSVILKLNWFFAHSLIGFSQLIKF 79
           DT++Q  + +++      + IL +IK VV  +  +P+ + + L     ++ I  S +I++
Sbjct: 16  DTIYQVLERMSSKKQHSSNEILPIIKNVVPIYPSLPRELKMALRRLCGNNYIFISLVIEY 75

Query: 80  GSDIDAKQSEQLIYIEYVTQFLKSSTTYLQNYLIECTENRTKELILKRTFTGSTVFNFVK 139
             ++  K  E  I+  ++T  LK  +  L NYL E +  R    I K    GS  +N + 
Sbjct: 76  AKEL-GKNRETSIFYGFLTDVLKYESDCLFNYL-EHSSRRDLPFI-KSILFGSRCYNALS 132

Query: 140 GKLNPLEYIELLNNQLVFALDKLDSRSGDFHKYLGNHIASLCDFHNIFAPDVILSKTFLI 199
             ++ +EY++ +  Q  F   +    +  + K       S    +  +  D+ +      
Sbjct: 133 SSISIVEYLKFMKMQWEFVFKE----TKQYDKTHLEMFVSCLQLNIPYGVDIFIEGLATT 188

Query: 200 KQERLETLSLFMKKTSEYTRYKIGIKYLLPYLDKVCSDTNAQLVHHXXXXXXXXXXXXVQ 259
            +     L + + K +   + +  + +L+P+L+KV +  N+  +              + 
Sbjct: 189 SEFSWNALIMMLSKGTSVQQRRFFMYHLVPFLEKVTNPDNSSTIFTLLSQLPFDIPTSI- 247

Query: 260 DIFRLNSFTLQKTILAILDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILKNHLNDS 319
           D F+  +   +   L  +   K   +   LL  F  ++  +D++  +++V IL     DS
Sbjct: 248 DCFKWGNPYFKIVYLHGMSEAKRAQLFRELLPCFELMDLYTDDSLAEILVMILDAMSKDS 307

Query: 320 GKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGK 373
            + ++ H    LN +TKRL  +D ++RER+M++AK  +N ++ YESDFTID+ +
Sbjct: 308 -RDELSHDAISLNFVTKRLHSEDHLVRERTMFVAKKLTNDQLQYESDFTIDLPR 360

>CAGL0C00627g 65389..66483 similar to sp|P38270 Saccharomyces
           cerevisiae YBR128c APG14 required for autophagy,
           hypothetical start
          Length = 364

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 309 VTILKNHLNDSGKIKVCHSDQFLNAITKRLSDQDKIIRERSMYIAKIAS 357
           V ILK  L   GK++V   ++  N I  ++S QD+ I+E+S YIA++ S
Sbjct: 76  VQILKERL---GKVQVLRKERQNNKIKHKISQQDRRIKEKSRYIAELRS 121

>KLLA0A09185g 804448..805761 highly similar to sp|P00924
           Saccharomyces cerevisiae YGR254w ENO1 enolase I
           (2-phosphoglycerate dehydratase), start by similarity
          Length = 437

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 160 DKLDSRSGDFHKYLGNHI-ASLCDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYT 218
           + L+ R GD  K+LG  +  ++ + +NI AP ++ +   +  Q++++ L L +  T+   
Sbjct: 45  EALELRDGDKSKWLGKGVLTAVSNVNNIIAPALVKANVDVTNQQQVDDLLLSLDGTA--N 102

Query: 219 RYKIGIKYLL 228
           + K+G   +L
Sbjct: 103 KSKLGANAIL 112

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
           Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 9/81 (11%)

Query: 78  KFGSDIDA---KQSEQLIYIEYVTQFLKSSTTYLQN----YLIECTENRTKELILKRTFT 130
           KF +D++A     S  LI         K ++ Y+Q+    Y+I CT  R K L   R +T
Sbjct: 189 KFTADVNALLQDISTSLIPASNELYLPKMTSNYVQSHFNQYIISCTNERLKNLRANRQYT 248

Query: 131 GSTVFNFVKGKLNPLEYIELL 151
              V + + GKL P +   LL
Sbjct: 249 A--VDSVINGKLFPFQKDSLL 267

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 20,259,070
Number of extensions: 880376
Number of successful extensions: 2819
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2878
Number of HSP's successfully gapped: 25
Length of query: 674
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 566
Effective length of database: 12,857,365
Effective search space: 7277268590
Effective search space used: 7277268590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)