Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G07689g21521211051e-156
Scas_675.282162177981e-109
YKR014C (YPT52)2342327671e-104
Kwal_14.23942072127581e-103
Sklu_2238.22072127551e-102
AAL176C2052127471e-101
KLLA0D02376g2072126961e-93
KLLA0C13728g2081884869e-62
YOR089C (VPS21)2101704791e-60
Kwal_23.29782111704764e-60
Scas_662.262121704712e-59
CAGL0J08635g2082124685e-59
YNL093W (YPT53)2201894565e-57
ACL084C2071974547e-57
Kwal_14.24842032033763e-45
Sklu_2366.32182163722e-44
Scas_203.22511793742e-44
Sklu_2293.32141743643e-43
Kwal_56.225552121803633e-43
AEL187C2081833624e-43
YLR262C (YPT6)2151773626e-43
AGR257C2202153592e-42
KLLA0F01232g2101743531e-41
Scas_574.22221743532e-41
CAGL0K06017g2191743487e-41
KLLA0F20471g2121743487e-41
YER031C (YPT31)2231733426e-40
CAGL0K09394g2211713401e-39
CAGL0I09306g2061923373e-39
YBR264C (YPT10)1991583337e-39
AER434C2191713322e-38
YGL210W (YPT32)2221663235e-37
CAGL0C02453g2181663218e-37
Scas_712.412191713191e-36
CAGL0K12672g2061933033e-34
Scas_713.52111702991e-33
YFL038C (YPT1)2061702972e-33
KLLA0D05313g2041932963e-33
Kwal_14.11162041932964e-33
ACR003C2081712964e-33
KLLA0D01265g2071702912e-32
Scas_674.52081722903e-32
CAGL0E02607g2082102886e-32
Sklu_2144.32041702877e-32
ABR220W2041882861e-31
Sklu_2373.32081722861e-31
Scas_656.22181952826e-31
YML001W (YPT7)2081712763e-30
Kwal_56.224402081702721e-29
Kwal_23.50582131702721e-29
Sklu_1815.22131932712e-29
KLLA0E12111g2141632686e-29
Scas_707.262101842686e-29
CAGL0F02123g2151632642e-28
AGL021W2121632617e-28
YFL005W (SEC4)2151842591e-27
Kwal_47.190551791422543e-27
Sklu_1136.11821422544e-27
ABR182W2091872251e-22
Scas_691.362121742208e-22
YPR165W (RHO1)2091932162e-21
Scas_610.42111902163e-21
Kwal_55.219372081962153e-21
YLR293C (GSP1)2191702154e-21
YOR185C (GSP2)2201702155e-21
Sklu_1816.11881952101e-20
CAGL0I00594g2141702111e-20
Sklu_2151.32091902111e-20
KLLA0C05126g2141702102e-20
KLLA0A04499g2141702102e-20
AGR294C2141702102e-20
CAGL0I08459g2101732092e-20
Sklu_2285.42141702092e-20
Scas_586.62191702084e-20
Sklu_2151.42071732066e-20
KLLA0B10626g2081902067e-20
Kwal_56.233612141702067e-20
ABR183W2071902041e-19
Kwal_55.219412091922022e-19
ACL087C1871942003e-19
KLLA0D08327g2541922033e-19
AER132W2321691981e-18
Kwal_47.169832231791972e-18
Kwal_33.144522602241982e-18
Sklu_1653.32561691982e-18
Kwal_33.140152711941973e-18
KLLA0C13816g1871821933e-18
CAGL0J05632g1881951925e-18
Scas_578.71871941916e-18
KLLA0B05038g2231691937e-18
YKR055W (RHO4)2912161968e-18
Scas_677.202832191895e-17
Scas_547.32231691822e-16
Scas_444.4*2891701843e-16
Scas_575.102711741809e-16
Sklu_2007.22612091791e-15
Scas_417.32912311782e-15
CAGL0E03113g3231741792e-15
ABL139C2941901774e-15
AGL093W1911781724e-15
YNL090W (RHO2)1921721724e-15
CAGL0L11242g2541611754e-15
ACR257C2591811737e-15
YGR152C (RSR1)2722131721e-14
Sklu_2345.52191641701e-14
KLLA0C12001g2591921711e-14
Sklu_1655.12871911721e-14
YLR229C (CDC42)1911781681e-14
YOR101W (RAS1)3092041722e-14
CAGL0K08316g3231801722e-14
CAGL0B04521g3391651713e-14
YML064C (TEM1)2451611693e-14
Kwal_23.31351911781653e-14
KLLA0A04213g1911781654e-14
KLLA0F03443g2231901665e-14
CAGL0G08558g2271941665e-14
ADL252W2241901656e-14
CAGL0F05269g1911781637e-14
Scas_721.961911781629e-14
KLLA0A05643g2181901641e-13
Scas_703.412251201641e-13
ADL262W2701651651e-13
YNL180C (RHO5)3312651661e-13
KLLA0A11330g1901651612e-13
Kwal_14.22442441741632e-13
Kwal_26.83872921651632e-13
AFR464W2641831623e-13
Kwal_55.21971421951634e-13
YIL118W (RHO3)2312001561e-12
Scas_697.463241641572e-12
Scas_671.352341291552e-12
Kwal_34.161421921861505e-12
YNL098C (RAS2)3221651536e-12
Kwal_23.48752301961517e-12
CAGL0I03916g1811711373e-10
YNL304W (YPT11)355981404e-10
YDL137W (ARF2)1811711348e-10
Scas_624.4*1811711331e-09
CAGL0J09064g1811711331e-09
Scas_701.42*1811711331e-09
CAGL0G05764g2901891361e-09
Sklu_2320.21641251312e-09
ADL162W404981352e-09
Kwal_23.29441841261303e-09
YOR094W (ARF3)1831291294e-09
Sklu_1681.21621701284e-09
YDL192W (ARF1)1811711285e-09
CAGL0J11242g3841331325e-09
Scas_697.54*1811261285e-09
Sklu_2354.10422961326e-09
Kwal_56.244531811711286e-09
ACL078W1811461277e-09
Kwal_56.244621811731261e-08
KLLA0C13563g1821291233e-08
ADR094W1811601223e-08
CAGL0M03817g4751031254e-08
KLLA0F05225g1811601191e-07
YCR027C (RHB1)2091801182e-07
Scas_503.25271121202e-07
KLLA0C12881g3731131183e-07
Scas_628.212081791154e-07
YMR138W (CIN4)1911851138e-07
Sklu_2365.21971771129e-07
YPL051W (ARL3)1981911111e-06
CAGL0I00858g1971811092e-06
Scas_567.91991871074e-06
Sklu_2202.61831121049e-06
CAGL0E05896g1891241041e-05
YPL218W (SAR1)1901491004e-05
KLLA0E24805g183112987e-05
YBR164C (ARL1)183112987e-05
AGR221W183113977e-05
CAGL0I10835g183112979e-05
Kwal_27.11872197126961e-04
KLLA0C13387g21196961e-04
CAGL0L12826g199167952e-04
Kwal_47.18241230124943e-04
Scas_700.11183112933e-04
Scas_706.2*190120908e-04
Scas_680.21183177880.001
KLLA0B02046g190120880.001
CAGL0E06292g408234880.002
KLLA0F17072g190125850.004
YMR023C (MSS1)526197870.004
Sklu_1358.1218133830.007
Kwal_26.6810664197810.020
Kwal_56.2414914993760.041
YAL048C662169780.043
AGL261W198124770.044
KLLA0A03465g659146780.052
KLLA0F02662g253129760.067
Sklu_2411.4496177760.075
AFL114W190120730.13
ADR402W661110720.27
AEL232C309131700.39
Kwal_47.17857198195670.78
AFR359C240120661.1
Scas_692.9309144661.4
KLLA0E12837g19973651.4
Scas_698.27701106661.6
KLLA0E07634g501179652.0
KLLA0E11638g40571642.1
KLLA0C06358g299155632.9
Scas_721.9039744633.1
Scas_690.10801114633.6
CAGL0L13090g74866625.1
CAGL0K06369g33081598.5
Scas_721.832947599.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G07689g
         (212 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G07689g complement(729919..730566) highly similar to sp|P36...   430   e-156
Scas_675.28                                                           311   e-109
YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-bind...   300   e-104
Kwal_14.2394                                                          296   e-103
Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement        295   e-102
AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..3220...   292   e-101
KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces c...   272   1e-93
KLLA0C13728g 1173329..1173955 highly similar to sp|P36017 Saccha...   191   9e-62
YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-bind...   189   1e-60
Kwal_23.2978                                                          187   4e-60
Scas_662.26                                                           186   2e-59
CAGL0J08635g complement(853978..854604) highly similar to sp|P36...   184   5e-59
YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protei...   180   5e-57
ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W (...   179   7e-57
Kwal_14.2484                                                          149   3e-45
Sklu_2366.3 , Contig c2366 5288-5944 reverse complement               147   2e-44
Scas_203.2                                                            148   2e-44
Sklu_2293.3 YLR262C, Contig c2293 4975-5619                           144   3e-43
Kwal_56.22555                                                         144   3e-43
AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH] (284984..2...   144   4e-43
YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-bindi...   144   6e-43
AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH] (1225886..1...   142   2e-42
KLLA0F01232g complement(114430..115062) similar to sp|P36019 Sac...   140   1e-41
Scas_574.2                                                            140   2e-41
CAGL0K06017g complement(586093..586752) highly similar to sp|Q99...   138   7e-41
KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260 Saccha...   138   7e-41
YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-bindi...   136   6e-40
CAGL0K09394g complement(929234..929899) highly similar to sp|P51...   135   1e-39
CAGL0I09306g complement(897087..897707) similar to sp|P38146 Sac...   134   3e-39
YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of ...   132   7e-39
AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C ...   132   2e-38
YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein r...   129   5e-37
CAGL0C02453g 247493..248149 highly similar to sp|P38555 Saccharo...   128   8e-37
Scas_712.41                                                           127   1e-36
CAGL0K12672g 1255541..1256161 highly similar to sp|P01123 Saccha...   121   3e-34
Scas_713.5                                                            119   1e-33
YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding ...   119   2e-33
KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1 Kluyverom...   118   3e-33
Kwal_14.1116                                                          118   4e-33
ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH] (359762..36...   118   4e-33
KLLA0D01265g 110784..111407 highly similar to sp|P32939 Saccharo...   116   2e-32
Scas_674.5                                                            116   3e-32
CAGL0E02607g complement(248761..249387) highly similar to sp|P32...   115   6e-32
Sklu_2144.3 YFL038C, Contig c2144 4079-4693                           115   7e-32
ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH] complement(8...   114   1e-31
Sklu_2373.3 YML001W, Contig c2373 10977-11603                         114   1e-31
Scas_656.2                                                            113   6e-31
YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein...   110   3e-30
Kwal_56.22440                                                         109   1e-29
Kwal_23.5058                                                          109   1e-29
Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement        108   2e-29
KLLA0E12111g 1075299..1075943 highly similar to sp|P07560 Saccha...   107   6e-29
Scas_707.26                                                           107   6e-29
CAGL0F02123g 212117..212764 highly similar to sp|P07560 Saccharo...   106   2e-28
AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH] complement(...   105   7e-28
YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein ...   104   1e-27
Kwal_47.19055                                                         102   3e-27
Sklu_1136.1 YGL210W, Contig c1136 1284-1832                           102   4e-27
ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    91   1e-22
Scas_691.36                                                            89   8e-22
YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein...    88   2e-21
Scas_610.4                                                             88   3e-21
Kwal_55.21937                                                          87   3e-21
YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a GT...    87   4e-21
YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a GT...    87   5e-21
Sklu_1816.1 YNL090W, Contig c1816 115-681                              86   1e-20
CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomy...    86   1e-20
Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement         86   1e-20
KLLA0C05126g complement(463657..464301) highly similar to sp|P32...    86   2e-20
KLLA0A04499g complement(404732..405376) highly similar to sp|P32...    86   2e-20
AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C (...    86   2e-20
CAGL0I08459g 829292..829924 highly similar to sp|P06780 Saccharo...    85   2e-20
Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement         85   2e-20
Scas_586.6                                                             85   4e-20
Sklu_2151.4 , Contig c2151 3640-4263 reverse complement                84   6e-20
KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromy...    84   7e-20
Kwal_56.23361                                                          84   7e-20
ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH] complement(7...    83   1e-19
Kwal_55.21941                                                          82   2e-19
ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH] (191573..192...    82   3e-19
KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces c...    83   3e-19
AER132W [2636] [Homologous to ScYML064C (TEM1) - SH] complement(...    81   1e-18
Kwal_47.16983                                                          80   2e-18
Kwal_33.14452                                                          81   2e-18
Sklu_1653.3 YML064C, Contig c1653 2277-3047                            81   2e-18
Kwal_33.14015                                                          80   3e-18
KLLA0C13816g 1183412..1183975 highly similar to sp|P06781 Saccha...    79   3e-18
CAGL0J05632g complement(537342..537908) highly similar to sp|P06...    79   5e-18
Scas_578.7                                                             78   6e-18
KLLA0B05038g complement(457608..458279) similar to sp|P38987 Sac...    79   7e-18
YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein...    80   8e-18
Scas_677.20                                                            77   5e-17
Scas_547.3                                                             75   2e-16
Scas_444.4*                                                            75   3e-16
Scas_575.10                                                            74   9e-16
Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement          74   1e-15
Scas_417.3                                                             73   2e-15
CAGL0E03113g complement(289164..290135) some similarities with s...    74   2e-15
ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH] (134875..135...    73   4e-15
AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH] complement...    71   4e-15
YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein...    71   4e-15
CAGL0L11242g 1197075..1197839 highly similar to sp|P38987 Saccha...    72   4e-15
ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH] (808667..80...    71   7e-15
YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-bindin...    71   1e-14
Sklu_2345.5 YCR027C, Contig c2345 9936-10595                           70   1e-14
KLLA0C12001g complement(1029092..1029871) similar to sp|P13856 S...    70   1e-14
Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement          71   1e-14
YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type...    69   1e-14
YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein...    71   2e-14
CAGL0K08316g 838393..839364 some similarities with sp|Q00246 Sac...    71   2e-14
CAGL0B04521g complement(439732..440751) similar to sp|P01120 Sac...    70   3e-14
YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-bindi...    70   3e-14
Kwal_23.3135                                                           68   3e-14
KLLA0A04213g complement(382243..382818) highly similar to sp|P19...    68   4e-14
KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya g...    69   5e-14
CAGL0G08558g complement(804969..805652) highly similar to sp|Q00...    69   5e-14
ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH] complement(...    68   6e-14
CAGL0F05269g complement(533759..534334) highly similar to sp|P19...    67   7e-14
Scas_721.96                                                            67   9e-14
KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces c...    68   1e-13
Scas_703.41                                                            68   1e-13
ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C (...    68   1e-13
YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of...    69   1e-13
KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida...    67   2e-13
Kwal_14.2244                                                           67   2e-13
Kwal_26.8387                                                           67   2e-13
AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH] complement(...    67   3e-13
Kwal_55.21971                                                          67   4e-13
YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein ...    65   1e-12
Scas_697.46                                                            65   2e-12
Scas_671.35                                                            64   2e-12
Kwal_34.16142                                                          62   5e-12
YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-bindi...    64   6e-12
Kwal_23.4875                                                           63   7e-12
CAGL0I03916g 343014..343559 highly similar to sp|P11076 Saccharo...    57   3e-10
YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase pos...    59   4e-10
YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein o...    56   8e-10
Scas_624.4*                                                            56   1e-09
CAGL0J09064g 892556..893101 highly similar to sp|P11076 Saccharo...    56   1e-09
Scas_701.42*                                                           56   1e-09
CAGL0G05764g complement(552809..553681) similar to sp|P53879 Sac...    57   1e-09
Sklu_2320.2 YOR094W, Contig c2320 3571-4065                            55   2e-09
ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH] complement...    57   2e-09
Kwal_23.2944                                                           55   3e-09
YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with simila...    54   4e-09
Sklu_1681.2 YDL137W, Contig c1681 2279-2767                            54   4e-09
YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein i...    54   5e-09
CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces...    55   5e-09
Scas_697.54*                                                           54   5e-09
Sklu_2354.10 YNL304W, Contig c2354 13851-15119                         55   6e-09
Kwal_56.24453                                                          54   6e-09
ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH] complement(2...    54   7e-09
Kwal_56.24462                                                          53   1e-08
KLLA0C13563g complement(1157278..1157826) highly similar to sp|P...    52   3e-08
ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W (...    52   3e-08
CAGL0M03817g complement(431237..432664) weakly similar to sp|P48...    53   4e-08
KLLA0F05225g 515391..515936 highly similar to sp|P19146 Saccharo...    50   1e-07
YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein inv...    50   2e-07
Scas_503.2                                                             51   2e-07
KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559 Saccha...    50   3e-07
Scas_628.21                                                            49   4e-07
YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein...    48   8e-07
Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement          48   9e-07
YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation fa...    47   1e-06
CAGL0I00858g complement(63365..63958) similar to sp|P39110 Sacch...    47   2e-06
Scas_567.9                                                             46   4e-06
Sklu_2202.6 YBR164C, Contig c2202 5407-5958                            45   9e-06
CAGL0E05896g join(complement(585178..585202),complement(584348.....    45   1e-05
YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408) Comp...    43   4e-05
KLLA0E24805g 2194554..2195105 highly similar to sp|P38116 Saccha...    42   7e-05
YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding...    42   7e-05
AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH] complement(...    42   7e-05
CAGL0I10835g 1060258..1060809 highly similar to sp|P38116 Saccha...    42   9e-05
Kwal_27.11872                                                          42   1e-04
KLLA0C13387g complement(1142002..1142637) similar to sp|P01119 S...    42   1e-04
CAGL0L12826g complement(1370767..1371366) highly similar to tr|Q...    41   2e-04
Kwal_47.18241                                                          41   3e-04
Scas_700.11                                                            40   3e-04
Scas_706.2*                                                            39   8e-04
Scas_680.21                                                            39   0.001
KLLA0B02046g 178646..179218 highly similar to sp|P20606 Saccharo...    39   0.001
CAGL0E06292g 633135..634361 some similarities with sp|P01119 Sac...    39   0.002
KLLA0F17072g complement(1566668..1567240) similar to sp|P39110 S...    37   0.004
YMR023C (MSS1) [3987] chr13 complement(319436..321016) Mitochond...    38   0.004
Sklu_1358.1 YMR138W, Contig c1358 536-1192                             37   0.007
Kwal_26.6810                                                           36   0.020
Kwal_56.24149                                                          34   0.041
YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein inv...    35   0.043
AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH] complement(...    34   0.044
KLLA0A03465g complement(314573..316552) similar to sp|P39722 Sac...    35   0.052
KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus...    34   0.067
Sklu_2411.4 YMR023C, Contig c2411 8898-10388                           34   0.075
AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH] complement(...    33   0.13 
ADR402W [2142] [Homologous to ScYAL048C - SH] complement(1426900...    32   0.27 
AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 3...    32   0.39 
Kwal_47.17857                                                          30   0.78 
AFR359C [3551] [Homologous to ScYEL038W (UTR4) - SH] (1089133..1...    30   1.1  
Scas_692.9                                                             30   1.4  
KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomy...    30   1.4  
Scas_698.27                                                            30   1.6  
KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces c...    30   2.0  
KLLA0E11638g 1028781..1029998 some similarities with sp|P01120 S...    29   2.1  
KLLA0C06358g complement(563583..564482) highly similar to sp|Q00...    29   2.9  
Scas_721.90                                                            29   3.1  
Scas_690.10                                                            29   3.6  
CAGL0L13090g 1395504..1397750 some similarities with sp|P38830 S...    28   5.1  
CAGL0K06369g 624706..625698 highly similar to tr|Q03290 Saccharo...    27   8.5  
Scas_721.8                                                             27   9.1  

>CAGL0G07689g complement(729919..730566) highly similar to sp|P36018
           Saccharomyces cerevisiae YKR014c YPT52 GTP-binding
           protein, start by similarity
          Length = 215

 Score =  430 bits (1105), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS
Sbjct: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180

Query: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS
Sbjct: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212

>Scas_675.28
          Length = 216

 Score =  311 bits (798), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 154/217 (70%), Positives = 182/217 (83%), Gaps = 9/217 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK--DGNEDVVIKF 58
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDELRESTIGAAFLSQT+KIK  +  EDVVIKF
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDELRESTIGAAFLSQTIKIKAEEQEEDVVIKF 60

Query: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYL 118
           EIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ DSL KA+SWV+EL+NKVGDE+LVI+L
Sbjct: 61  EIWDTAGQERYKSLAPMYYRNANAALVVYDLTQKDSLVKARSWVEELKNKVGDEDLVIFL 120

Query: 119 VGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKK 178
           VGNK+D+ E +E  R ++T E   YA+ Q LLF EVSAKTG GVK++F+ IGE+LY++KK
Sbjct: 121 VGNKLDLCEGEEDLRAVDTSEAKAYAEEQNLLFTEVSAKTGQGVKEVFRSIGEKLYASKK 180

Query: 179 ASL---KNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
             +   KN++   R +    N+VDI  QRPSTNDT++
Sbjct: 181 DEILAKKNRELGNRVN----NSVDINAQRPSTNDTTT 213

>YKR014C (YPT52) [3269] chr11 complement(465010..465714) GTP-binding
           protein of the rab family (ras superfamily) involved in
           endocytosis and transport of proteins to the vacuole
           [705 bp, 234 aa]
          Length = 234

 Score =  300 bits (767), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/232 (67%), Positives = 181/232 (78%), Gaps = 21/232 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK--DGNE--DVVI 56
           MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQ++ I   DGNE  DVVI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVI 60

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVI 116
           KFEIWDTAGQERYKSLAPMYYRNANAALVVYD+TQ DSL KA++WV EL+NKVGD++LVI
Sbjct: 61  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVI 120

Query: 117 YLVGNKVDIVE----------------ADESARKIETEEGAEYAQAQKLLFKEVSAKTGA 160
           YL+GNKVD+ +                 ++  R I TEE  +YAQ Q LLF+EVSAKTG 
Sbjct: 121 YLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGE 180

Query: 161 GVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           GVK+IFQ+IGE+LY  KK  + +K Q+R+    ++  VDI  QRPSTND +S
Sbjct: 181 GVKEIFQDIGEKLYDLKKDEILSK-QNRQIGGGNNGQVDINLQRPSTNDPTS 231

>Kwal_14.2394
          Length = 207

 Score =  296 bits (758), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/212 (69%), Positives = 171/212 (80%), Gaps = 8/212 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K++  +EDV IKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLEK-HEDVTIKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVTQ  SL KAQSWV+EL+NKVGD++LVI LVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQAGSLVKAQSWVEELKNKVGDQDLVICLVG 119

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           NK+D+   +E  R +E E+   YAQ Q LLF EVSAKTG+GV  IFQEIGE +Y  K A+
Sbjct: 120 NKLDLCTEEEGGRGVEKEDAQMYAQEQGLLFHEVSAKTGSGVAAIFQEIGENVYQKKGAA 179

Query: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
                Q+R+T +V       + QRPSTND++S
Sbjct: 180 TAASPQARKTPNV-------KLQRPSTNDSTS 204

>Sklu_2238.2 YKR014C, Contig c2238 2956-3579 reverse complement
          Length = 207

 Score =  295 bits (755), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/212 (68%), Positives = 172/212 (81%), Gaps = 8/212 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K+KD N D V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSQTIKLKDYN-DTVVKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQERYKSLAPMYYRNAN ALVVYDVTQPDSL KAQ+WV EL++KVGDE+LVI LVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANGALVVYDVTQPDSLVKAQNWVDELKSKVGDEDLVICLVG 119

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           NK+D+ E +   R ++ ++   YA  + LLF EVSAKTG GV +IFQEIGE+LY  KK S
Sbjct: 120 NKLDLCEEEGQERGVDKDDAQSYASDKGLLFHEVSAKTGKGVSNIFQEIGEKLYLQKKDS 179

Query: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           L+   Q+R       + V+++ QRP+TND +S
Sbjct: 180 LEAASQTR-------HVVNVELQRPTTNDATS 204

>AAL176C [11] [Homologous to ScYKR014C (YPT52) - SH] (31588..32205)
           [618 bp, 205 aa]
          Length = 205

 Score =  292 bits (747), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 172/212 (81%), Gaps = 10/212 (4%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLS+T+K+ D ++D +IKFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEFRESTIGAAFLSRTIKLAD-HDDAMIKFEI 59

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVTQ DSL+KAQSWV EL++KVGDE+LVI+LVG
Sbjct: 60  WDTAGQERYKSLAPMYYRNANAALVVYDVTQEDSLAKAQSWVNELKSKVGDEDLVIFLVG 119

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           NK+D+V+ D   R I++EE   YA+A  L+F EVSAKTG G+ D+FQ IG +LY  ++ S
Sbjct: 120 NKLDLVDEDCKPRVIDSEEAQAYAEAHGLMFHEVSAKTGTGILDVFQGIGGKLYEQRRES 179

Query: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           L  + Q         ++  IQ QRP+TND +S
Sbjct: 180 LAAQPQ---------HSSSIQLQRPTTNDATS 202

>KLLA0D02376g 201512..202135 similar to sp|P36018 Saccharomyces
           cerevisiae YKR014c YPT52 GTP-binding protein of the rab
           family, start by similarity
          Length = 207

 Score =  272 bits (696), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 135/212 (63%), Positives = 167/212 (78%), Gaps = 8/212 (3%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           MLQFKLVLLGDSSVGKSSIVHRFVKD+FDE RESTIGAAFLSQT+K+ +  ++ V+KFEI
Sbjct: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDSFDEYRESTIGAAFLSQTIKLSEEYDEQVLKFEI 60

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQERYKSLAPMYYRNANAALVVYDVT+PDSL KA+ WV EL+ KV D++L+I LVG
Sbjct: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTEPDSLPKAKLWVDELKEKVNDDKLIICLVG 120

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           NK+D+V   ES   ++  +  E+AQ   LLF +VSAKTG  V  +FQ+IGE+LY      
Sbjct: 121 NKLDLVSERESTSLVDEADAREFAQENNLLFHQVSAKTGENVIKVFQDIGERLY------ 174

Query: 181 LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           L+NKD+ + +   ++N + +  QRPSTND+ S
Sbjct: 175 LQNKDKIQESKKPNNNNISL--QRPSTNDSQS 204

>KLLA0C13728g 1173329..1173955 highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  191 bits (486), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (70%), Gaps = 7/188 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V + D      IKFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMADH----TIKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV+EL  +   + +VI LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKM 122

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKN 183
           D++E++E  RK+  EE  + +Q + LLF E SAKTG  V ++F  IGE++   KK+   N
Sbjct: 123 DLLESEED-RKVAKEEAEKLSQEENLLFFETSAKTGDNVNEVFLAIGEKI-PLKKSDGSN 180

Query: 184 KDQSRRTD 191
            D  R T+
Sbjct: 181 TDGLRGTE 188

>YOR089C (VPS21) [4894] chr15 complement(490197..490829) GTP-binding
           protein required for sorting of vacuolar proteins and
           involved in late stage of endocytosis, member of the rab
           family in the ras superfamily [633 bp, 210 aa]
          Length = 210

 Score =  189 bits (479), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 126/170 (74%), Gaps = 6/170 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V I   NE  V KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTI---NEHTV-KFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV+EL  +   ++++I LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQ-ASKDIIIALVGNKI 122

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+++ +   RK+  EEG + A+ + LLF E SAKTG  V D+F  IGE++
Sbjct: 123 DMLQ-EGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKI 171

>Kwal_23.2978
          Length = 211

 Score =  187 bits (476), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 98/170 (57%), Positives = 125/170 (73%), Gaps = 6/170 (3%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V + D      IKFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVNMGDH----TIKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV+EL+ +   +++VI LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELREQ-ASKDIVIALVGNKL 122

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           DIVE+    RK+  EE    A  ++LLF E SAKTG+ V ++F  IG+++
Sbjct: 123 DIVESG-GERKVAREEAENLAAQEQLLFFETSAKTGSNVNEVFLGIGQKI 171

>Scas_662.26
          Length = 212

 Score =  186 bits (471), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 126/170 (74%), Gaps = 5/170 (2%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V I D      +KFEIWDT
Sbjct: 8   IKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNINDN----TVKFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER+ SLAPMYYRNA AAL+VYDVT+P S  KA+ W++EL  +  +++++I LVGNKV
Sbjct: 64  AGQERFASLAPMYYRNAQAALIVYDVTKPQSFIKARHWIKELHEQ-ANKDMIIALVGNKV 122

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D++E +E  RK+  EEG + A+ + LLF E SAKTG  V + F  IGE++
Sbjct: 123 DVLENNEDERKVAREEGEKLAEEEGLLFFETSAKTGLNVTETFVAIGEKI 172

>CAGL0J08635g complement(853978..854604) highly similar to sp|P36017
           Saccharomyces cerevisiae YOR089c VPS21 GTP-binding
           protein, start by similarity
          Length = 208

 Score =  184 bits (468), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 143/212 (67%), Gaps = 15/212 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V I   NE  V KFEIWDT
Sbjct: 8   LKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVTI---NEHTV-KFEIWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER+ SLAPMYYRNA AALVVYDVT+P S  KA+ WV+ELQ +   ++++I LVGNK+
Sbjct: 64  AGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELQEQ-ASKDIIIALVGNKI 122

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKN 183
           D++E + + R +  EE  + A+ + LLF E SAK+G  + D+F  IGE      K  LK 
Sbjct: 123 DVLE-NGTERSVSREEAEKLAEEENLLFFETSAKSGENITDVFLAIGE------KVPLKT 175

Query: 184 KDQSRRTDSVSSN-TVDIQT--QRPSTNDTSS 212
            +Q+   ++ + N  VD+ +    P+ N + S
Sbjct: 176 ANQANVPNNANENQRVDLTSVVNNPAANSSCS 207

>YNL093W (YPT53) [4498] chr14 (449868..450530) GTP-binding protein
           involved in endocytosis and transport of proteins to the
           vacuole, member of the rab family in the ras superfamily
           [663 bp, 220 aa]
          Length = 220

 Score =  180 bits (456), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 96/189 (50%), Positives = 128/189 (67%), Gaps = 7/189 (3%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           L  K+VLLG+S+VGKSSIV RFV D F E +E TIGAAFL++ +  +DG    VIKFEIW
Sbjct: 11  LTIKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRI-TRDGK---VIKFEIW 66

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           DTAGQER+  LAPMYYRNA AALVV+DVT   S  KAQ+WV+EL  KVG  ++VI LVGN
Sbjct: 67  DTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVG-HDIVIALVGN 125

Query: 122 KVDIVEADE--SARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           K+D++  D+    R ++        + + LL+ E SAKTG  +  IFQ +GE++   ++ 
Sbjct: 126 KMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQN 185

Query: 180 SLKNKDQSR 188
           + ++    R
Sbjct: 186 TRQSSTHDR 194

>ACL084C [965] [Homologous to ScYOR089C (VPS21) - SH; ScYNL093W
           (YPT53) - SH] (199020..199643) [624 bp, 207 aa]
          Length = 207

 Score =  179 bits (454), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 137/197 (69%), Gaps = 11/197 (5%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLVLLG+++VGKSSIV RFV + F E +E TIGAAFL+Q V +    +   IKFEIWDTA
Sbjct: 9   KLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFLTQRVNM----DSKTIKFEIWDTA 64

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           GQER+ SLAPMYYRNA AALVVYD+T+P S  KA+ WV+EL  +   + +VI LVGNK+D
Sbjct: 65  GQERFASLAPMYYRNAQAALVVYDITKPQSFIKARHWVKELHEQ-ASKGIVIALVGNKLD 123

Query: 125 IVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTK----KAS 180
           ++E  E ARK+  EE  + A+ + LLF E SAKTG  + ++F  IGE++   K     AS
Sbjct: 124 LLENGE-ARKVSREEAEKLAEEEGLLFFETSAKTGDKINEVFLAIGEKIPLAKVGEQPAS 182

Query: 181 LKNKDQSRR-TDSVSSN 196
             + D +R   ++VSSN
Sbjct: 183 GPSVDNARLDLNAVSSN 199

>Kwal_14.2484
          Length = 203

 Score =  149 bits (376), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 127/203 (62%), Gaps = 24/203 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + KLVLLG+SSVGKS++V RF   +F +   +TIGAAF ++ +  +       +KFEIWD
Sbjct: 9   ELKLVLLGESSVGKSALVTRFTTGSFHK-SNATIGAAFTTKVISWETETARKEVKFEIWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE---LVIYLV 119
           TAGQERY++L PMYYRN + A VV+DVT+  +  KA SWVQEL++ +  EE   +VI L+
Sbjct: 68  TAGQERYRALTPMYYRNTDVAFVVFDVTEESTSLKADSWVQELKSYMEGEEAHNIVIKLI 127

Query: 120 GNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           GNK+D++  DE                +K+ +  VSAKTG GV D+F+ +  ++ S+K  
Sbjct: 128 GNKIDLL--DE-------------VPPRKVGWTPVSAKTGEGVADLFESVAREVPSSK-- 170

Query: 180 SLKNKDQSRRTDSVSSNTVDIQT 202
             K  D +    S + NTVD+++
Sbjct: 171 -FKVIDTT--APSSADNTVDLRS 190

>Sklu_2366.3 , Contig c2366 5288-5944 reverse complement
          Length = 218

 Score =  147 bits (372), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 92/216 (42%), Positives = 133/216 (61%), Gaps = 26/216 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVK----IKDGNE--DVVI 56
           + KLVLLG+SSVGKSSIV RF    F     +TIGAAF ++T+     + +  E  D  I
Sbjct: 8   ELKLVLLGESSVGKSSIVTRFTTGNFHR-SNATIGAAFTTKTLSLESIVPETGETIDKKI 66

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE--- 113
           K EIWDTAGQERY+SLAPMYYRN + AL+V+DVT  DS+++AQSW+ EL   + + E   
Sbjct: 67  KLEIWDTAGQERYRSLAPMYYRNTDVALIVFDVTNKDSIARAQSWIDELNRYINEGEHEE 126

Query: 114 --LVIYLVGNKVDI-VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIG 170
             ++I +VGNK+D+  EA E+       +   Y Q Q   +  VSAKTG G+ ++F  I 
Sbjct: 127 RGILIKIVGNKIDLNPEARET-------QNLPYIQDQGYNWFPVSAKTGDGIDELFDTIV 179

Query: 171 EQLYSTK--KASLKNKDQSRRTDSVSSNTVDIQTQR 204
           +++   K  + +L+  ++ R   S+    VD+ +Q+
Sbjct: 180 KEIPWEKFTRQNLQKTNEIRPKKSI----VDLGSQK 211

>Scas_203.2
          Length = 251

 Score =  148 bits (374), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 78/179 (43%), Positives = 113/179 (63%), Gaps = 13/179 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
            + K VLLG+SSVG++SIV RF      + R   IGAAFL++ ++  D +    +  EIW
Sbjct: 46  CRLKFVLLGESSVGRTSIVTRFTTGKIPKKRMLPIGAAFLNKNIRWVDEDNIYEVDLEIW 105

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDE---ELVIYL 118
           DTAGQERY+SLAP+YYRN + AL+V+DVT  ++  KA+SWV EL++ + +E   E+ +YL
Sbjct: 106 DTAGQERYRSLAPIYYRNTDVALIVFDVTSSNTFQKARSWVDELRSYLDNEQGKEIQLYL 165

Query: 119 VGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTK 177
           +GNK D          +E E  A+ A      FKEVSAK   G++++F+EI   + + K
Sbjct: 166 IGNKCD----------LEHESIAKTAILDMCTFKEVSAKRDEGIQELFEEIARGIPTDK 214

>Sklu_2293.3 YLR262C, Contig c2293 4975-5619
          Length = 214

 Score =  144 bits (364), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 117/174 (67%), Gaps = 9/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 65

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      W+++++++ G+E +++ +VG
Sbjct: 66  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWIEDVKSERGEENVILCIVG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+V+     R++ TEEG   AQ     +F E S K G  VK++F++I + L
Sbjct: 126 NKNDLVD----ERQVSTEEGERKAQVLNAKIFMETSTKAGFNVKNLFKKIAKSL 175

>Kwal_56.22555
          Length = 212

 Score =  144 bits (363), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 121/180 (67%), Gaps = 9/180 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 10  LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 65

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      WV++++++ G+E +V+ +VG
Sbjct: 66  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           NK D+  +DE  R++ TEEG   AQ     +F E S K G  VK++F++I + L   +KA
Sbjct: 126 NKNDL--SDE--RQVSTEEGERKAQVLNAKIFIETSTKAGFNVKNLFRKIAKTLPEFQKA 181

>AEL187C [2319] [Homologous to ScYBR264C (YPT10) - SH]
           (284984..285610) [627 bp, 208 aa]
          Length = 208

 Score =  144 bits (362), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 80/183 (43%), Positives = 115/183 (62%), Gaps = 24/183 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK-------DGNED 53
             Q KLVLLG+SSVGKSSIV RF    F +  ++TIGAAF +++V+ +       D  E 
Sbjct: 6   CCQVKLVLLGESSVGKSSIVTRFTTGEFRK-NQATIGAAFTTRSVQWEEDAGDGSDAKEV 64

Query: 54  VVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGD-- 111
             + FEIWDTAGQERY+SLAPMYYRN + ALVVYDVT+  S   A+SW+ EL   +G+  
Sbjct: 65  RSVTFEIWDTAGQERYRSLAPMYYRNTDVALVVYDVTEQQSFQNARSWIDELNTYIGEAQ 124

Query: 112 -EELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIG 170
             ++V+ +VGNK+D+    +  + + +   A +          VSAKTG G++++F +I 
Sbjct: 125 RNDVVVRIVGNKIDLHAGGQLEQPLPS---ATF----------VSAKTGEGIEELFMDIA 171

Query: 171 EQL 173
           + +
Sbjct: 172 KHV 174

>YLR262C (YPT6) [3655] chr12 complement(668246..668893) GTP-binding
           protein involved in the secretory pathway, member of the
           rab family in the ras superfamily [648 bp, 215 aa]
          Length = 215

 Score =  144 bits (362), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 74/177 (41%), Positives = 119/177 (67%), Gaps = 15/177 (8%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 63

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R++  A++VYD+T+  S      W+++++N+ GDE +++ +VG
Sbjct: 64  WDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVG 123

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLL----FKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+  +DE  R+I TEEG + A   KLL    F E S K G  VK +F++I + L
Sbjct: 124 NKSDL--SDE--RQISTEEGEKKA---KLLGAKIFMETSTKAGYNVKALFKKIAKSL 173

>AGR257C [4568] [Homologous to ScYLR262C (YPT6) - SH]
           (1225886..1226548) [663 bp, 220 aa]
          Length = 220

 Score =  142 bits (359), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 125/215 (58%), Gaps = 13/215 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+TV +    +D  I+ ++WD
Sbjct: 12  KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTVYL----DDRTIRLQLWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
           TAGQER++SL P Y R+++ A+VVYD+T   S      WV++++N+ G+E L++ +VGNK
Sbjct: 68  TAGQERFRSLIPSYIRDSHVAIVVYDITNKKSFEYIDKWVEDVRNERGEENLILCIVGNK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKL-LFKEVSAKTGAGVKDIFQEIGEQL--YSTKKA 179
            D+V+     RK+  EEG   A+     +F E S K G  V  +F+ I + L  +   K 
Sbjct: 128 SDLVD----ERKVTVEEGENKAKLLNAKIFVETSTKAGFNVGALFKRIAKLLPEFQNGKG 183

Query: 180 S--LKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           +  L N D  +         +DI        D+S 
Sbjct: 184 TSGLGNGDAEKDGAGTRQGVIDISVPVAKGGDSSC 218

>KLLA0F01232g complement(114430..115062) similar to sp|P36019
           Saccharomyces cerevisiae YNL093w YPT53 GTP-binding
           protein of the RAB family (RAS superfamily), start by
           similarity
          Length = 210

 Score =  140 bits (353), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 112/174 (64%), Gaps = 20/174 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDV--VIKFEIWD 62
           KLVLLG+SSVGKS+IV RF    F  +   TIGAAF ++ ++  D  + +   + FEIWD
Sbjct: 11  KLVLLGESSVGKSTIVTRFTTGEF-HINSPTIGAAFSTKAMEWVDSEDGIKRRVNFEIWD 69

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGD---EELVIYLV 119
           TAGQERY+SLAPMYYRN + AL+V+DVTQ  S  KAQSW+ EL N + D   + + + +V
Sbjct: 70  TAGQERYRSLAPMYYRNTDVALIVFDVTQLASEKKAQSWIDELNNYLEDYKKDTVQLRVV 129

Query: 120 GNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           GNK+D+V+          EE  +     +L    VSAKTG G+ ++F +IG+ +
Sbjct: 130 GNKIDLVD----------EETLQNWNDAEL----VSAKTGEGIDELFLKIGKDI 169

>Scas_574.2
          Length = 222

 Score =  140 bits (353), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 117/174 (67%), Gaps = 9/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 8   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYL----DDKTIRLQL 63

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R++  A+VVYD+T+  S      W+++++N+ GD+ +++ +VG
Sbjct: 64  WDTAGQERFRSLIPSYIRDSRVAIVVYDITKKKSFEYIDKWIEDVKNERGDDNVILCIVG 123

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKL-LFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+  +DE  R++  EEG   A+     +F E S K G  VK++F++I + L
Sbjct: 124 NKSDL--SDE--RQVTIEEGENKAKILGADIFMETSTKAGYNVKNLFKKIAKSL 173

>CAGL0K06017g complement(586093..586752) highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c GTP-binding protein,
           start by similarity
          Length = 219

 Score =  138 bits (348), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 117/174 (67%), Gaps = 9/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 9   LTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL----DDKTIRLQL 64

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R++  A+VVYD+T+  S      W+++++N+ G E +++ +VG
Sbjct: 65  WDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDKWIEDVKNERGAENVILCVVG 124

Query: 121 NKVDIVEADESARKIETEEGAEYAQ-AQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+  ADE  R++  EEG + AQ     +F + S K G  VK++F++I + L
Sbjct: 125 NKSDL--ADE--RQVTAEEGEKKAQDLGAKIFMQTSTKVGYNVKNLFKKIAKSL 174

>KLLA0F20471g 1901749..1902387 highly similar to sp|Q99260
           Saccharomyces cerevisiae YLR262c YPT6 GTP-binding
           protein of the rab family, start by similarity
          Length = 212

 Score =  138 bits (348), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 114/174 (65%), Gaps = 9/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           + ++K+V LG+  VGK+S++ RF+ DTFD+  ++TIG  FLS+T+ +    +D  I+ ++
Sbjct: 9   LRKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIGIDFLSKTMYL----DDKTIRLQL 64

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WDTAGQER++SL P Y R+++ A+VVYDVT   S      W+++++ + G+E +++ +VG
Sbjct: 65  WDTAGQERFRSLIPSYIRDSHVAIVVYDVTNRKSFEYIDKWIEDVKMERGEENVILVIVG 124

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKL-LFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+VE     R++ TEEG   +      LF E S K G  VK +F++I + L
Sbjct: 125 NKSDLVE----ERQVSTEEGERKSTVLNAKLFIETSTKAGFNVKTLFKKIAKLL 174

>YER031C (YPT31) [1456] chr5 complement(214075..214746) GTP-binding
           protein required in the secretory pathway at the stage
           of formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily of small GTP-binding
           proteins [672 bp, 223 aa]
          Length = 223

 Score =  136 bits (342), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 105/173 (60%), Gaps = 9/173 (5%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           L FK+VL+GDS VGKS+++ RF K+ F+   +STIG  F ++T++I DG     IK +IW
Sbjct: 12  LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKR---IKAQIW 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           DTAGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+ + + L+GN
Sbjct: 68  DTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENA-DDNVAVGLIGN 126

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           K D+       R + TEE   +AQ  +LLF E SA     V   F+E+   +Y
Sbjct: 127 KSDLAH----LRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIY 175

>CAGL0K09394g complement(929234..929899) highly similar to sp|P51996
           Saccharomyces cerevisiae YGL210w YPT32 or sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 221

 Score =  135 bits (340), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 104/171 (60%), Gaps = 9/171 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++T+K+    ED  IK +IWDT
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTNEFNLESKSTIGVEFATRTIKV----EDKKIKAQIWDT 70

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQERY+++   YYR A  AL+VYD+++  +      W+ EL+    D+ + I L+GNK 
Sbjct: 71  AGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLTELKENA-DDNVAIGLIGNKS 129

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+    E  R + TEE   +A   +L F E SA     V   F+E+ EQ+Y
Sbjct: 130 DL----EHLRAVPTEEARGFASENQLFFTETSALNSENVDLAFRELIEQIY 176

>CAGL0I09306g complement(897087..897707) similar to sp|P38146
           Saccharomyces cerevisiae YBR264c GTP-binding protein,
           hypothetical start
          Length = 206

 Score =  134 bits (337), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 82/192 (42%), Positives = 121/192 (63%), Gaps = 23/192 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRE-STIGAAFLSQTVK-IKDGNEDVV-IKFEI 60
            K+VLLG+S+VGKS+IV RF    +  LR  +TIGAA++++ ++ I+DG  DV  ++ EI
Sbjct: 11  LKVVLLGESAVGKSAIVTRFSTGKY--LRNNATIGAAYVTKDLEYIRDG--DVYQVRLEI 66

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKV---GDEELVIY 117
           WDTAGQERY+SL PMYYRN + A+VV+DV+   SLS A  W+ EL   V   G E + I 
Sbjct: 67  WDTAGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLSMAHKWIDELNTYVENKGRERINIV 126

Query: 118 LVGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL---- 173
           LVGNK+D+            EE +   Q  +  F+ VSAK+G G++++F  I + +    
Sbjct: 127 LVGNKMDLC---------SDEERSTLPQRVEEQFQAVSAKSGEGIEELFDHIVKGIPSDQ 177

Query: 174 YSTKKASLKNKD 185
           ++ K A+++  D
Sbjct: 178 FTLKSAAVEQPD 189

>YBR264C (YPT10) [444] chr2 complement(737727..738326) Member of the
           rab family in the ras superfamily of small GTP-binding
           proteins [600 bp, 199 aa]
          Length = 199

 Score =  132 bits (333), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 74/158 (46%), Positives = 102/158 (64%), Gaps = 10/158 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIK--DGNEDVVIKFEIW 61
            K+VLLGDSSVGK+SIV R     F     +TIGAAF+++T+++   D + +  I  EIW
Sbjct: 5   IKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIHMEIW 64

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           DTAGQERYKSL PMYYR+AN AL+V+++    SL  A++W Q+LQ++    +++I  VGN
Sbjct: 65  DTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVII--VGN 122

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTG 159
           K D+V  + S       E    A+ Q L +  VSAKTG
Sbjct: 123 KYDLVCEEHSG------EVTIPAELQGLPYVAVSAKTG 154

>AER434C [2934] [Homologous to ScYGL210W (YPT32) - SH; ScYER031C
           (YPT31) - SH] (1466442..1467052,1467106..1467154) [660
           bp, 219 aa]
          Length = 219

 Score =  132 bits (332), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 102/171 (59%), Gaps = 9/171 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++T+++    E   +K +IWDT
Sbjct: 15  FKIVLIGDSGVGKSNLLSRFTTDEFNVNSKSTIGVEFATRTIEV----EGKKVKAQIWDT 70

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    DE + + L+GNK 
Sbjct: 71  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DENVAVGLIGNKS 129

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+       R + T+E   +AQ  ++LF E SA     V   F+E+   +Y
Sbjct: 130 DLAH----LRAVPTDEAKNFAQGNQMLFTETSALNAENVDLAFRELITAIY 176

>YGL210W (YPT32) [1786] chr7 (93795..94463) GTP-binding protein
           required in the secretory pathway at the stage of
           formation of trans-Golgi vesicles, member of the rab
           family in the ras superfamily [669 bp, 222 aa]
          Length = 222

 Score =  129 bits (323), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 100/166 (60%), Gaps = 9/166 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  D F+   +STIG  F ++T+++    E+  IK +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEV----ENKKIKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+ + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENA-DDNVAVGLIGNKS 128

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           D+       R + T+E   +A   ++LF E SA     V   F+E+
Sbjct: 129 DLAH----LRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFREL 170

>CAGL0C02453g 247493..248149 highly similar to sp|P38555
           Saccharomyces cerevisiae YER031c YPT31, start by
           similarity
          Length = 218

 Score =  128 bits (321), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 9/166 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++T+ + DG +   IK +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIDSKSTIGVEFATRTIDV-DGKK---IKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQERY+++   YYR A  AL+VYD+++  S      W+ EL+    D+ + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSSSYENCHHWLSELRENA-DDNVAVGLIGNKS 128

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           D+       R + TEE  ++A   +LLF E SA     V   F+E+
Sbjct: 129 DLAH----LRAVPTEEAKQFASENQLLFTETSALNSDNVDLAFKEL 170

>Scas_712.41
          Length = 219

 Score =  127 bits (319), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 102/171 (59%), Gaps = 9/171 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FK+VL+GDS VGKS+++ RF  + F+   +STIG  F ++T+++    E   IK +IWDT
Sbjct: 14  FKIVLIGDSGVGKSNLLSRFTTNEFNIESKSTIGVEFATRTIEV----EGKKIKAQIWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQERY+++   YYR A  AL+VYD+++  +      W++EL++   D+ + + L+GNK 
Sbjct: 70  AGQERYRAITSAYYRGAVGALIVYDISKSGTYENCNHWLKELRDNA-DDNVAVGLIGNKS 128

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+       R + T E   +A   +LLF E SA     V   F+E+   +Y
Sbjct: 129 DLAH----LRAVPTAEAKNFASENELLFTETSALNSENVDQAFRELITAIY 175

>CAGL0K12672g 1255541..1256161 highly similar to sp|P01123
           Saccharomyces cerevisiae YFL038c YPT1, start by
           similarity
          Length = 206

 Score =  121 bits (303), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 112/193 (58%), Gaps = 9/193 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR ++  ++VYDVT  +S +  + W+QE+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKN 183
           D+ +     R +E +   E+A+A K+ F E SA     V++ F  +  Q+  +      N
Sbjct: 124 DLAD----KRVVEYDVAKEFAEANKMPFLETSALDSTNVEEAFLTMARQIKESMTQQNMN 179

Query: 184 KDQSRRTDSVSSN 196
           + Q ++ D  + N
Sbjct: 180 ESQQKKNDKGNVN 192

>Scas_713.5
          Length = 211

 Score =  119 bits (299), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 102/170 (60%), Gaps = 9/170 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR ++  ++VYDVT  DS +  + W+QE+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQDSFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ +     R +E +   E+A A K+ F E SA     V++ F  +  Q+
Sbjct: 124 DLTD----KRVVEYDVAKEFADANKMPFLETSALNSTNVEEAFLTMARQI 169

>YFL038C (YPT1) [1645] chr6 complement(55365..55985) GTP-binding
           protein required for vesicle transport from ER to Golgi
           and within the Golgi stack, member of the rab family in
           the ras superfamily of GTP-binding proteins [621 bp, 206
           aa]
          Length = 206

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 102/170 (60%), Gaps = 9/170 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+G+S VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR ++  ++VYDVT  +S +  + W+QE+ ++     ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEI-DRYATSTVLKLLVGNKC 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+    +  R +E +   E+A A K+ F E SA     V+D F  +  Q+
Sbjct: 124 DL----KDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQI 169

>KLLA0D05313g 459496..460110 gi|10129780|emb|CAC08198.1
           Kluyveromyces lactis putative GTP-binding protein, start
           by similarity
          Length = 204

 Score =  118 bits (296), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 115/193 (59%), Gaps = 11/193 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A+  ++VYDVT  +S +  ++W+QE+ ++ G   ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRFGTAGVLKLLVGNKN 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKN 183
           D+ +     + ++TE   E+A +  + F E SA   + V++ F  + +Q+   +  + + 
Sbjct: 124 DLTD----KKVVDTEVAKEFADSIGIPFIETSALDSSNVEEAFLIMTKQI--KESVAKQQ 177

Query: 184 KDQSRRTDSVSSN 196
           KD  R  D  + N
Sbjct: 178 KDNGRAEDKSNVN 190

>Kwal_14.1116
          Length = 204

 Score =  118 bits (296), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 115/193 (59%), Gaps = 11/193 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A+  ++VYDVT  DS +  + W+QE+ ++     ++  +VGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDHDSFNDVKMWLQEI-DRYATAGVLKLMVGNKS 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKN 183
           D+    +  R +E +   E+A + ++ F E SA   + V++ F  + +Q+   +  + ++
Sbjct: 124 DL----QDKRMVEYDVAKEFADSLQIPFLETSALDSSNVEEAFLTMAKQI--KESMAQQH 177

Query: 184 KDQSRRTDSVSSN 196
           +D  ++ D  + N
Sbjct: 178 RDTGKKDDKANVN 190

>ACR003C [1051] [Homologous to ScYML001W (YPT7) - SH]
           (359762..360388) [627 bp, 208 aa]
          Length = 208

 Score =  118 bits (296), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 100/171 (58%), Gaps = 10/171 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V + DG  D V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DG--DKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENVKSWRDEFLVHANVPSPESFPFVILG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIG 170
           NK+D+   +ES + + T    E A++   + F   SAK    V D F+EI 
Sbjct: 126 NKIDV---EESKKVVTTRTSQELAKSLGNIPFFLTSAKNAINVDDAFEEIA 173

>KLLA0D01265g 110784..111407 highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 207

 Score =  116 bits (291), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 97/170 (57%), Gaps = 8/170 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V +   N+D V   ++WDT
Sbjct: 8   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVIV---NDDKVATMQVWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++ 
Sbjct: 65  AGQERFQSLGVAFYRGADCCVLVYDVTNGKSFDNVKSWRDEFLVHANVSSPETFPFVILA 124

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIG 170
           NKVD+ E+ +       +E A+      L F   SAK    V+D F+EI 
Sbjct: 125 NKVDVEESKKVVSSRSAQEQAKSLGNVPLFF--TSAKDSINVQDAFEEIA 172

>Scas_674.5
          Length = 208

 Score =  116 bits (290), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (56%), Gaps = 12/172 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V I D   D V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTIDD---DKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA--QKLLFKEVSAKTGAGVKDIFQEIG 170
           NKVDI   DE+ + +      E A++     LF   SAK    + + F+EI 
Sbjct: 126 NKVDI---DETKKVVSANAAQELAKSLGNTPLFM-TSAKDSINIDNAFEEIA 173

>CAGL0E02607g complement(248761..249387) highly similar to sp|P32939
           Saccharomyces cerevisiae YML001w YPT7 GTP-binding
           protein of the RAB family, start by similarity
          Length = 208

 Score =  115 bits (288), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 119/210 (56%), Gaps = 20/210 (9%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V + D   D V+  ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVVLDD---DKVVTMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWKDEFLVHANISSPESFPFVILG 125

Query: 121 NKVDIVEADESARKIETEE-GAEYAQA--QKLLFKEVSAKTGAGVKDIFQEIGEQLYSTK 177
           NKVDI    E ++K+ +E+ G E A++     LF   SAK+   V   F+EI       K
Sbjct: 126 NKVDI----EDSKKVVSEKAGQELAKSLGDVPLFL-TSAKSAINVDTAFEEIA------K 174

Query: 178 KASLKNKDQSRRTDSVSSNTVDIQTQRPST 207
            A  +N++ +   +   ++ ++IQ +  S 
Sbjct: 175 SALQQNQNDAHAFEDDFNDAINIQLEGESN 204

>Sklu_2144.3 YFL038C, Contig c2144 4079-4693
          Length = 204

 Score =  115 bits (287), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 103/170 (60%), Gaps = 9/170 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +TV + DG     +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVDL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A+  ++VYDVT  +S +  ++W+QE+ ++ G   ++  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKTWLQEI-DRYGTAGVLKLLVGNKN 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ +     + +E E   E+A + ++   E SA   + V++ F  +  Q+
Sbjct: 124 DLTD----KKVVEYEVAKEFADSLQIPVLETSALDSSNVEEAFLTMARQI 169

>ABR220W [814] [Homologous to ScYFL038C (YPT1) - SH]
           complement(817290..817904) [615 bp, 204 aa]
          Length = 204

 Score =  114 bits (286), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 111/188 (59%), Gaps = 13/188 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKL+L+GDS VGKS ++ RF  DT+     STIG  F  +TV++ DG     +K +IWDT
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDTYTNDYISTIGVDFKIKTVEL-DGK---TVKLQIWDT 64

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A+  ++VYDVT  +S    ++W+QE+ ++ G   +V  LVGNK 
Sbjct: 65  AGQERFRTITSSYYRGAHGIIIVYDVTDQESFDNMKTWLQEI-DRYGTAGVVKLLVGNKN 123

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF----QEIGEQLYSTKKA 179
           D+    +  + ++ E   E+A +  +   E SA   + V++ F    ++I E +   +K 
Sbjct: 124 DL----KDKKVVDFEVAREFADSLNIPVLETSALDSSNVEEAFLTMARQIKETMSHQQKE 179

Query: 180 SLKNKDQS 187
           S K  D+S
Sbjct: 180 SGKKDDKS 187

>Sklu_2373.3 YML001W, Contig c2373 10977-11603
          Length = 208

 Score =  114 bits (286), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 100/172 (58%), Gaps = 12/172 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V +   +ED V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV---DEDKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPESFPFVILG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA--QKLLFKEVSAKTGAGVKDIFQEIG 170
           NK+D+   +ES + + T    E A++     LF   SAK    V+  F+EI 
Sbjct: 126 NKIDV---EESKKVVNTRSAQELAKSLGNVPLFL-TSAKGSINVETAFEEIA 173

>Scas_656.2
          Length = 218

 Score =  113 bits (282), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 109/195 (55%), Gaps = 23/195 (11%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV++ F+    +TIG  F  +T+ I+ G +   IK ++WDT
Sbjct: 27  MKILLIGDSGVGKSCLLVRFVENKFNPSFITTIGIDFKIKTLDIQ-GRK---IKLQLWDT 82

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   +    + W   + N+  +E++ + LVGNK 
Sbjct: 83  AGQERFRTITTAYYRGAMGIILVYDVTDERTFQNIRQWYSTV-NEHANEQVQLLLVGNKS 141

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF-------------QEIG 170
           D+       R++  E+G E A+   L F E SAK    V D+F              E+G
Sbjct: 142 DL-----GNRQVTKEQGEELARELGLPFMEASAKNDDNVNDLFLQLAKLIQEKIDNDEMG 196

Query: 171 EQLYSTKKASLKNKD 185
           E   + K  ++K+KD
Sbjct: 197 EPRTAKKNVNIKSKD 211

>YML001W (YPT7) [3965] chr13 (267174..267800) GTP-binding protein
           with a role in protein transport between endosome-like
           compartments, member of the rab family in the ras
           superfamily [627 bp, 208 aa]
          Length = 208

 Score =  110 bits (276), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 98/171 (57%), Gaps = 10/171 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D + +  ++TIGA FL++ V + DG  D V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTV-DG--DKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIG 170
           NK+D   A+ES + +  +   E A++   +     SAK    V   F+EI 
Sbjct: 126 NKID---AEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIA 173

>Kwal_56.22440
          Length = 208

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 95/170 (55%), Gaps = 8/170 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LGDS VGK+S++HR+V D F +  ++TIGA FL++ V + DG  D V   ++WDT
Sbjct: 9   LKVIILGDSGVGKTSLMHRYVSDKFSQQYKATIGADFLTKEVSM-DG--DKVATMQVWDT 65

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLVG 120
           AGQER++SL   +YR A+  ++VYDVT   S    +SW  E     N    E     ++G
Sbjct: 66  AGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKSWRDEFLVHANVSSPETFPFVILG 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIG 170
           NK+D+ E+ +       ++ A+      L     SAK    V   F+EI 
Sbjct: 126 NKLDVEESKKVVSNRSAQDMAKSLGNIPLFL--TSAKGSINVDTAFEEIA 173

>Kwal_23.5058
          Length = 213

 Score =  109 bits (272), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 99/170 (58%), Gaps = 10/170 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +TV I +G +   +K ++WDT
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDI-NGKK---VKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   + +  + W   + N+  ++E  + LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFANVKQWFSTV-NQHANDEAQLLLVGNK- 134

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
               +D   R + T++G   A+   + F E SAK    V DIF ++ + +
Sbjct: 135 ----SDMDTRAVSTDQGESLAKELGIPFVEASAKDDTNVNDIFFQLAKLI 180

>Sklu_1815.2 YFL005W, Contig c1815 3148-3789 reverse complement
          Length = 213

 Score =  108 bits (271), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 106/193 (54%), Gaps = 14/193 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  +TV I +G +   IK ++WDT
Sbjct: 21  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKTVDI-NGKK---IKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   + S  + W+  +     DE  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFSNIKQWLSTVNQHANDEAQLL-LVGNK- 134

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF----QEIGEQLYSTKKA 179
               +D   R +  E+G   ++   L F E SAK    V +IF    + I E++ + K  
Sbjct: 135 ----SDMDTRAVTYEQGEALSKELGLPFVEASAKNDDNVNEIFFTLAKLIQEKIDNDKLV 190

Query: 180 SLKNKDQSRRTDS 192
              NKD S   +S
Sbjct: 191 GNTNKDGSVNINS 203

>KLLA0E12111g 1075299..1075943 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4 GTP-binding
           protein of the ras superfamily, start by similarity
          Length = 214

 Score =  107 bits (268), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++LLGDS VGKS ++ RFV+D F     +TIG  F  +TV I +G     +K ++WDT
Sbjct: 21  MKILLLGDSGVGKSCLLVRFVEDKFTPTFITTIGIDFKIKTVDI-NGKR---VKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   +++YDVT   +    + W   + N+   E++V+ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIVLIYDVTDERTFENIRQWFSTV-NQHASEDVVMLLVGNKK 135

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           D+       R +  E+G   A+   + F E SAK    V +IF
Sbjct: 136 DM-----DTRTVSYEQGEALAKELGIPFIEASAKDDTNVSEIF 173

>Scas_707.26
          Length = 210

 Score =  107 bits (268), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/184 (37%), Positives = 103/184 (55%), Gaps = 14/184 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +TV I +G +   +K ++WDT
Sbjct: 17  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI-NGKK---VKLQLWDT 72

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   + S  + W + +     DE  ++ LVGNK 
Sbjct: 73  AGQERFRTITTAYYRGAMGIILVYDVTDERTFSNVKQWFKTVNEHANDEAQLL-LVGNKS 131

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF----QEIGEQLYSTKKA 179
           D+       R +  E+G   A+   L F E SAK    V +IF    + I E++ S K A
Sbjct: 132 DM-----DTRVVTYEQGESLAKELGLPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLA 186

Query: 180 SLKN 183
              N
Sbjct: 187 GPGN 190

>CAGL0F02123g 212117..212764 highly similar to sp|P07560
           Saccharomyces cerevisiae YFL005w SEC4, start by
           similarity
          Length = 215

 Score =  106 bits (264), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (57%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +TV I +G +   +K ++WDT
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI-NGKK---VKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   + +  + W + +     DE  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFANIKQWFKTVNEHANDEAQLL-LVGNK- 134

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
               +D   R +  E+G   A+   L F E SAK    V +IF
Sbjct: 135 ----SDMDTRVVTYEQGEALAKELGLPFIESSAKNDDNVNEIF 173

>AGL021W [4290] [Homologous to ScYFL005W (SEC4) - SH]
           complement(681760..682398) [639 bp, 212 aa]
          Length = 212

 Score =  105 bits (261), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/163 (38%), Positives = 92/163 (56%), Gaps = 10/163 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F     +TIG  F  + V I +G +   IK ++WDT
Sbjct: 20  MKILLVGDSGVGKSCLLVRFVEDKFSPSFITTIGIDFKIKAVDI-NGKK---IKLQLWDT 75

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   +    + W   + N+  +EE  + LVGNK 
Sbjct: 76  AGQERFRTITTAYYRGAMGIILVYDVTDERTFENIRQWFTTV-NQHANEEAQLLLVGNKK 134

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           D+       R +  E+G   A+   + F E SAK    V DIF
Sbjct: 135 DM-----DTRAVTYEQGESLAKELGVPFIEASAKDDENVSDIF 172

>YFL005W (SEC4) [1676] chr6 (130329..130976) GTP-binding protein
           involved in vesicular transport between Golgi and plasma
           membrane, member of the rab family in the ras
           superfamily [648 bp, 215 aa]
          Length = 215

 Score =  104 bits (259), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 103/184 (55%), Gaps = 14/184 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K++L+GDS VGKS ++ RFV+D F+    +TIG  F  +TV I +G +   +K ++WDT
Sbjct: 21  MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDI-NGKK---VKLQLWDT 76

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQER++++   YYR A   ++VYDVT   + +  + W + +     DE  ++ LVGNK 
Sbjct: 77  AGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLL-LVGNK- 134

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF----QEIGEQLYSTKKA 179
               +D   R +  ++G   A+   + F E SAK    V +IF    + I E++ S K  
Sbjct: 135 ----SDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLV 190

Query: 180 SLKN 183
            + N
Sbjct: 191 GVGN 194

>Kwal_47.19055
          Length = 179

 Score =  102 bits (254), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 81/142 (57%), Gaps = 9/142 (6%)

Query: 33  ESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQP 92
           +STIG  F ++T+++    E   IK +IWDTAGQERY+++   YYR A  AL+VYD+++ 
Sbjct: 4   KSTIGVEFATRTIEV----EGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKS 59

Query: 93  DSLSKAQSWVQELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLLFK 152
            S      W+ EL+    DE + + L+GNK D+       R + T+E   +AQ  +LLF 
Sbjct: 60  SSYENCNHWLTELREN-ADENVAVGLIGNKSDLAH----LRAVPTDEAKNFAQENQLLFT 114

Query: 153 EVSAKTGAGVKDIFQEIGEQLY 174
           E SA     V   F+E+   +Y
Sbjct: 115 ETSALNSENVDQAFRELISAIY 136

>Sklu_1136.1 YGL210W, Contig c1136 1284-1832
          Length = 182

 Score =  102 bits (254), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (57%), Gaps = 9/142 (6%)

Query: 33  ESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQP 92
           +STIG  F ++T+++    E   IK +IWDTAGQERY+++   YYR A  AL+VYD+++ 
Sbjct: 4   KSTIGVEFATRTIEV----EGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKS 59

Query: 93  DSLSKAQSWVQELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLLFK 152
           +S      W+ EL+    DE + + L+GNK D+       R + T+E   +AQ  +LLF 
Sbjct: 60  NSYENCNHWLTELREN-ADENVAVGLIGNKSDLAH----LRAVPTDEAKNFAQENQLLFT 114

Query: 153 EVSAKTGAGVKDIFQEIGEQLY 174
           E SA     V   F+E+   +Y
Sbjct: 115 ETSALNSENVDLAFRELITAIY 136

>ABR182W [775] [Homologous to ScYPR165W (RHO1) - SH]
           complement(754517..755146) [630 bp, 209 aa]
          Length = 209

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 98/187 (52%), Gaps = 19/187 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V I DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLVVFSKGQFPEIHVPTVFENYVAD-VDI-DGRR---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQ-SWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + V  PDSL   Q  WV E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSVDLPDSLDNVQEKWVSEVLHFC--QGVPILLVGCKV 124

Query: 124 DI---------VEADESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+         ++A E  R +   EG+  A +   + + E SA+TG GVK++F       
Sbjct: 125 DLRNDPQVLQQLQA-EGQRPVTAAEGSAVAGKIGAVAYLECSARTGQGVKEVFDTATRAA 183

Query: 174 YSTKKAS 180
            S K A+
Sbjct: 184 LSGKPAA 190

>Scas_691.36
          Length = 212

 Score = 89.4 bits (220), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/174 (33%), Positives = 95/174 (54%), Gaps = 19/174 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VEV-DGRR---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKV 124

Query: 124 DI---------VEADESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQ 167
           D+         + ADE  + + T EG   A Q     + E SAKTG GV+++F+
Sbjct: 125 DLRNDPQAIEALRADEQ-QPVSTAEGQSVAEQIGATGYYECSAKTGLGVREVFE 177

>YPR165W (RHO1) [5580] chr16 (875362..875991) GTP-binding protein
           required to activate the PKC1 pathway and
           beta-1,3-glucan synthase and to coordinate exocyst
           assembly, member of the rho family of the ras
           superfamily [630 bp, 209 aa]
          Length = 209

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 103/193 (53%), Gaps = 24/193 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VEV-DGRR---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKV 124

Query: 124 DI------VEA--DESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+      +E    E  + + ++EG   A Q     + E SAKTG GV+++F+       
Sbjct: 125 DLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFE------- 177

Query: 175 STKKASLKNKDQS 187
           +  +ASL  K ++
Sbjct: 178 AATRASLMGKSKT 190

>Scas_610.4
          Length = 211

 Score = 87.8 bits (216), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 101/190 (53%), Gaps = 24/190 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VEV-DGRR---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKV 124

Query: 124 DI------VEA--DESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+      +EA  +E  + + + +G   A Q     + E SAKTG GV+++F+       
Sbjct: 125 DLRNDPQTIEALREEGQQPVSSADGQSVADQIGATGYYECSAKTGFGVREVFE------- 177

Query: 175 STKKASLKNK 184
              +ASL  K
Sbjct: 178 GATRASLMGK 187

>Kwal_55.21937
          Length = 208

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 104/196 (53%), Gaps = 24/196 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG +   ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VQV-DGRQ---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQ-SWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLDNVQEKWIAEVMHFC--QGVPIILVGCKV 124

Query: 124 DIVEADESARKIET--EEGAEYAQAQKL-------LFKEVSAKTGAGVKDIFQEIGEQLY 174
           D+ +  ++   +    ++     +AQ +        + E SAKTG GV+++F+       
Sbjct: 125 DLRDNPQTVEALRAIGQQPVTGPEAQSVADKIGASAYYECSAKTGYGVREVFE------- 177

Query: 175 STKKASLKNKDQSRRT 190
           +  +A+L  K  S++ 
Sbjct: 178 AATRAALSGKAMSKQA 193

>YLR293C (GSP1) [3684] chr12 complement(720773..721432) Ran, a
           GTP-binding protein of the ras superfamily involved in
           trafficking through nuclear pores [660 bp, 219 aa]
          Length = 219

 Score = 87.4 bits (215), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 87/170 (51%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +     G     IKF++WDT
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE----IKFDVWDT 68

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA  A++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 69  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 126

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 127 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>YOR185C (GSP2) [4981] chr15 complement(681444..682106) Ran, a
           GTP-binding protein member of the ras superfamily
           involved in trafficking through nuclear pores [663 bp,
           220 aa]
          Length = 220

 Score = 87.4 bits (215), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 87/170 (51%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +     G     IKF++WDT
Sbjct: 14  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGE----IKFDVWDT 69

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA  A++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 70  AGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 127

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 128 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 171

>Sklu_1816.1 YNL090W, Contig c1816 115-681
          Length = 188

 Score = 85.5 bits (210), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 101/195 (51%), Gaps = 20/195 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++      DG   + ++  +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEEYHPTVFENYVTDCRV--DG---IKVQLALWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L P  Y  AN  L+ + +  P+SL  A++ W +E         +V  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKANIILIGFAIDDPESLMNARTKWTEEALRYCPTAPIV--LVGLKK 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLL----FKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           D+ ++  +  ++ T E AE  Q  + +    + E SA TG GV DIF+       +T+ +
Sbjct: 122 DLRKSVGNGEEVVTREAAE--QVARAIGAKRYMECSALTGEGVDDIFE------VATRTS 173

Query: 180 SLKNKDQSRRTDSVS 194
            L NK+  +   ++S
Sbjct: 174 LLVNKEPGQGCCTIS 188

>CAGL0I00594g 44835..45479 highly similar to sp|P32835 Saccharomyces
           cerevisiae YLR293c GSP1, start by similarity
          Length = 214

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFHTNFGE----IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Sklu_2151.3 YPR165W, Contig c2151 2495-3124 reverse complement
          Length = 209

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 100/190 (52%), Gaps = 24/190 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++  V++ DG     ++  +WDTA
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVAD-VEV-DGRR---VELALWDTA 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+ +    + + I LVG KV
Sbjct: 69  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGCKV 126

Query: 124 DIVEADESARKIET--EEGAEYAQAQKLL-------FKEVSAKTGAGVKDIFQEIGEQLY 174
           D+    +    + T  +E    A AQ++        + E SAKTG GV+++F+       
Sbjct: 127 DLRNDPQVVESLRTNGQEPVSQASAQEVADQIGAVEYIECSAKTGFGVREVFE------- 179

Query: 175 STKKASLKNK 184
           +  +ASL  K
Sbjct: 180 AATRASLMGK 189

>KLLA0C05126g complement(463657..464301) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE----IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>KLLA0A04499g complement(404732..405376) highly similar to sp|P32836
           Saccharomyces cerevisiae YOR185c GSP2 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 214

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE----IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>AGR294C [4605] [Homologous to ScYOR185C (GSP2) - SH; ScYLR293C
           (GSP1) - SH] (1287042..1287686) [645 bp, 214 aa]
          Length = 214

 Score = 85.5 bits (210), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE----IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>CAGL0I08459g 829292..829924 highly similar to sp|P06780
           Saccharomyces cerevisiae YPR165w RHO1, start by
           similarity
          Length = 210

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 92/173 (53%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVAD-VEV-DGRR---VELALWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQ-SWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL   Q  W+ E+ +    + + I LVG KV
Sbjct: 67  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFC--QGVPIILVGCKV 124

Query: 124 DIVEAD--------ESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQ 167
           D+            E  + + T +G   A Q     + E SAKTG GV+++F+
Sbjct: 125 DLRNDPQTLEQLRAEGLQPVATADGQNVADQIGATGYYECSAKTGYGVREVFE 177

>Sklu_2285.4 YLR293C, Contig c2285 4349-4993 reverse complement
          Length = 214

 Score = 85.1 bits (209), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     IKF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTNFGE----IKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>Scas_586.6
          Length = 219

 Score = 84.7 bits (208), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG      +     G     IKF+ WDT
Sbjct: 13  FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFFTNYGE----IKFDCWDT 68

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 69  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 126

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 127 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 170

>Sklu_2151.4 , Contig c2151 3640-4263 reverse complement
          Length = 207

 Score = 84.0 bits (206), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 93/173 (53%), Gaps = 17/173 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F E+   T+   +++  V++ DG     ++  +WDTA
Sbjct: 12  KLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVTD-VEV-DGRH---VELTLWDTA 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQ-SWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P  Y ++N  L+ + +  PDSL   Q  W+ E+      + + I LVG KV
Sbjct: 67  GQEDYDRLRPFSYPDSNVVLICFSIDLPDSLDNVQEKWINEVLYFC--KGVPIILVGCKV 124

Query: 124 DIVEADESA--------RKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQ 167
           D+ +  ++         R + T +G   A +   + + E SAK+G GV+++F+
Sbjct: 125 DLRDDTQTIETLKAIGQRPVSTTDGQTVADRIGAVGYYECSAKSGLGVREVFE 177

>KLLA0B10626g 936497..937123 gi|22858698|gb|AAN05733.1 Kluyveromyces
           lactis RHO1, start by similarity
          Length = 208

 Score = 84.0 bits (206), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 100/190 (52%), Gaps = 24/190 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++  V++ DG     ++  +WDTA
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVAD-VEV-DGRR---VELALWDTA 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+ +    + + I LVG K 
Sbjct: 69  GQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGCKA 126

Query: 124 DIVEADESARKIETE--EGAEYAQAQKLL-------FKEVSAKTGAGVKDIFQEIGEQLY 174
           D+    +   ++  +  +    AQAQ++        + E SAKTG GV+++F+       
Sbjct: 127 DLRNDPQVVEELRAQGLQPVSQAQAQEVADQIGAVDYIECSAKTGYGVREVFE------- 179

Query: 175 STKKASLKNK 184
           +  +ASL  K
Sbjct: 180 AATRASLVGK 189

>Kwal_56.23361
          Length = 214

 Score = 84.0 bits (206), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           FKLVL+GD   GK++ V R +   F++   +TIG            G     +KF++WDT
Sbjct: 8   FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLAFYTDFGE----LKFDVWDT 63

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
           AGQE++  L   YY NA   ++++DVT   +     +W ++L      E + I L GNKV
Sbjct: 64  AGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWHRDLVRVC--ENIPIVLCGNKV 121

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ E    A+ I       + + + L + ++SAK+    +  F  +  +L
Sbjct: 122 DVKERKVKAKTI------TFHRKKNLQYYDISAKSNYNFEKPFLWLARKL 165

>ABR183W [776] [Homologous to ScYPR165W (RHO1) - SH]
           complement(755914..756537) [624 bp, 207 aa]
          Length = 207

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 100/190 (52%), Gaps = 24/190 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++  V++ DG     ++  +WDTA
Sbjct: 13  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVAD-VEV-DGRR---VELALWDTA 67

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ Y +  PDSL    + W+ E+      + + I LVG K 
Sbjct: 68  GQEDYDRLRPLSYPDSNVVLICYSIDLPDSLENVMEKWISEVLYFC--QGVPIILVGCKA 125

Query: 124 DIVEADESARKI--ETEEGAEYAQAQKLL-------FKEVSAKTGAGVKDIFQEIGEQLY 174
           D+    +   ++  + ++    AQAQ++        + E SAKTG GV+++F+       
Sbjct: 126 DLRNDPQVIEQLRQQGQQPVSQAQAQEVADQIGAVEYIECSAKTGFGVREVFE------- 178

Query: 175 STKKASLKNK 184
           +  +ASL  K
Sbjct: 179 AATRASLMGK 188

>Kwal_55.21941
          Length = 209

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 98/192 (51%), Gaps = 28/192 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+ ++  F K  F ++   T+   +++  V++ DG     ++  +WDTA
Sbjct: 14  KLVIVGDGACGKTCLLIVFAKGKFPQVYVPTVFDNYVAD-VEV-DGRR---VELALWDTA 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y  L P+ Y ++N  L+ + +  PDSL    + W+ E+ +    + + I LVG KV
Sbjct: 69  GQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVMEKWISEVLHFC--QGVPIILVGCKV 126

Query: 124 DI-----------VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQ 172
           D+               E   +   +E AE  Q   + + E SAKTG GV+++F+     
Sbjct: 127 DLRNDSQVIENLRANGHEPVSQGAAQEVAE--QIGAVEYIECSAKTGYGVREVFE----- 179

Query: 173 LYSTKKASLKNK 184
             +  +ASL  K
Sbjct: 180 --AATRASLMGK 189

>ACL087C [962] [Homologous to ScYNL090W (RHO2) - SH]
           (191573..192136) [564 bp, 187 aa]
          Length = 187

 Score = 81.6 bits (200), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 19/194 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S++H F    F E    T+   +++      DG   + ++  +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLHVFTLGKFPEEYLPTVFENYVTDCRV--DG---IKVQLALWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L PM Y  A+  L+ + +  P SLS A + W  E      +  ++  LVG K 
Sbjct: 64  GQEEYERLRPMSYSKADIILIGFAIDDPGSLSNAREKWTVEALRYCPNAPII--LVGLKK 121

Query: 124 DIVEADESARKIETEEGAEYAQ---AQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           D+         +   +  E  +   A+K  + E SA TG GV D+F+       +T+ + 
Sbjct: 122 DLRRPGTQCAMVAPSQAQEVVRAIGAKK--YMECSALTGEGVDDVFE------LATRTSL 173

Query: 181 LKNKDQSRRTDSVS 194
           L NK+  +    +S
Sbjct: 174 LVNKEPGQGCCIIS 187

>KLLA0D08327g 708240..709004 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 254

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 96/192 (50%), Gaps = 26/192 (13%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDG----NEDVVI 56
           M   K V++GD +VGK+S++  +  +TF +    T+   + S T+ + D     +E  + 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALPDPYNPDSEPQIF 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELV 115
           K  +WDTAGQE Y  L P+ Y   +  L+ + V +P+S       W  E+++    E L 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSVNEPNSFENVYDKWFPEIKHSTNFENLD 119

Query: 116 IY---------LVGNKVDIVEADESARKIETEEGAEYA---QAQKLLFK-------EVSA 156
           +Y         LVG K D+ + D    +++ E  +++    Q Q+L+ K       E SA
Sbjct: 120 LYHQSGKLPILLVGTKADLRDDDHERDRLQ-ESNSDFVSQQQIQELVNKLGLMGYVECSA 178

Query: 157 KTGAGVKDIFQE 168
            T  GV+++F++
Sbjct: 179 ATQVGVREVFEK 190

>AER132W [2636] [Homologous to ScYML064C (TEM1) - SH]
           complement(888052..888750) [699 bp, 232 aa]
          Length = 232

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 93/169 (55%), Gaps = 7/169 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L +  KI  G+ DV+  F I 
Sbjct: 14  VKIKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLER--KINLGSTDVI--FSIM 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           D  GQ  + ++ P+    A A + ++D+T+P++L+  + W +  Q +  +E  +  LVG 
Sbjct: 70  DLGGQREFINMLPLVSNRAVAIIFLFDLTRPETLTSIREWYR--QARGFNETAIPLLVGT 127

Query: 122 KVDI-VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           K D+ V  D + ++  ++    YAQ         S  +   V+ IF+ I
Sbjct: 128 KYDLFVNLDVAYQEELSKTSMRYAQVMGAPLVFCSTASSINVQKIFKVI 176

>Kwal_47.16983
          Length = 223

 Score = 80.5 bits (197), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 97/179 (54%), Gaps = 8/179 (4%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+ L+GD+ VGK+S++ ++V++ FDE    T+G   LS+  KI  G+ +++  F I D 
Sbjct: 19  LKIGLIGDAQVGKTSLMVKYVENVFDEEYTQTLGVNCLSK--KITLGSAEIL--FYIMDL 74

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
            GQ  + ++ P+    A A + ++D+T+P++L   + W +  Q    +E+ V  LVG K 
Sbjct: 75  GGQREFINMLPLASEGAKAIIFLFDLTRPETLKSIKEWHR--QATGFNEQAVPLLVGTKY 132

Query: 124 DI-VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYS-TKKAS 180
           D+ V  D   +   +++   YAQA        S      V+ IF+ +  +LY+ T +AS
Sbjct: 133 DLFVNLDPEYQAQISKQSMRYAQAMDAPLIFCSTSHSINVQKIFKIVIAKLYNLTMRAS 191

>Kwal_33.14452
          Length = 260

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 108/224 (48%), Gaps = 27/224 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGN--EDVVIKF 58
           M   K V++GD +VGK+S++  +  +TF +    T+   + + T+ + DG+  E  V + 
Sbjct: 1   MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-TTTIALNDGDSAEPQVFRL 59

Query: 59  EIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIY 117
            +WDTAGQE Y  L P+ Y   +  L+ + + +P+S    +  W  E+++    E L ++
Sbjct: 60  NLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFENVKDKWFPEIRHNTNYENLELF 119

Query: 118 ---------LVGNKVDIVEADESARKIETEEGAEY----------AQAQKLLFKEVSAKT 158
                    LVG K D+ + DE  +    E  +++          +Q   + + E SA T
Sbjct: 120 RVCGKYPILLVGTKADLRD-DEHEQDRLAEVNSDFVSRGDIDQCVSQCGLMGYVECSAAT 178

Query: 159 GAGVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDIQT 202
             GV D+F+     + S  +  L    QS++  + + + +D Q+
Sbjct: 179 QVGVADVFERAVRCVVSEPERLLG---QSKQRTNAADHFIDPQS 219

>Sklu_1653.3 YML064C, Contig c1653 2277-3047
          Length = 256

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 92/169 (54%), Gaps = 7/169 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L +  KI  G+ DVV  F I 
Sbjct: 58  VKVKIGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLER--KIALGSTDVV--FSIM 113

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           D  GQ  + ++ P+    A + + ++D+T+P++LS  + W +  Q +  +E  +  LVG 
Sbjct: 114 DLGGQREFINMLPLVSEGAVSIIFLFDLTRPETLSSIKEWYR--QARGFNETAIALLVGT 171

Query: 122 KVDI-VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           K D+ +  D   ++  +    +YAQA        S      ++ IF+ I
Sbjct: 172 KYDLFITMDSEYQEQISRTSMKYAQAMDSPLVFCSTSNSINIQKIFKVI 220

>Kwal_33.14015
          Length = 271

 Score = 80.5 bits (197), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 95/194 (48%), Gaps = 13/194 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
             K+V++GD +VGK+ ++  + +  F E     I   F +   K+K G ++ V++  +WD
Sbjct: 65  HLKIVVVGDGAVGKTCLLISYTQGHFPE---EYIPTVFENYVTKMK-GPDNTVVELALWD 120

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGN 121
           TAGQE Y  L P+ Y + +  +V Y V    SL   Q  W+ E+++   D    I LVG 
Sbjct: 121 TAGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLLNVQELWIPEVRHFCPDTP--ILLVGL 178

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQ-EIGEQLYST--- 176
           K D+   D   + ++  E   +A    LL   + S+K+   V+++F   +   LY     
Sbjct: 179 KSDLYALDNLDKLVDPGEADLFATEHNLLGHYQCSSKSRQNVEELFNVAMATLLYDPVQE 238

Query: 177 -KKASLKNKDQSRR 189
            K+ S+ N    RR
Sbjct: 239 RKRISVANIFGPRR 252

>KLLA0C13816g 1183412..1183975 highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2 GTP-binding
           protein of the RHO subfamily of RAS-like proteins, start
           by similarity
          Length = 187

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 94/182 (51%), Gaps = 15/182 (8%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++      DG   + ++  +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGQFPEEYHPTVFENYVTDCRV--DG---IKVQLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L P  Y  A+  L+ + +  P+SL  A++ W +E+     +  +V  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAIDDPESLVNARNKWSEEVLRYCPEAPVV--LVGLKK 121

Query: 124 DIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLK 182
           D+   D   + +  E+  + A+A     + E SA TG  V D+F+       +T+ + L 
Sbjct: 122 DLRSPDNEHQMVTREQAEQVARAIGAKKYMECSALTGENVDDVFE------VATRTSLLV 175

Query: 183 NK 184
           NK
Sbjct: 176 NK 177

>CAGL0J05632g complement(537342..537908) highly similar to sp|P06781
           Saccharomyces cerevisiae YNL090w RHO2, start by
           similarity
          Length = 188

 Score = 78.6 bits (192), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 99/195 (50%), Gaps = 20/195 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++      DG   + +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRV--DG---IKVSLALWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L P  Y  A+  L+ + V   +SL  A++ W +E      D  ++  LVG K 
Sbjct: 64  GQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEEAFRYCPDAPVI--LVGLKE 121

Query: 124 DIVEADESA----RKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           D+ ++ +       + + E+ A+   A+K L  E SA TG GV D+F+       +T+ +
Sbjct: 122 DLRKSKQEGIVFVNREDAEQVAKAIGAKKYL--ECSALTGEGVDDVFE------LATRSS 173

Query: 180 SLKNKDQSRRTDSVS 194
            L +K+      S+S
Sbjct: 174 LLMHKEPDHFCCSIS 188

>Scas_578.7
          Length = 187

 Score = 78.2 bits (191), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 99/194 (51%), Gaps = 19/194 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S+++ F    F +    T+   +++      DG   + +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPQEYHPTVFENYVTDCRV--DG---IKVSLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L P  Y  A+  L+ + +   +SL  A++ W +E        E  I LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAINDTESLDNARNKWTEEALRYC--PEAPIILVGLKK 121

Query: 124 DIVEADESARKIETEEGAEYAQ---AQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKAS 180
           D+ +  +    ++ E+  + A+   A+K  + E SA TG GV D+F+       +T+ + 
Sbjct: 122 DLRQKQDGVEMVKPEDAQQVARIIGAKK--YVECSALTGEGVDDVFE------LATRTSL 173

Query: 181 LKNKDQSRRTDSVS 194
           L NK+  +   +VS
Sbjct: 174 LVNKEPGQTCCTVS 187

>KLLA0B05038g complement(457608..458279) similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, start by similarity
          Length = 223

 Score = 79.0 bits (193), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 95/169 (56%), Gaps = 7/169 (4%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+ L+GD+ VGK+S++ ++V++ FDE    T+G  +L + V +  G+ DV+  F I 
Sbjct: 15  VKVKVGLIGDAQVGKTSLMVKYVQNVFDEEYTQTLGVHYLERKVVL--GSTDVI--FSIM 70

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           D  GQ  + ++ P+    A A + ++D+T+P++L+  + W +  Q +  ++  +  LVG 
Sbjct: 71  DLGGQREFINMLPLVSEGAVAIVFLFDLTRPETLNSIKEWYR--QARGFNDTAISILVGT 128

Query: 122 KVDI-VEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           K D+ V+ D   ++  +    +YAQ  K      S ++   V+ IF+ +
Sbjct: 129 KYDLFVDMDPEYQENVSRTAMKYAQVMKSPLIFCSTQSSINVQKIFKVV 177

>YKR055W (RHO4) [3306] chr11 (547858..548733) GTP-binding protein,
           member of the rho family in the ras superfamily [876 bp,
           291 aa]
          Length = 291

 Score = 80.1 bits (196), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 103/216 (47%), Gaps = 20/216 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
             K+V++GD +VGK+ ++  +V+ TF      TI   +++      +G    +I+  +WD
Sbjct: 72  HLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNI----EGPNGQIIELALWD 127

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGN 121
           TAGQE Y  L P+ Y NA+  +V Y V    SL   +  W  E+++        I LVG 
Sbjct: 128 TAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTP--IMLVGL 185

Query: 122 KVDIVEADESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIFQE-----IGEQLYS 175
           K D+ EAD  +  +E       A +       + SA+    + ++F+      + + LY+
Sbjct: 186 KSDLYEADNLSDLVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDSLYA 245

Query: 176 TKKASLKNKDQSRRTDSVSSNTVDIQTQRPSTNDTS 211
            ++ +   K+  +R  + S    DI +   ST DTS
Sbjct: 246 PREPTHTIKNPFKRNTTRS----DIDS---STGDTS 274

>Scas_677.20
          Length = 283

 Score = 77.4 bits (189), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 104/219 (47%), Gaps = 27/219 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKI----KDGNEDVVI 56
           M   K  ++GD  VGK+ ++  +  +TF      T+   + S T+ +    K   E    
Sbjct: 1   MRSIKCTVIGDGCVGKTCLLISYTTNTFPNEYVPTVFDNY-STTITLPPVGKGKEEPEYY 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELV 115
           K  +WDTAGQ+ Y +L P+ Y   +  ++ + V    SL   +S WV E++N   ++EL 
Sbjct: 60  KLNLWDTAGQDDYDTLRPLSYPQTDIFIICFAVNDLVSLDNVKSKWVPEIKNSFNEDELK 119

Query: 116 IY---------LVGNKVDIVEADESARKIETEEGAEYA--QAQKLLFKEVSAKTGAGVKD 164
           ++         LVG K D    DE   K  T E  +    Q   + + E SA +  G+KD
Sbjct: 120 VFQSRNRFPMLLVGTKADTRYDDEIDGKFATNETIQSVVDQCGFVGYVECSALSQMGIKD 179

Query: 165 IFQE------IGEQLYSTKKASLKNKDQSRRTDSVSSNT 197
           +F+E       G+ + + ++ ++     +++T + S+NT
Sbjct: 180 VFEEAVKAVVYGDGIETPERGAM----AAQKTRTTSTNT 214

>Scas_547.3
          Length = 223

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 93/169 (55%), Gaps = 11/169 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           +Q ++ L+GD+ VGK+S++ ++ ++ FDE    T+G   L + V+IK  N    I F + 
Sbjct: 23  IQIQVGLVGDAQVGKTSLMVKYAQNGFDEEYTQTLGVNLLKRKVRIKSSN----IVFSLM 78

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           D  GQ+ + ++ P+   N++  + ++D+T+P+SL   ++W   +Q    + + V  LVG 
Sbjct: 79  DLGGQKEFINMLPIASVNSSVIIFLFDLTRPESLESIKNWY--MQAHGLNHDAVCILVGT 136

Query: 122 KVDI-VEADESARKIETEEGAEYAQAQ--KLLFKEVSAKTGAGVKDIFQ 167
           K D+ ++     ++  +    +YAQA    L+F   S+     ++ IF+
Sbjct: 137 KYDLFIDLPTEYQEQISRTSMKYAQAMDSPLIFS--SSIASINIQKIFK 183

>Scas_444.4*
          Length = 289

 Score = 75.5 bits (184), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 88/170 (51%), Gaps = 13/170 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
              K+V++GD  VGK+ ++  +V+  F      T+   +++      +G +  V++  +W
Sbjct: 62  FHVKIVIVGDEGVGKTCLLISYVQREFPTGDIPTVFENYVTDF----EGPDGEVVELALW 117

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLVG 120
           DTA QE Y  L P+ Y + +  LV Y V  P SL    +SW+ E+++      ++  LVG
Sbjct: 118 DTAAQEDYNRLRPLSYTDVDILLVCYSVANPTSLKNIKRSWIPEVKHFCYKTPVI--LVG 175

Query: 121 NKVDIVEADESARKI----ETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
            K D+ +++E+   +    E E+ AE   A  L   + SAKT   V+D+F
Sbjct: 176 LKSDLYDSNENTDTLVDPKEAEQLAEKLGA--LAHLQCSAKTRQNVEDVF 223

>Scas_575.10
          Length = 271

 Score = 73.9 bits (180), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 92/174 (52%), Gaps = 10/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I    ++ V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGIYLDTYDPTIEDSY-RKTIEI----DNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y ++    L+VY VT P SL +     +++      + + + LVG
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDPQSLDELMELREQVLRIKDTDRVPMVLVG 115

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+ E     R I  EEG E +    K+ F E SA   + V ++F ++  Q+
Sbjct: 116 NKADLTE----DRVISVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVDLVRQI 165

>Sklu_2007.2 YNL180C, Contig c2007 789-1574 reverse complement
          Length = 261

 Score = 73.6 bits (179), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 27/209 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGN----EDVVI 56
           M   K V++GD +VGK+S++  +  +TF +    T+   + S T+ + D +    E  V 
Sbjct: 1   MRSIKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTIALADPSDLSAEQEVF 59

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELV 115
           K  +WDTAGQE Y  L P+ Y   +  ++ + V +P S       W  E+++    E + 
Sbjct: 60  KLNLWDTAGQEEYDRLRPLSYPQTDIFIICFSVNEPSSFENVIDKWFPEIRHNTNYENME 119

Query: 116 IY---------LVGNKVDIVEADESARKIETEEGAEYAQAQK----------LLFKEVSA 156
           ++         LVG K D+ E +    ++  E  +++    +          + + E SA
Sbjct: 120 LFSSCGKFPILLVGTKADLREDEHELDRLR-ELNSDFVDRHEIDHAVSKCGFMGYVECSA 178

Query: 157 KTGAGVKDIFQEIGEQ-LYSTKKASLKNK 184
            T  GV+++F+   E  +Y   +   +NK
Sbjct: 179 ATQFGVREVFERAVECVVYEPDRLLNRNK 207

>Scas_417.3
          Length = 291

 Score = 73.2 bits (178), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 107/231 (46%), Gaps = 42/231 (18%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKD--------GNE 52
           M Q K V++GD +VGK+S++  +  +TF +    T+   + S T+ ++D         NE
Sbjct: 1   MRQIKTVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNY-STTISLRDPFLSRESLANE 59

Query: 53  DV-----VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSK-AQSWVQELQ 106
           +      + K  +WDTAGQE Y  L P+ Y   +  L+ + V +  S       W+ E++
Sbjct: 60  NENDHLELFKLNLWDTAGQEEYDRLRPLSYPQTDVFLICFSVAELSSFENVVDKWLPEIK 119

Query: 107 NKVGDE---------ELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQK--------- 148
                E         +L I L+G K D+ + DE+ +K   E  +++    +         
Sbjct: 120 QNANVESSELFLQFGKLPIMLIGTKADLRD-DEAVQKKLQETNSQFITRDQIDQVVDKYG 178

Query: 149 -LLFKEVSAKTGAGVKDIFQEI-------GEQLYSTKKASLKNKDQSRRTD 191
            L + E SA T  GV+++F++         E+L  T++   K  ++ +R D
Sbjct: 179 FLGYVECSAATQMGVREVFEKAVQYVVFEPERLRRTERVKAKELEEQKRKD 229

>CAGL0E03113g complement(289164..290135) some similarities with
           sp|P13856 Saccharomyces cerevisiae YGR152c RSR1
           GTP-binding protein, start by similarity
          Length = 323

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 93/174 (53%), Gaps = 10/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKSS+  +FV+  + +  + TI  ++  +T++I    ++ V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSSLTVQFVQGVYLDTYDPTIEDSY-RKTIEI----DNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y +     L+VY VT  DSL +     +++      + + + LVG
Sbjct: 56  LDTAGVAQFTAMRELYIKAGMGFLLVYSVTDRDSLRELMELKEQVLRIKDSQRVPMVLVG 115

Query: 121 NKVDIVEADESARKIETEEG-AEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+V+     R I  EEG    +Q  K+ F E SA   + V ++F ++  Q+
Sbjct: 116 NKADLVD----DRIIPVEEGIGVSSQWGKVPFYETSALLRSNVDEVFVDLVRQI 165

>ABL139C [453] [Homologous to ScYNL180C (RHO5) - SH]
           (134875..135759) [885 bp, 294 aa]
          Length = 294

 Score = 72.8 bits (177), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 90/190 (47%), Gaps = 24/190 (12%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDG----NEDVVI 56
           M   K V++GD +VGK+S++  +  ++F +    T+   + S T+ ++D      E  + 
Sbjct: 17  MRSIKCVVIGDGAVGKTSLLISYTTNSFPQDYIPTVFDNY-STTIAVQDPASSTGEQQLF 75

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELV 115
           K  +WDTAGQE Y  L P+ Y   +  L+ + + +P S    +  W  E+++    E + 
Sbjct: 76  KLNLWDTAGQEEYDRLRPLSYPQTDIFLICFSINEPVSFQNIRDKWFPEIKHNTNYENME 135

Query: 116 IY---------LVGNKVDIVEADESARKIETEEGAEYAQAQK---------LLFKEVSAK 157
           ++         LVG K D+ + D    ++        +QA+          + + E SA 
Sbjct: 136 LFLECGKYPILLVGTKADLRDDDHEEDRLREMNTDFVSQAEIERVVQDCGFMGYVECSAA 195

Query: 158 TGAGVKDIFQ 167
           T  GV+++F+
Sbjct: 196 TQEGVREVFE 205

>AGL093W [4218] [Homologous to ScYLR229C (CDC42) - SH]
           complement(532002..532577) [576 bp, 191 aa]
          Length = 191

 Score = 70.9 bits (172), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 85/178 (47%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V++GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVVSPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKVDIVEAD--------ESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G ++D+ E          +  R I  E+G ++A+  + + + E SA T  G+K++F E
Sbjct: 114 GTQIDLRENKMVIEKLQRQRLRPITPEQGEKFARELRAVKYVECSALTQRGLKNVFDE 171

>YNL090W (RHO2) [4501] chr14 (456565..457143) GTP-binding protein,
           member of the rho family in the ras superfamily [579 bp,
           192 aa]
          Length = 192

 Score = 70.9 bits (172), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 85/172 (49%), Gaps = 18/172 (10%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KLV++GD + GK+S+++ F    F E    T+   +++      DG   + +   +WDTA
Sbjct: 9   KLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRV--DG---IKVSLTLWDTA 63

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE Y+ L P  Y  A+  L+ + V   +SL  A++ W  E      D  +V  LVG K 
Sbjct: 64  GQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIV--LVGLKK 121

Query: 124 DIVE--------ADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQ 167
           D+ +         DE     + ++ A    A+K  + E SA TG GV D+F+
Sbjct: 122 DLRQEAHFKENATDEMVPIEDAKQVARAIGAKK--YMECSALTGEGVDDVFE 171

>CAGL0L11242g 1197075..1197839 highly similar to sp|P38987
           Saccharomyces cerevisiae YML064c TEM1 GTP-binding
           protein of the RAS superfamily, hypothetical start
          Length = 254

 Score = 72.0 bits (175), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 90/161 (55%), Gaps = 7/161 (4%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQE 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + V I+  + D+V  F + D  GQ 
Sbjct: 33  LIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIR--STDIV--FSLMDLGGQR 88

Query: 68  RYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDI-V 126
            + ++ P+    ++  ++++D+T+P++L+  + W ++    + D  + I LVG K D+ +
Sbjct: 89  EFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALG-LNDSAIPI-LVGTKYDLFI 146

Query: 127 EADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQ 167
           + +E  ++  ++   +YAQ         S      ++ IF+
Sbjct: 147 DLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFK 187

>ACR257C [1304] [Homologous to ScYKR055W (RHO4) - SH]
           (808667..809446) [780 bp, 259 aa]
          Length = 259

 Score = 71.2 bits (173), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 88/181 (48%), Gaps = 9/181 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+V++GD + GK+S++  + +  F E    TI   +++      +G    VI+  +WD
Sbjct: 52  RIKIVVVGDGATGKTSLLMSYTQGQFPEDYVPTIFENYVTNI----EGPRGKVIELALWD 107

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGN 121
           TAGQE Y  L P+ Y + +  +V Y      SL+ A+  W  E+++      ++  LVG 
Sbjct: 108 TAGQEEYSRLRPLSYGDVDIVMVCYAADNRTSLTNAEELWFPEVRHFCPHAPMM--LVGL 165

Query: 122 KVDIVEADESARKIETEEGAEYAQAQ-KLLFKEVSAKTGAGVKDIFQ-EIGEQLYSTKKA 179
           K D+   D   R ++  +    A+     +  + SAKT   ++D+F   I   LY   +A
Sbjct: 166 KSDLYSLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALYDELRA 225

Query: 180 S 180
            
Sbjct: 226 P 226

>YGR152C (RSR1) [2106] chr7 complement(794677..795495) GTP-binding
           protein involved in bud site selection, member of the
           ras family in the ras superfamily [819 bp, 272 aa]
          Length = 272

 Score = 70.9 bits (172), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 107/213 (50%), Gaps = 16/213 (7%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I    ++ V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTIEI----DNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y ++    L+VY VT   SL +     +++      + + + L+G
Sbjct: 56  LDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIG 115

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           NK D++    + R I  EEG E +    ++ F E SA   + V ++F ++  Q+   +  
Sbjct: 116 NKADLI----NERVISVEEGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEME 171

Query: 180 SLKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSS 212
           S+  KD   ++   S      + + PST   SS
Sbjct: 172 SVAVKDARNQSQQFS------KIESPSTRLPSS 198

>Sklu_2345.5 YCR027C, Contig c2345 9936-10595
          Length = 219

 Score = 70.1 bits (170), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 82/164 (50%), Gaps = 6/164 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           K+ ++G  +VGKSSI  +FV+  F E    TI   F S+TVK+      V+   EI DTA
Sbjct: 27  KIAVVGARNVGKSSITVQFVESHFVESYYPTIENEF-SRTVKLGK----VMYTLEICDTA 81

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVG-DEELVIYLVGNKV 123
           GQ+ +  +           LVVY V    S         ++ +++G DE + + + GNK+
Sbjct: 82  GQDEFSLVNNRSLMGVAGFLVVYSVVNRHSFELVGLIRDKILDQLGLDENVPVVVAGNKI 141

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQ 167
           D+     + R++  EEG + A++    F E SAK    V+D+  
Sbjct: 142 DLCPDGGNNRQVTREEGQQLAKSLGAGFSECSAKLNWNVEDVMM 185

>KLLA0C12001g complement(1029092..1029871) similar to sp|P13856
           Saccharomyces cerevisiae YGR152c RSR1 GTP-binding
           protein, start by similarity
          Length = 259

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 100/192 (52%), Gaps = 12/192 (6%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I    ++ V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDSYDPTIEDSY-RKTMEI----DNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y ++    L+VY V+   SL++     +++      + + I LVG
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVSDRQSLNELLELREQVLRIKDSDRVPIVLVG 115

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQLYST--K 177
           NK D+    +  R I  EEG E +    K+ F E SA   + V ++F ++  Q+     +
Sbjct: 116 NKADL----QDERVISVEEGIEVSSKWGKVPFYEASALLRSNVDEVFIDLVRQIIRNELE 171

Query: 178 KASLKNKDQSRR 189
            AS  N  QSR+
Sbjct: 172 SASNINNSQSRK 183

>Sklu_1655.1 YKR055W, Contig c1655 395-1258 reverse complement
          Length = 287

 Score = 70.9 bits (172), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 92/191 (48%), Gaps = 15/191 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
              K+V++GD +VGK+ ++  + +  F      TI   ++S+      G  + VI+  +W
Sbjct: 76  CHLKIVVVGDGAVGKTCLLISYTQGRFPTEYVPTIFENYVSKV----QGPRNKVIELALW 131

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE Y  L P+ Y + +  +V Y V    S    Q  W  E+++   D  ++  LVG
Sbjct: 132 DTAGQEEYNRLRPLSYTDVDILMVCYSVDSKTSFYNVQELWFPEVKHFCPDAPVM--LVG 189

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEV--SAKTGAGVKDIFQ-----EIGEQL 173
            K D+   D   + ++ ++    AQ Q   F  V  SAK+   V ++F       + ++L
Sbjct: 190 LKSDLYALDNLEQLVDPKDADTLAQ-QLGAFAHVQCSAKSRDNVDEVFNLAMTTALYDEL 248

Query: 174 YSTKKASLKNK 184
           Y  + +S+  K
Sbjct: 249 YGARDSSIFRK 259

>YLR229C (CDC42) [3629] chr12 complement(604214..604789) Rho-type
           GTPase involved in bud site assembly, cell polarity, and
           exocytosis, member of the rho family of the ras
           superfamily [576 bp, 191 aa]
          Length = 191

 Score = 69.3 bits (168), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 86/178 (48%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V++GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       ++  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLV--V 113

Query: 120 GNKVD------IVEA--DESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G ++D      I+E    +  R I +E+G+  A+  K + + E SA T  G+K++F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDE 171

>YOR101W (RAS1) [4906] chr15 (515244..516173) GTP-binding protein
           involved in regulation of cAMP pathway, homolog of
           mammalian proto-oncogene ras [930 bp, 309 aa]
          Length = 309

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 106/204 (51%), Gaps = 17/204 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++K+V++G   VGKS++  +F++  F +  + TI  ++  Q V      +D V   +I D
Sbjct: 10  EYKIVVVGGGGVGKSALTIQFIQSYFVDEYDPTIEDSYRKQVVI-----DDKVSILDILD 64

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGN 121
           TAGQE Y ++   Y R     L+VY VT  +S  +  S+ Q++Q +V D + + + +VGN
Sbjct: 65  TAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQ-RVKDSDYIPVVVVGN 123

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL------YS 175
           K+D+    E+ R++  E+G   A+     F E SAK    V + F  +   +      Y+
Sbjct: 124 KLDL----ENERQVSYEDGLRLAKQLNAPFLETSAKQAINVDEAFYSLIRLVRDDGGKYN 179

Query: 176 TKKASLKNKDQSRRTDSVSSNTVD 199
           +    L N ++ R ++  SS T D
Sbjct: 180 SMNRQLDNTNEIRDSELTSSATAD 203

>CAGL0K08316g 838393..839364 some similarities with sp|Q00246
           Saccharomyces cerevisiae YKR055w RHO4 GTP-binding
           protein, hypothetical start
          Length = 323

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 87/180 (48%), Gaps = 13/180 (7%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
             K+V++GD +VGK+S++  +V+  F   +   I   F +    I+ G +  +I+  +WD
Sbjct: 83  HLKIVVVGDGAVGKTSLLISYVEKVF---KHENIPTIFENYVTNIQ-GPKGQIIELALWD 138

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGN 121
           TAGQE Y  L P+ Y  A+  ++ Y +    SL   +  W  E+++      ++  LVG 
Sbjct: 139 TAGQEEYSRLRPLSYTGADVLMICYAIDSITSLKNVEDVWFPEVRHFCPGTPVM--LVGL 196

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFK-EVSAKTGAGVKDIF-----QEIGEQLYS 175
           K D+ E +    K++  E    A+        + SAK    V ++F     + + EQL S
Sbjct: 197 KSDLYEEESCDSKVDPAEADSIAKKNGAFAHIQCSAKLRVKVDNVFYAAINELLAEQLIS 256

>CAGL0B04521g complement(439732..440751) similar to sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein or sp|P01119 Saccharomyces cerevisiae YOR101w
           RAS1, hypothetical start
          Length = 339

 Score = 70.5 bits (171), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 88/165 (53%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++KLV++G   VGKS++  + V   F +  + TI  ++  Q V      +D V   +I D
Sbjct: 8   EYKLVVVGGGGVGKSALTIQLVHSHFVDEYDPTIEDSYRKQVVI-----DDKVTILDILD 62

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGN 121
           TAGQE Y ++   Y R     L+VY VT   S  +  ++ Q++Q +V D E + + +VGN
Sbjct: 63  TAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELITYYQQIQ-RVKDVEYIPVVVVGN 121

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           K D+    E+ R++  EEGA  A+     F E SAK    V+D F
Sbjct: 122 KSDL----ETERQVSFEEGASLAKQLNAPFLETSAKQAINVEDAF 162

>YML064C (TEM1) [3905] chr13 complement(145139..145876) GTP-binding
           protein involved in termination of M-phase, member of
           the ras superfamily [738 bp, 245 aa]
          Length = 245

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 87/161 (54%), Gaps = 7/161 (4%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQE 67
           L+GD+ VGK+S++ ++V++ +D+    T+G  FL + V I+  + D++  F I D  GQ 
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIR--STDII--FSIMDLGGQR 80

Query: 68  RYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD-IV 126
            + ++ P+    ++  + ++D+T+P++LS  + W ++    + D  + I LVG K D ++
Sbjct: 81  EFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYG-LNDSAIPI-LVGTKYDLLI 138

Query: 127 EADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQ 167
           + D   ++  +    +YAQ         S      ++ IF+
Sbjct: 139 DLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFK 179

>Kwal_23.3135
          Length = 191

 Score = 68.2 bits (165), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V++GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKVD------IVEA--DESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G ++D      I+E    +  R I  E+G   A+  + + + E SA T  G+K++F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSALTQRGLKNVFDE 171

>KLLA0A04213g complement(382243..382818) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42 GTP-binding
           protein of RAS superfamily, start by similarity
          Length = 191

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V++GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MQTLKCVVIGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKVD------IVEA--DESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G ++D      I+E    +  R I  E+G   A+  + + + E SA T  G+K++F E
Sbjct: 114 GTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSALTQRGLKNVFDE 171

>KLLA0F03443g 324020..324691 highly similar to sp|Q9HF51 Ashbya
           gossypii Rho3, start by similarity
          Length = 223

 Score = 68.6 bits (166), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 87/190 (45%), Gaps = 30/190 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E TI   ++          ++  I   +W
Sbjct: 13  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTIFENYIHDIFV-----DNQHISLSLW 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   Q+ WV E+ +     +LV  LV 
Sbjct: 68  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVQNKWVGEIADHCEGVKLV--LVA 125

Query: 121 NKVDIVEADESARK---------------------IETEEGAEYA-QAQKLLFKEVSAKT 158
            K D+   +E   +                     I  EEG + A +   L + E SAK 
Sbjct: 126 LKCDLRNLEEFGNESAAITPGSIQNRNSNAKDNGLISYEEGLDMAKKIGALRYLECSAKM 185

Query: 159 GAGVKDIFQE 168
             GV + F E
Sbjct: 186 NRGVNEAFTE 195

>CAGL0G08558g complement(804969..805652) highly similar to sp|Q00245
           Saccharomyces cerevisiae YIL118w RHO3, start by
           similarity
          Length = 227

 Score = 68.6 bits (166), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 25/194 (12%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           K+V+LGD + GK+S+++ F +  F E+ E T+   ++          ++  I   +WDTA
Sbjct: 22  KIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-----DNRHITLSLWDTA 76

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGNKV 123
           GQE +  L  + Y + +  ++ + +   DSL   ++ WV E+ +      LV  LV  K 
Sbjct: 77  GQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLENVKNKWVGEITDHCEGVNLV--LVALKC 134

Query: 124 DIVEADESA----------------RKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIF 166
           D+   + +                   I  EEG   A Q   L + E SAK   GV + F
Sbjct: 135 DLRNNENNVITPNNIQNNRNNNNNNNLITYEEGLAMAKQIGALRYLECSAKLNKGVNEAF 194

Query: 167 QEIGEQLYSTKKAS 180
            E      + K A+
Sbjct: 195 TEAARVALTAKNAT 208

>ADL252W [1489] [Homologous to ScYIL118W (RHO3) - SH]
           complement(258349..259023) [675 bp, 224 aa]
          Length = 224

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 30/190 (15%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   F +    I   N+ + +   +W
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTV---FENYIHDIFVDNQHITLS--LW 68

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   ++ WV E+ +     +LV  LV 
Sbjct: 69  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLENVKNKWVSEIADHCEGVKLV--LVA 126

Query: 121 NKVDIVEADESARK---------------------IETEEGAEYA-QAQKLLFKEVSAKT 158
            K D+  +DE   +                     I  +EG   A Q   L + E SAK 
Sbjct: 127 LKCDLRSSDEYGNESAITPGSIQNQKYNGGGGNGLIPYDEGLAMAKQIGALRYLECSAKM 186

Query: 159 GAGVKDIFQE 168
             GV + F E
Sbjct: 187 NRGVNEAFTE 196

>CAGL0F05269g complement(533759..534334) highly similar to sp|P19073
           Saccharomyces cerevisiae YLR229c CDC42, start by
           similarity
          Length = 191

 Score = 67.4 bits (163), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V++GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MQTLKCVVVGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       ++  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLV--V 113

Query: 120 GNKVD------IVEA--DESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G +VD      I+E    +  R I  E+G   A+  + + + E SA T  G+K++F E
Sbjct: 114 GTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSALTQRGLKNVFDE 171

>Scas_721.96
          Length = 191

 Score = 67.0 bits (162), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K V +GD +VGK+ ++  +  + F       +   F +  V +  G+E   +   +
Sbjct: 1   MKTIKAVTIGDGAVGKTCLLISYTTNQFPA---DYVPTVFDNYAVTVMIGDEPYTLG--L 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKA-QSWVQELQNKVGDEELVIYLV 119
           +DTAGQE Y  L P+ Y + +  LV + V  P S     + W  E+ +       +I  V
Sbjct: 56  FDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLI--V 113

Query: 120 GNKVD------IVEA--DESARKIETEEGAEYAQAQKLL-FKEVSAKTGAGVKDIFQE 168
           G ++D      I+E    +  R I  E+G   A+  K + + E SA T  G+K++F E
Sbjct: 114 GTQIDLRSDPIIIEKLQRQRLRPISPEQGERLARELKAVKYVECSALTQRGLKNVFDE 171

>KLLA0A05643g 528976..529632 similar to sp|Q00246 Saccharomyces
           cerevisiae YKR055w RHO4 GTP-binding protein of the rho
           family, hypothetical start
          Length = 218

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 93/190 (48%), Gaps = 10/190 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
             K+V++GD +VGK+S++  + +  F E    TI   +++      +G    +++  +WD
Sbjct: 31  HLKIVVVGDGAVGKTSLLISYTQGKFPEDYVPTIFENYVTNL----EGPNGKIVELALWD 86

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVGN 121
           TAGQE Y  L P+ Y + +  ++ Y +    S    +  W+ E+++   D  ++I  VG 
Sbjct: 87  TAGQEEYSRLRPLSYTDVDVLMICYAINSKVSFYNIEEMWLPEVKHFCPDVPIMI--VGL 144

Query: 122 KVDIVEADESARKIETEEGAEYA-QAQKLLFKEVSAKTGAGVKDIF-QEIGEQLYSTKKA 179
           K D+   D  +  ++  +  E A +    +  + S+K+   V+++F   I   LY   K 
Sbjct: 145 KSDLYAEDNISDFVDAFKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALYDELKP 204

Query: 180 SLKNKDQSRR 189
             K K  SRR
Sbjct: 205 K-KKKLNSRR 213

>Scas_703.41
          Length = 225

 Score = 67.8 bits (164), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 75/120 (62%), Gaps = 8/120 (6%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQE 67
           L+GD+ VGK+S++ ++V++ FDE    T+G  FL + VK+   + D+V  F + D  GQ+
Sbjct: 25  LVGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVKLH--STDIV--FSLMDLGGQK 80

Query: 68  RYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVI-YLVGNKVDIV 126
            + ++ P+    ++  + ++D+T+P++L+  + W ++++   G  ++ I  LVG K D++
Sbjct: 81  EFINMLPIAAVGSSVIVFLFDLTRPETLNSIKDWYRQVK---GLNDIAIPILVGTKYDLL 137

>ADL262W [1479] [Homologous to ScYOR101W (RAS1) - SH; ScYNL098C
           (RAS2) - SH] complement(243998..244012,244074..244871)
           [813 bp, 270 aa]
          Length = 270

 Score = 68.2 bits (165), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 90/165 (54%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q V   DG   ++   +I D
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI--DGQVSIL---DILD 64

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGN 121
           TAGQE Y ++   Y R     L+VY VT   S  +  ++ Q++  +V D E V I++VGN
Sbjct: 65  TAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMTYYQQIL-RVKDVEYVPIFVVGN 123

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           K D+    E  R++  EEGAE A+     F E SAK    V++ F
Sbjct: 124 KSDL----EGERQVSFEEGAELARHFNASFLETSAKQAINVEESF 164

>YNL180C (RHO5) [4420] chr14 complement(299654..300649) GTPase of
           the rho family in the ras superfamily, involved in
           negative regulation of the Slt2p MAP kinase branch of
           the Pkc1p pathway [996 bp, 331 aa]
          Length = 331

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 118/265 (44%), Gaps = 56/265 (21%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELREST----------IGAAFLSQTVKIKDG 50
           M   K V++GD +VGK+S++  +  ++F      T          I     S  +++ +G
Sbjct: 1   MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNG 60

Query: 51  NEDV---------------VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSL 95
           N+                 + K  +WDTAGQE Y  L P+ Y   +  L+ + V++  S 
Sbjct: 61  NDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASF 120

Query: 96  SK-AQSWVQELQNKVGDEELVIY---------LVGNKVDIVEADESARKIETEEGAEYAQ 145
           +   + W+ EL+     E   +Y         LVG K D+ +   + +K++ E  ++Y  
Sbjct: 121 ANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQ-EANSDYVS 179

Query: 146 AQK----------LLFKEVSAKTGAGVKDIF-QEIGEQLYSTKKASLKNKDQSRRTDSVS 194
            ++          + + E SA T AGV+++F Q +   +Y  +  + K+ + +  TD ++
Sbjct: 180 QEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSANHT-LTDELT 238

Query: 195 SNTVDI--------QTQRPSTNDTS 211
           + T +         Q Q+P  N+++
Sbjct: 239 TATTNTNGDKNIREQKQQPHHNNST 263

>KLLA0A11330g 982552..983124 similar to ca|CA6070|IPF4842 Candida
           albicans, start by similarity
          Length = 190

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 82/165 (49%), Gaps = 6/165 (3%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           K+++LG  +VGK++++ +  +  F E    TI   F+ + V  K    ++    +I DT+
Sbjct: 7   KIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIHEFVLKKPNGTELKFNLDIVDTS 66

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           GQ+ +  +           +++Y V    S    +    ++ + +G  EL + LVGNK+D
Sbjct: 67  GQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVELIRDKMLDMLGLLELPMVLVGNKID 126

Query: 125 IVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           +       R++  +EG E A+  K  F E+  K G+G++  F+ +
Sbjct: 127 L------DRQVSYKEGEELAKRLKCGFVEICVKQGSGIEMPFKTL 165

>Kwal_14.2244
          Length = 244

 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 91/174 (52%), Gaps = 10/174 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  +T++I    ++ V   EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSY-RKTMEI----DNKVFDLEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y ++    L+VY VT   SL +     +++     +  + + LVG
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLRIKDNSRVPMVLVG 115

Query: 121 NKVDIVEADESARKIETEEGAEYAQA-QKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+    +  R I  EEG E +    K+ F E SA   + V ++F ++  Q+
Sbjct: 116 NKADL----QDERVISVEEGIEMSSKWGKVPFYETSALLRSNVDEVFVDVVRQI 165

>Kwal_26.8387
          Length = 292

 Score = 67.4 bits (163), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 87/165 (52%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++KLV++G   VGKS++  + ++  F +  + TI  ++  Q V      +D V   +I D
Sbjct: 16  EYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKQVVI-----DDKVSILDILD 70

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGN 121
           TAGQE Y ++   Y R     L+VY VT   S  +  ++ Q++  +V D + V ++LVGN
Sbjct: 71  TAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELMTYYQQIL-RVKDADYVPVFLVGN 129

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           K D+    E  R++  EEG   A+     F E SAK    V+D F
Sbjct: 130 KSDL----EDERQVAYEEGVSLAKQFNAPFMETSAKQAINVEDSF 170

>AFR464W [3656] [Homologous to ScYGR152C (RSR1) - SH]
           complement(1274158..1274952) [795 bp, 264 aa]
          Length = 264

 Score = 67.0 bits (162), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 97/183 (53%), Gaps = 10/183 (5%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M  +KLV+LG   VGKS +  +FV+  + +  + TI  ++  ++++I D   D     EI
Sbjct: 1   MRDYKLVVLGAGGVGKSCLTVQFVQGEYLDTYDPTIEDSY-RKSMEIDDKAFD----LEI 55

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
            DTAG  ++ ++  +Y ++    L+VY VT   SL++     +++      + + + LVG
Sbjct: 56  LDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLAELMELREQILRIKDSKRVPMVLVG 115

Query: 121 NKVDIVEADESARKIETEEGAEY-AQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKA 179
           NK D+    ++ R I  EEG +  ++  K+ F E SA   + V ++F ++  Q+   +  
Sbjct: 116 NKADL----QNERAISVEEGIDVSSRWGKVPFYETSALLKSNVDEVFIDLVRQIMRAELE 171

Query: 180 SLK 182
           +L+
Sbjct: 172 TLE 174

>Kwal_55.21971
          Length = 421

 Score = 67.4 bits (163), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 54/95 (56%), Gaps = 7/95 (7%)

Query: 34  STIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQP 92
           STIG    +  V I    ++   K  +WDTAGQERY+ ++ P  Y+ +N  L+ YD+   
Sbjct: 202 STIGVDIRTNLVNI----DNRYFKVTMWDTAGQERYRNAMIPSLYKGSNGILLSYDICSR 257

Query: 93  DSLSKA-QSWVQELQNKVGDEE-LVIYLVGNKVDI 125
            S       W+QE+ N   D++ L IYLVGNK+D+
Sbjct: 258 KSFQNCLDYWLQEVLNCCADDKALRIYLVGNKIDL 292

>YIL118W (RHO3) [2558] chr9 (139749..140444) GTP-binding protein
           involved in control of actin cytoskeleton, exocytosis,
           and beta 1,6-glucan biosynthesis, member of the rho
           family in the ras superfamily [696 bp, 231 aa]
          Length = 231

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 87/200 (43%), Gaps = 42/200 (21%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++          +   I   +W
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-----DSKHITLSLW 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE +  L  + Y +    ++ + +   DSL   Q+ WV E+ +     +LV  LV 
Sbjct: 70  DTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLV--LVA 127

Query: 121 NKVDI--------------VEADESARK---------------IETEEGAEYAQAQK--- 148
            K D+              ++ D S                  I  EEG   A A+K   
Sbjct: 128 LKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEG--LAMAKKIGA 185

Query: 149 LLFKEVSAKTGAGVKDIFQE 168
           L + E SAK   GV + F E
Sbjct: 186 LRYLECSAKLNKGVNEAFTE 205

>Scas_697.46
          Length = 324

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 83/164 (50%), Gaps = 9/164 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++KLV++G   VGKS++  + +   F +  + TI  ++  Q V      +D V   ++ D
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLIHSHFVDEYDPTIEDSYRKQVVI-----DDKVTVLDVLD 64

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
           TAGQE Y ++   Y R     L+VY VT  +S  +  ++ Q++Q     + + + +VGNK
Sbjct: 65  TAGQEEYSAMREQYMRTGEGFLLVYSVTSKNSFEELLTYYQQIQRVKDSDYIPVVIVGNK 124

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
            D+    E  R++  + G   A+     F E SAK    V++ F
Sbjct: 125 SDL----EDERQVPYQSGVNLAKQMNAPFLETSAKQAINVEEAF 164

>Scas_671.35
          Length = 234

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F E+ E T+   ++          ++  I   +W
Sbjct: 15  IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFV-----DNKHITLSLW 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE +  L  + Y + +  ++ + +   DSL+  Q  WV E+ +     +LV  LV 
Sbjct: 70  DTAGQEEFDRLRSLSYSDTHTIMLCFSIDSRDSLANVQHKWVGEIADHCEGVKLV--LVA 127

Query: 121 NKVDIVEAD 129
            K D+   D
Sbjct: 128 LKCDLRNND 136

>Kwal_34.16142
          Length = 192

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 86/186 (46%), Gaps = 8/186 (4%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           K+ ++G  +VGKSS+  +FV+  F E    TI   F  Q V  +          EI DTA
Sbjct: 13  KIAVVGARNVGKSSLTVQFVESRFVEPYYPTIENQFTKQIVLGR-----TTYTLEICDTA 67

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           GQ+ +  +            +VY      S    +    ++ ++VG E++   ++GNK+D
Sbjct: 68  GQDEFSLINTKSLIGVKGVAIVYSCVNRASFEIVELIRDKILDQVGLEQIPTVILGNKID 127

Query: 125 IVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKNK 184
           + ++  +  K+  +EG E A      F E SAK   GV++   ++ + + S    SL   
Sbjct: 128 LRDSGINGGKVRRQEGEELAARLGAGFVECSAKLNIGVEEAMMKLLKMVESADGRSL--- 184

Query: 185 DQSRRT 190
           D S+ T
Sbjct: 185 DSSKCT 190

>YNL098C (RAS2) [4493] chr14 complement(439602..440570) GTP-binding
           protein involved in regulation of cAMP pathway, homolog
           of mammalian proto-oncogene ras [969 bp, 322 aa]
          Length = 322

 Score = 63.5 bits (153), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 88/165 (53%), Gaps = 11/165 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           ++KLV++G   VGKS++  +  +  F +  + TI  ++  Q V      +D V   +I D
Sbjct: 10  EYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVI-----DDEVSILDILD 64

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGN 121
           TAGQE Y ++   Y RN    L+VY +T   SL +  ++ Q++  +V D + V I +VGN
Sbjct: 65  TAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQIL-RVKDTDYVPIVVVGN 123

Query: 122 KVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
           K D+    E+ +++  ++G   A+     F E SAK    V++ F
Sbjct: 124 KSDL----ENEKQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAF 164

>Kwal_23.4875
          Length = 230

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 89/196 (45%), Gaps = 38/196 (19%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           ++ K+V+LGD + GK+S+++ F +  F ++ E T+   F +    I   N+ + +   +W
Sbjct: 14  IERKIVILGDGACGKTSLLNVFTRGYFPKVYEPTV---FENYIHDIFVDNQHITLS--LW 68

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKVGDEELVIYLVG 120
           DTAGQE +  L  + Y + +  ++ + V   DSL   Q  WV E+ +     +LV  LV 
Sbjct: 69  DTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSLDNVQHKWVGEIADHCEGVKLV--LVA 126

Query: 121 NKVDIVEADE-------------------------SARKIETEEGAEYAQAQK---LLFK 152
            K D+   +E                         S   I  EEG   A A+K   L + 
Sbjct: 127 LKCDLRSNNEEFALDSAITPGNIQQQQQQQQSSLQSNGLISYEEG--LAMAKKIGALRYL 184

Query: 153 EVSAKTGAGVKDIFQE 168
           E SAK   GV + F E
Sbjct: 185 ECSAKMNRGVNEAFTE 200

>CAGL0I03916g 343014..343559 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+      V  +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A TG G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQATCATTGEGLYEGLEWLSNNL 177

>YNL304W (YPT11) [4309] chr14 (60482..61549) Predicted GTPase
           possibly involved in non-selective vesicle transport,
           interacts with Myo2p and plays a role in distribution of
           mitochondria into growing buds [1068 bp, 355 aa]
          Length = 355

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 57/98 (58%), Gaps = 11/98 (11%)

Query: 34  STIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQP 92
           STIG    +  V I +   +V++    WDTAGQERY+ ++ P  Y+  NA ++ YD+T  
Sbjct: 142 STIGIDIKTNLVNIDNRFFNVIL----WDTAGQERYQNAIIPSLYKKTNAVILTYDITNA 197

Query: 93  DSL-SKAQSW-VQELQNKVGDEELV---IYLVGNKVDI 125
            S  S  + W VQ L+N    ++L+    +LVGNK+D+
Sbjct: 198 KSFQSCMERWIVQALEN-FSSQDLLKARFFLVGNKIDL 234

>YDL137W (ARF2) [731] chr4 (216529..217074) GTP-binding protein of
           the arf family (ras superfamily) involved in assembly of
           coated vesicles of the secretory system [546 bp, 181 aa]
          Length = 181

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+      V  +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNL 177

>Scas_624.4*
          Length = 181

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+      V  +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNL 177

>CAGL0J09064g 892556..893101 highly similar to sp|P11076
           Saccharomyces cerevisiae YDL192w ARF1 or sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2, start by
           similarity
          Length = 181

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+      V  +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNL 177

>Scas_701.42*
          Length = 181

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+      V  +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNNL 177

>CAGL0G05764g complement(552809..553681) similar to sp|P53879
           Saccharomyces cerevisiae YNL180c RHO5, start by
           similarity
          Length = 290

 Score = 57.0 bits (136), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 82/189 (43%), Gaps = 22/189 (11%)

Query: 1   MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
           M   K VL+GDS VGK++ +  +   +F      T+   +L+    I+D           
Sbjct: 1   MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLTT---IQDKETGYTFHTTF 57

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQS-WVQELQNKV----GDEELV 115
           WDT+G +++  L P+ Y   +  L  +      S    +  W+ EL+  +        + 
Sbjct: 58  WDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPELKKYIRKSDNSSTVP 117

Query: 116 IYLVGNKVDIVEADESARKIETE----EGAEYAQA--------QKLL-FKEVSAKTGAGV 162
           I LV  K D+ + D S+  I  +    +G    ++        + LL F + S+KTG G+
Sbjct: 118 ILLVATKCDLND-DNSSNNILNQSQEVDGMPLPESLVDGLVIDENLLGFVKCSSKTGYGL 176

Query: 163 KDIFQEIGE 171
           +D+   + +
Sbjct: 177 QDVIDNVAK 185

>Sklu_2320.2 YOR094W, Contig c2320 3571-4065
          Length = 164

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 67/125 (53%), Gaps = 15/125 (12%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            K+++LG  + GK++I+++      ++++ S     F  +TV  K+      +KF +WD 
Sbjct: 1   MKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVTYKN------VKFNMWDV 51

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLVG 120
            GQER + L   Y+    A + V D    D L++A+   +E  + VG++E+   V+ ++ 
Sbjct: 52  GGQERLRPLWRHYFPATTALIFVIDSQDKDRLNEAK---EEFYSIVGEKEMEKVVLLVLA 108

Query: 121 NKVDI 125
           NK D+
Sbjct: 109 NKQDL 113

>ADL162W [1579] [Homologous to ScYNL304W (YPT11) - SH]
           complement(405601..406815) [1215 bp, 404 aa]
          Length = 404

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 12/98 (12%)

Query: 33  ESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDV-- 89
           +STIG    +  V I    +  + K  +WDTAGQERY+ ++ P  Y+     ++ YD+  
Sbjct: 165 KSTIGVDIKTSFVDI----DRQLFKVIMWDTAGQERYRNAMVPSLYKGTQGIILSYDICS 220

Query: 90  --TQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDI 125
             T PD L   + W+ E       E    YLVGNKVD+
Sbjct: 221 RETFPDCL---EHWLPEALEHCQVEHTRFYLVGNKVDL 255

>Kwal_23.2944
          Length = 184

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+++LG  + GK++I+++      ++++ S     F  +TV  ++      +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVSFRN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLV 119
             GQ+R + L   Y+    A + V D    + L++A+   +EL + +GD+E+   V+ ++
Sbjct: 68  VGGQDRLRPLWRHYFPATTALIFVVDSQDMERLNEAK---EELYSIIGDKEMENVVLLVL 124

Query: 120 GNKVDI 125
            NK D+
Sbjct: 125 ANKQDL 130

>YOR094W (ARF3) [4899] chr15 (502795..503346) Protein with
           similarity to members of the arf family (ras
           superfamily) of GTP-binding proteins [552 bp, 183 aa]
          Length = 183

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 70/129 (54%), Gaps = 15/129 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+++LG    GK++I+++      ++++ ST    F  +TV  K+      +KF +WD
Sbjct: 17  EMKILMLGLDKAGKTTILYKL---KLNKIKTSTPTVGFNVETVTYKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLV 119
             GQ+R + L   Y+    A + V D +  + + +A+   +EL + +G++E+   V+ + 
Sbjct: 68  VGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAK---EELYSIIGEKEMENVVLLVW 124

Query: 120 GNKVDIVEA 128
            NK D+ +A
Sbjct: 125 ANKQDLKDA 133

>Sklu_1681.2 YDL137W, Contig c1681 2279-2767
          Length = 162

 Score = 53.9 bits (128), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 79/170 (46%), Gaps = 10/170 (5%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
            +++++G    GK++I+++       E+  +     F  +TV+ K+      I F +WD 
Sbjct: 1   MRVLMVGLDGAGKATILYKL---KLGEVVTTIPTIGFNVETVEYKN------ISFTVWDV 51

Query: 64  AGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKV 123
            GQ++ + L   Y+RN    + V D      +S+A+  +Q + N+      V+ +  NK 
Sbjct: 52  GGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANKQ 111

Query: 124 DIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           D+ EA  SA +I  + G    +    + +   A +G G+ +  + +   L
Sbjct: 112 DLPEA-MSAAEITEKLGLHSIRQHPWIIQATCAASGEGLYEGLEWLSNNL 160

>YDL192W (ARF1) [681] chr4 (116322..116867) GTP-binding protein
           involved in assembly of coated vesicles of the secretory
           system, member of the arf family in the ras superfamily
           [546 bp, 181 aa]
          Length = 181

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 78/171 (45%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVITTIPTIGFNVETVQYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ+R +SL   YYRN    + V D      + +A+  +Q + N+         +  NK
Sbjct: 68  VGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSL 177

>CAGL0J11242g 1092630..1093784 similar to sp|P53879 Saccharomyces
           cerevisiae YNL180c RHO5, start by similarity
          Length = 384

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 55  VIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSK-AQSWVQELQNKVGDE- 112
           + K  +WDTAGQE Y  L P+ YR  +  L+ + V++P S       W  EL+   G E 
Sbjct: 116 IFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVVDKWFPELKRVSGIES 175

Query: 113 --------ELVIYLVGNKVDIVEADESARK--------IETEEGAEYAQAQKLL-FKEVS 155
                   +  I LVG K D+ + +   +K        +  EE  +  +    + + E S
Sbjct: 176 GDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEEIDKVVEDNGFMGYVECS 235

Query: 156 AKTGAGVKDIFQE 168
           A T   V+ +F++
Sbjct: 236 AATQNNVRQVFEK 248

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 1  MLQFKLVLLGDSSVGKSSIVHRFVKDTF 28
          M   K V++GD +VGK+S++  +  +TF
Sbjct: 1  MRSIKCVVIGDGAVGKTSLLISYTTNTF 28

>Scas_697.54*
          Length = 181

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 69/126 (54%), Gaps = 15/126 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+++LG  + GK++I+++      ++++ ST    F  +TV  K+      +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSTPTVGFNVETVSYKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLV 119
             GQER + L   Y+    A + V D +  + L++A+   +EL + + ++E+   V+ + 
Sbjct: 68  VGGQERLRPLWRHYFPATTALIFVIDSSDQERLNEAK---EELYSIISEKEMEKVVLLVW 124

Query: 120 GNKVDI 125
            NK D+
Sbjct: 125 ANKQDL 130

>Sklu_2354.10 YNL304W, Contig c2354 13851-15119
          Length = 422

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 7/96 (7%)

Query: 33  ESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQ 91
           ++TIG    +  + I    ++   K  +WDTAGQERY+ ++ P  Y+ +N  ++ YD+  
Sbjct: 207 KTTIGIDIKTSLINI----DNRFFKVIMWDTAGQERYRNAMIPSLYKGSNGIILTYDICD 262

Query: 92  PDSL-SKAQSWVQE-LQNKVGDEELVIYLVGNKVDI 125
             S  S    W++E +QN     +   YLVGNK+D+
Sbjct: 263 RASFDSCLNHWLREAIQNCKDLGKTRFYLVGNKIDL 298

>Kwal_56.24453
          Length = 181

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 80/171 (46%), Gaps = 10/171 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ++ + L   Y+RN    + V D      +S+A+  +Q + N+      V+ +  NK
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNAVLLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
            D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRQRPWFIQAACATSGEGLYEGLEWLSNNL 177

>ACL078W [971] [Homologous to ScYOR094W (ARF3) - SH]
           complement(212664..213209) [546 bp, 181 aa]
          Length = 181

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 77/146 (52%), Gaps = 21/146 (14%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+++LG  + GK++I+++      ++++ S     F  +TV  ++      +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETVAFRN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLV 119
             GQER + L   Y+    A + V D      L++A+   +EL + +G++E+   V+ ++
Sbjct: 68  VGGQERLRPLWRHYFPATTALIFVIDSHDQARLNEAK---EELYSIIGEKEMENVVLLVL 124

Query: 120 GNKVDIVEADESARKIETEEGAEYAQ 145
            NK D+  A      ++ +E ++Y Q
Sbjct: 125 ANKQDLRGA------LKPQEVSDYLQ 144

>Kwal_56.24462
          Length = 181

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 83/173 (47%), Gaps = 14/173 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQN--KVGDEELVIYLVG 120
             GQ++ + L   YYRN    + V D      +S+A+  +Q + N  ++ +  L+++   
Sbjct: 68  VGGQDKIRPLWRHYYRNTEGIIFVVDSNDRSRISEAREVLQRMLNEDEIRNASLLVF--A 125

Query: 121 NKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           NK D+ EA  SA +I  + G    + +    +   A +G G+ +  + +   L
Sbjct: 126 NKQDLPEA-MSAAEITEKLGLHSIRQRPWFIQATCATSGEGLYEGLEWLSNSL 177

>KLLA0C13563g complement(1157278..1157826) highly similar to
           sp|P40994 Saccharomyces cerevisiae YOR094w ARF3
           ADP-ribosylation factor 3, start by similarity
          Length = 182

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 69/129 (53%), Gaps = 15/129 (11%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K+++LG  + GK++I+++      ++++ S     F  +T+  K+      +KF +WD
Sbjct: 17  EMKILMLGLDNAGKTTILYKL---KLNKIKTSAPTVGFNVETLSFKN------VKFNMWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL---VIYLV 119
             GQ R + L   Y+   +A + V D    + L +A+   +EL + +G++E+   V+ ++
Sbjct: 68  VGGQARLRPLWRHYFPATSALIFVIDSNDKERLDQAK---EELFSIIGEKEMEKVVLLVL 124

Query: 120 GNKVDIVEA 128
            NK D+  A
Sbjct: 125 ANKQDLPGA 133

>ADR094W [1835] [Homologous to ScYDL192W (ARF1) - SH; ScYDL137W
           (ARF2) - SH] complement(878123..878668) [546 bp, 181 aa]
          Length = 181

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ++ + L   Y+RN    + V D      +++A+  +Q + N+      V+ +  NK
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRIAEAREVLQRMLNEDEIRNAVLLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGV 162
            D+ EA  SA +I  + G    + +    +   A +G G+
Sbjct: 128 QDLPEA-MSAAEITEKLGLHSIRQRPWYIQATCATSGEGL 166

>CAGL0M03817g complement(431237..432664) weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, hypothetical
           start
          Length = 475

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 33  ESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQ 91
           ++TIG    +  + I    ++ +    +WDTAGQERY+ ++ P  Y+ +NA ++ YD+T 
Sbjct: 237 KTTIGVDIKTNIINI----DNRIFNCILWDTAGQERYRNAIMPSLYKKSNAIILSYDITD 292

Query: 92  PDSLSKA-QSWVQELQNKVGD---EELVIYLVGNKVDIVEADE 130
             S   + + W+ E          E+   Y +GNK D+ +  E
Sbjct: 293 KCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQRE 335

>KLLA0F05225g 515391..515936 highly similar to sp|P19146
           Saccharomyces cerevisiae YDL137w ARF2 GTP-binding
           protein of the ARF family, start by similarity
          Length = 181

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + +++++G    GK++++++       E+  +     F  +TV+ K+      I F +WD
Sbjct: 17  EMRILMVGLDGAGKTTVLYKL---KLGEVVTTIPTIGFNVETVEYKN------ISFTVWD 67

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
             GQ++ + L   Y+RN    + V D      +++A+  +Q + N+      V+ +  NK
Sbjct: 68  VGGQDKIRPLWRHYFRNTEGIIFVVDSNDRARIAEAREVLQRMLNEDEIRNAVLLVFANK 127

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGV 162
            D+ EA  +A +I  + G    + +    +   A +G G+
Sbjct: 128 QDLPEAMPAA-EITEKLGLHSIRQRPWYIQATCATSGEGL 166

>YCR027C (RHB1) [561] chr3 complement(167365..167994) Protein
           involved in regulation of arginine and lysine uptake,
           member of the Rheb family in the Ras superfamily of G
           proteins [630 bp, 209 aa]
          Length = 209

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 81/180 (45%), Gaps = 13/180 (7%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
            Q K+ L+G  +VGK+++  RFV+  F E    TI   F   T  I   + D  +  EI 
Sbjct: 15  FQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEF---TRIIPYKSHDCTL--EIL 69

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           DTAGQ+    L           ++ Y +    S         +L +++G + L + LVG 
Sbjct: 70  DTAGQDEVSLLNIKSLTGVRGIILCYSIINRASFDLIPILWDKLVDQLGKDNLPVILVGT 129

Query: 122 KVDIVEADESARKIETE-EGAEYA-------QAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           K D+  + +  ++  T+ EG + A       +  +  F E SA+    V++ F  + +Q+
Sbjct: 130 KADLGRSTKGVKRCVTKAEGEKLASTIGSQDKRNQAAFIECSAELDYNVEETFMLLLKQM 189

>Scas_503.2
          Length = 527

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 15/112 (13%)

Query: 25  KDTFDELRE------STIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYKS-LAPMYY 77
           K +FD+  E       TIG    S  V I+    + +     WD AGQ+R+K+ +    Y
Sbjct: 236 KASFDDREEMIIDTRPTIGIDIKSTLVNIQGKKYNCIF----WDPAGQDRFKNVMMDSLY 291

Query: 78  RNANAALVVYDVTQPDSL-SKAQSWVQE-LQN-KVGD-EELVIYLVGNKVDI 125
           + +NA ++ YD+    S  +  + W+ E L+N + GD  E+  YLVGNK+D+
Sbjct: 292 KISNAIILCYDICNLTSFQNCCRYWLNETLENVRSGDLSEIKFYLVGNKLDL 343

>KLLA0C12881g 1090895..1092016 weakly similar to sp|P48559
           Saccharomyces cerevisiae YNL304w YPT11, start by
           similarity
          Length = 373

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 11/113 (9%)

Query: 34  STIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYK-SLAPMYYRNANAALVVYDVTQP 92
           STIG    +  V I    ++   +  +WDTAGQERY+ ++    Y+ +N  ++ YD+   
Sbjct: 159 STIGIDIKTNLVNI----DNRFFRVIMWDTAGQERYRNAMISSLYKGSNGVILSYDICDF 214

Query: 93  DS-LSKAQSW-VQELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEY 143
           +S L+    W V+ ++N         YLVGNK+D+ +     RK+  E+  ++
Sbjct: 215 NSFLNCLNFWLVESIENIPNLSMTRFYLVGNKLDLYK----ERKVTHEDVLQF 263

>Scas_628.21
          Length = 208

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 82/179 (45%), Gaps = 12/179 (6%)

Query: 2   LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
            Q K+ +LG  +VGK+++  R+V+  F E    T+   F ++ +  K+ +       EI 
Sbjct: 13  FQRKIAVLGAKNVGKTTLTIRYVESRFLESYYPTVENHF-TKLIDFKNQH----FTLEIV 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           DTAGQ+    L           ++ Y V    +         +L +++  +++ + +VGN
Sbjct: 68  DTAGQDESSLLNLKSLAGVRGVILCYSVVNISTFDMIPVVWDKLLDQLERDDIPVIIVGN 127

Query: 122 KVDIVEADESARKIETEEGAEYA-------QAQKLLFKEVSAKTGAGVKDIFQEIGEQL 173
           K+D+    ++   +  +EG + A       +  K  F E SAK    V   FQ++ +Q+
Sbjct: 128 KIDLRNDLDNRTVVTKQEGKKLANLIRSSDKNIKAGFIECSAKDDTNVGTTFQKLLKQM 186

>YMR138W (CIN4) [4095] chr13 (545154..545729) GTP-binding protein
           involved in chromosome segregation, mutants arrest at
           mitosis with loss of microtubule structure [576 bp, 191
           aa]
          Length = 191

 Score = 48.1 bits (113), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 19/185 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTI--GAAFLSQTVKIKDGNEDVVIKFEI 60
           + + ++LG  + GKS+IV++ +    DE     I     F   ++ IKD      +   +
Sbjct: 16  EIRCLILGLDNSGKSTIVNKLLPK--DEQNNDGIMPTVGFQIHSLMIKD------VTISL 67

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQP----DSLSKAQSWVQELQNKVGDEELVI 116
           WD  GQ   +     Y+    A +   DV+      ++L + +  +   +N++G E  VI
Sbjct: 68  WDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVI 127

Query: 117 YLVGNKVDIVE-ADESARK---IETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQ 172
            +V NK+D+VE   E  R+   +E+E    +    ++   + S  TG G+ ++   + E 
Sbjct: 128 -VVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLRDRLVES 186

Query: 173 LYSTK 177
            + T+
Sbjct: 187 CHFTQ 191

>Sklu_2365.2 YPL051W, Contig c2365 827-1420 reverse complement
          Length = 197

 Score = 47.8 bits (112), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 80/177 (45%), Gaps = 32/177 (18%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGN------EDVVI 56
           QF +++LG  + GK++ +    K       E ++ +  L +       N      +D V+
Sbjct: 17  QFSILILGLDNAGKTTFLETLKK-------EYSLHSKPLEKITPTVGQNVATIPVQDCVL 69

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE--- 113
           KF  WD  GQE  +SL   YY  A+  + V D T  D L + +   + L++ V DE+   
Sbjct: 70  KF--WDVGGQETLRSLWAEYYSQAHGIIFVVDSTDRDRLDECK---ETLRSIVMDEDVEG 124

Query: 114 LVIYLVGNKVD------IVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKD 164
           + + ++ NK D      + +  E   KI     AE+  A+      +SA TG GV D
Sbjct: 125 VPVLMLANKQDREDRMEVQDIKEIFNKI-----AEHLGARDSRVLPISALTGEGVTD 176

>YPL051W (ARL3) [5389] chr16 (459958..460554) ADP-ribosylation
           factor-like protein, member of the arf-sar family in the
           ras superfamily [597 bp, 198 aa]
          Length = 198

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD---TFDELR--ESTIGAAFLSQTVKIKDGNEDVVIK 57
           Q+ +++LG  + GK++ +    K+    F  L   + T+G     Q V     +   ++K
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVG-----QNVATIPVDSKQILK 71

Query: 58  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL--- 114
           F  WD  GQE  +S+   YY   +  + + D +  + L +  +    LQ+ V DEE+   
Sbjct: 72  F--WDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECST---TLQSVVMDEEIEGV 126

Query: 115 VIYLVGNKVD------IVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQE 168
            I ++ NK D      + +  E   KI     AE+  A+      +SA TG GVKD  + 
Sbjct: 127 PILMLANKQDRQDRMEVQDIKEVFNKI-----AEHISARDSRVLPISALTGEGVKDAIEW 181

Query: 169 IGEQLYSTKKA 179
           +  +L   KK+
Sbjct: 182 MIVRLERNKKS 192

>CAGL0I00858g complement(63365..63958) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 197

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 86/181 (47%), Gaps = 17/181 (9%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + + ++LG  + GKS+IV+  + ++ ++    T    F   ++ ++   +    K  +WD
Sbjct: 16  EIRCLILGLDNSGKSTIVNGLLPES-EKCNSITPTVGFQIHSIVVESAQDGKTYKVNLWD 74

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQP----DSLSKAQSWVQELQNKVGDE-ELVIY 117
             GQ   +     Y+   +  L   D+       +S ++ +  V + ++++G + +LV+ 
Sbjct: 75  IGGQRTLRPFWDNYFDKTDVLLWCVDIASSLRFDESFNELRELVMQDRDRIGYQCKLVVA 134

Query: 118 LVGNKVDIVE-------ADESARKIE--TEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQE 168
           +  NK+D+VE       A +  +KIE     G    ++    +   S KTGAG++++ Q 
Sbjct: 135 I--NKIDLVEQADLEHYAHDIEQKIEHILHHGQSVGESSIGHYVLCSGKTGAGIENLAQM 192

Query: 169 I 169
           I
Sbjct: 193 I 193

>Scas_567.9
          Length = 199

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 84/187 (44%), Gaps = 20/187 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKD------TFDELRESTIGAAFLSQTVKIKDGNEDVVI 56
           Q+ +++LG  + GK++ +    K+        D++   T+G    + +V+    N   ++
Sbjct: 17  QYSILILGLDNAGKTTFLETCKKEFNLNSKPLDKI-TPTVGQNVATISVE----NNKKLL 71

Query: 57  KFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE--- 113
           KF  WD  GQE  +S+   YY   +  + V D T    + +     + L   V D+E   
Sbjct: 72  KF--WDVGGQENLRSMWSEYYSQCHGIIFVVDSTDRSRIDECS---KTLGKIVMDDEVEG 126

Query: 114 LVIYLVGNKVDIVEADESARKIET-EEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQ 172
           + I ++ NK D+ E  E     E   + AE+  A+      VSA TG GVKD    +  +
Sbjct: 127 VPILMLANKQDMPERMEVQDIKEIFNQIAEHLSARDSRVLPVSALTGEGVKDAIDWMTLR 186

Query: 173 LYSTKKA 179
           L   KK 
Sbjct: 187 LERNKKV 193

>Sklu_2202.6 YBR164C, Contig c2202 5407-5958
          Length = 183

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K+      +K  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
             GQ   +     YY N  A + V D T  D +S A    +EL   + +EEL
Sbjct: 69  LGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMSTAS---KELHMMLQEEEL 117

>CAGL0E05896g
           join(complement(585178..585202),
           complement(584348..584892)) highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family
          Length = 189

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +   + ++  GN    IKF  +D  
Sbjct: 24  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN----IKFTTFDLG 74

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           G  + + L   Y+   N  + + D   PD   +A+  +  L N    +++   ++GNK+D
Sbjct: 75  GHVQARRLWKDYFPEVNGIVFLVDSADPDRFDEARVELDALFNITELKDVPFVILGNKID 134

Query: 125 IVEA 128
              A
Sbjct: 135 AANA 138

>YPL218W (SAR1) [5231] chr16 (138697..138724,138864..139408)
           Component of COPII coat of vesicles involved in
           endoplasmic reticulum to Golgi transport, GTP-binding
           protein of the arf family in the ras superfamily [573
           bp, 190 aa]
          Length = 190

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 70/149 (46%), Gaps = 14/149 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +   + ++  GN    IKF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN----IKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           G  + + L   Y+   N  + + D   P+   +A+  +  L N    +++   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKID 135

Query: 125 ----IVEAD-ESARKIETEEGAEYAQAQK 148
               + EA+  SA  +    G++  + Q+
Sbjct: 136 APNAVSEAELRSALGLLNTTGSQRIEGQR 164

>KLLA0E24805g 2194554..2195105 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ARL1 ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K+      +K  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVITTKPTIGFNVETLNYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
             GQ   +     YY N  A + V D T  D ++ A    +EL   + +EEL
Sbjct: 69  LGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMNIAS---KELHLMLQEEEL 117

>YBR164C (ARL1) [350] chr2 complement(567832..568383) GTP-binding
           protein of the arf-sar family in the ras superfamily,
           possibly involved in signal transduction, and plays a
           role in membrane trafficking [552 bp, 183 aa]
          Length = 183

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K+      +K  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLSYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
             GQ   +     YY +  A + V D T  D +S A    +EL   + +EEL
Sbjct: 69  LGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTAS---KELHLMLQEEEL 117

>AGR221W [4532] [Homologous to ScYBR164C (ARL1) - SH]
           complement(1164831..1165382) [552 bp, 183 aa]
          Length = 183

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 14/113 (12%)

Query: 3   QFKLVLLGDSSVGKSSIVHRF-VKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW 61
           + ++++LG    GK++I++R  V +      + TIG  F  +T+  ++      +K  +W
Sbjct: 18  ELRILILGLDGAGKTTILYRLQVGEVVTT--KPTIG--FNVETLTYRN------LKLNVW 67

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
           D  GQ   +     YY N  A + V D T  D +  A    +EL   + +EEL
Sbjct: 68  DLGGQTSIRPYWRCYYANTAAVIFVVDSTDKDRMGVA---ARELHTMLQEEEL 117

>CAGL0I10835g 1060258..1060809 highly similar to sp|P38116
           Saccharomyces cerevisiae YBR164c ADP-ribosylation
           factor, start by similarity
          Length = 183

 Score = 42.0 bits (97), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 12/112 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K+      +K  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
             GQ   +     YY +  A + V D T  D +S A    +EL   + +EEL
Sbjct: 69  LGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTAS---KELHLMLQEEEL 117

>Kwal_27.11872
          Length = 197

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVK-IKDGNEDVVIKFEIW 61
           Q+ +++LG  + GK++ +    ++     +        + Q V  +  GN   ++KF  W
Sbjct: 17  QYSILILGLDNAGKTTFLEMLKREYSKSGKAPDKITPTVGQNVATVPVGN--CLLKF--W 72

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE---LVIYL 118
           D  GQE  ++L P YY+ A+  + V D    + L +     Q L+  V DE+   + + +
Sbjct: 73  DVGGQESLRALWPEYYKQAHGIIFVIDSADRERLDEC---CQTLRTIVMDEDVEGIPVLM 129

Query: 119 VGNKVD 124
           + NK D
Sbjct: 130 LANKQD 135

>KLLA0C13387g complement(1142002..1142637) similar to sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1 GTP-binding
           protein, start by similarity
          Length = 211

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 72  LAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV-IYLVGNKVDIVEADE 130
           +   Y R     L+VY VT   S  +  ++ Q++  +V D + V ++++GNK D+    E
Sbjct: 1   MREQYMRTGEGFLLVYSVTSKTSFEELMTYYQQIL-RVKDSDYVPVFVIGNKSDL----E 55

Query: 131 SARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIF 166
             R++  EEG   A+     F E SAK    V++ F
Sbjct: 56  DERQVSYEEGQTLAKQFDAPFLETSAKQNINVEESF 91

>CAGL0L12826g complement(1370767..1371366) highly similar to
           tr|Q02804 Saccharomyces cerevisiae YPL051w
           ADP-ribosylation factor-like protein, start by
           similarity
          Length = 199

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVK-IKDGNEDVVIKFEIW 61
           Q+ +++LG  + GK++ +    K+     +     A  + Q V  I   N   ++KF  W
Sbjct: 17  QYSILILGLDNAGKTTFLETLKKEYSMHSKPLDKIAPTVGQNVATIPVDNNRSILKF--W 74

Query: 62  DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEE---LVIYL 118
           D  GQ   +++   YY   +  + V D T    + +     + L+  V D+E   + I +
Sbjct: 75  DVGGQASLRAMWSEYYPQCHGIIFVVDSTDRSRIDECS---ETLRTIVMDDEIEGIPILM 131

Query: 119 VGNKVDIVEADESARKIET-EEGAEYAQAQKLLFKEVSAKTGAGVKD 164
           + NK D  E  E     E     AE+  A+      V A TG G+KD
Sbjct: 132 LANKQDKPERMEVQDIKEIFNRIAEHMSARDSRVLPVCALTGEGIKD 178

>Kwal_47.18241
          Length = 230

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           Q  +V++G  + GK+S+    +   F++    T+G      T+ +     ++V    I+D
Sbjct: 4   QLNIVIVGLQNSGKTSLTRALLSKPFEQDTIPTLGMRMEQFTMGL-----NIV---RIFD 55

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
            AGQ R++ L   Y+  A+  + V D+    + ++ +  V+++      + + + ++GNK
Sbjct: 56  LAGQYRFQHLWDRYFDRADLIIYVIDLADQTNWAECKEAVRKVIVDTNRDCIPMLILGNK 115

Query: 123 VDIV 126
           +D++
Sbjct: 116 IDLI 119

>Scas_700.11
          Length = 183

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 12/112 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + ++++LG    GK++I++R       E+  +     F  +T+  K+      +K  +WD
Sbjct: 18  ELRILILGLDGAGKTTILYRL---QIGEVVTTKPTIGFNVETLTYKN------LKLNVWD 68

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEEL 114
             GQ   +     YY +  A + V D T  D +  A    +EL   + +EEL
Sbjct: 69  LGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMGTAS---KELHLMLQEEEL 117

>Scas_706.2*
          Length = 190

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 9/120 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +   + ++  GN    IKF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN----IKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           G  + + L   Y+   N  + + D   P+   +A   +  L      +++   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADPERFHEAYVELDALFKIAELKDVPFVILGNKID 135

>Scas_680.21
          Length = 183

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 75/177 (42%), Gaps = 29/177 (16%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + K ++LG  + GKS++V++ + +  +E  +  I      Q V    G   +     +WD
Sbjct: 16  ELKCLILGLDNSGKSTLVNKLLPE--EERSQVEITPTIGFQIVNFNHGGYTI----SMWD 69

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV------- 115
             GQ   +     Y+    A +   DV+ P   S+ Q  ++EL   +  +  V       
Sbjct: 70  IGGQTTLRPFWDNYFDKMEALVWCVDVSAP---SRFQESLRELSQLLNLDRTVESGETLP 126

Query: 116 --IYLVGNKVDIVEADESARKIET-----EEGAEYAQAQKLLFKEVSAKTGAGVKDI 165
             + +V NK+D+V+ +    ++++      EG EY          VSA  G G  ++
Sbjct: 127 FKLIVVLNKIDLVDWNSVEGQLDSLLSTHLEGIEYVSLA------VSALNGQGTMEL 177

>KLLA0B02046g 178646..179218 highly similar to sp|P20606
           Saccharomyces cerevisiae YPL218w SAR1 GTP-binding
           protein of the ARF family, start by similarity
          Length = 190

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 9/120 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +   + ++  GN    IKF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGN----IKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           G  + + L   Y+   N  + + D   P+  ++A+  +  L      + +   ++GNK+D
Sbjct: 76  GHLQARRLWKDYFPEVNGIVFLVDAADPERFNEARIELDALFQIKELDNVPFAVLGNKID 135

>CAGL0E06292g 633135..634361 some similarities with sp|P01119
           Saccharomyces cerevisiae YOR101w RAS1, start by
           similarity
          Length = 408

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 102/234 (43%), Gaps = 48/234 (20%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTF----------DELRESTIGAAF------------ 40
            F++++LGD  VGK+S++ +++ D +          D  R+     +F            
Sbjct: 20  NFRIMVLGDPKVGKTSMIMQWLTDNYRSGDEATYSDDIYRKKIPYYSFRLLNDKGLIAEK 79

Query: 41  ------LSQTVKIKDGNEDVVIKFEIWDTAGQ---ERYKS-LAPMYYRNANAALVVYDVT 90
                 L  + + +  N+D+ IK EI D       E Y + L  +  + ++A ++ +D  
Sbjct: 80  DVIDFNLDNSHRFQYTNKDL-IKLEILDANIHDISEYYSNELRSLQVKQSDAIVICFDGK 138

Query: 91  QPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLL 150
              +    + +   +++ +G+E++ + +   K+D +  D    K+E  E   +     L 
Sbjct: 139 SQTTFEHVREYYNTIKDALGEEQIPVVICNTKIDYLMED----KVEFNELINFLAELDLD 194

Query: 151 FK----EVSAKTGAGVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDI 200
           ++    E S+K    VK++       L+S       NK+  ++ +++ S T++I
Sbjct: 195 YENDYFETSSKHNINVKEL-------LFSLLYRIETNKEMKKKEEALKSETLEI 241

>KLLA0F17072g complement(1566668..1567240) similar to sp|P39110
           Saccharomyces cerevisiae YMR138w CIN4 GTP-binding
           protein, start by similarity
          Length = 190

 Score = 37.4 bits (85), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 67/125 (53%), Gaps = 14/125 (11%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           +++LLG  + GK++++++ + +  D++ + TIG  F  +T+K+ +         ++WD  
Sbjct: 18  RVLLLGLDNSGKTTVLNQLLNEPIDKI-QPTIG--FQIKTLKLSNK------VLQMWDIG 68

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQ---PDSLSKAQSWVQELQNKVGDEELVIYLVGN 121
           GQ+  +     Y+   +  + V D+      +SL+  +  VQE  N   + +  ++++ N
Sbjct: 69  GQKTLRPFWFNYFEKTDYLIWVIDILDNRLMESLTLLEEIVQE--NDRINLQFEVFILLN 126

Query: 122 KVDIV 126
           K+D++
Sbjct: 127 KIDLL 131

>YMR023C (MSS1) [3987] chr13 complement(319436..321016)
           Mitochondrial GTPase involved in expression of COX1/OXI3
           [1581 bp, 526 aa]
          Length = 526

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 41/197 (20%)

Query: 4   FKLVLLGDSSVGKSSIVHRF--------------VKDTFDELRESTIGAAFLSQTVKIKD 49
            KLVLLG  +VGKSS+V+                 +D+ D +         +  T  I++
Sbjct: 275 IKLVLLGAPNVGKSSLVNSLTNDDISIVSDIPGTTRDSIDAMINVNGYKVIICDTAGIRE 334

Query: 50  GNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSK--AQSWVQELQN 107
            + D   K E+    G +R K       ++  + L ++ +  P  LSK   +  +  L +
Sbjct: 335 KSSD---KIEML---GIDRAKK------KSVQSDLCLF-IVDPTDLSKLLPEDILAHLSS 381

Query: 108 KV-GDEELVIYLVGNKVDIVEADESAR---KIETEEGAEYAQAQKLLFKEVSAKTGAGVK 163
           K  G++ ++I  V NK D+V  DE  +   K++T  G++Y          VS KT  G++
Sbjct: 382 KTFGNKRIII--VVNKSDLVSDDEMTKVLNKLQTRLGSKYP------ILSVSCKTKEGIE 433

Query: 164 DIFQEIGEQLYSTKKAS 180
            +   +     S  ++S
Sbjct: 434 SLISTLTSNFESLSQSS 450

>Sklu_1358.1 YMR138W, Contig c1358 536-1192
          Length = 218

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWD 62
           + + ++LG  + GKS++V  ++ +  ++    T    F   T++    N       ++WD
Sbjct: 42  ELRSLVLGLDNSGKSTVVD-WLLERGEKRSRITPTVGFRIHTIEYAGHN------VQLWD 94

Query: 63  TAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL---QNKVGDEELVIYLV 119
             GQ   +     Y+   +  L V DVT     S++ + +++L   ++++G    +I L+
Sbjct: 95  IGGQRTLRPFWDNYFDKTDVLLWVIDVTARSRFSESFAELEKLLQDRDRLGYRCKMIVLL 154

Query: 120 GNKVDIVEADESA 132
            NK+D+++ DES 
Sbjct: 155 -NKMDLIDEDESV 166

>Kwal_26.6810
          Length = 664

 Score = 35.8 bits (81), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 78/197 (39%), Gaps = 38/197 (19%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTF-----DELRESTIGAAFLSQTVKIKDGNEDVVIK 57
           Q K+V+ GD  VGK+S++   +KD F     D L   TI   F S  V  K   + V++ 
Sbjct: 5   QIKIVVCGDDGVGKTSLIAALLKDQFILNLQDSLPPVTIPQYFSSSPVCPK---KSVLVD 61

Query: 58  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIY 117
              +D  G +R         ++A+   +VY  +  +S  +   +   +   +G   L + 
Sbjct: 62  TTSYDLPGLQR-------ELKSADVIWLVY--SDHESYDRVPLYWMMMFRSLG-VNLPVI 111

Query: 118 LVGNKVDIVEAD---------------ESARKIETEEGAEYAQAQKLLFKEVSAKTGAGV 162
           L  NK D   AD                 + KIE EE     +     FKE+        
Sbjct: 112 LCKNKCDDFLADGEPVTSNNLSLEDGSSDSTKIEDEEFIPILRE----FKEIETCIKTSA 167

Query: 163 KDIFQEIGEQLYSTKKA 179
           +D F  + +  Y  ++A
Sbjct: 168 RDKFN-VNQAFYLCQRA 183

>Kwal_56.24149
          Length = 149

 Score = 33.9 bits (76), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 32  RESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQ 91
           R +T+   +   + ++  GN    IKF  +D  G  + + L   Y+   N  + + D   
Sbjct: 6   RLATLQPTWHPTSEELAIGN----IKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAAD 61

Query: 92  PDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           P+ L++A+  +  L N    +++   ++GNK+D
Sbjct: 62  PERLNEARVELDALFNIAELKDVPFVILGNKID 94

>YAL048C (YAL048C) [19] chr1 complement(52804..54792) Protein
           involved in the secretory pathway, has weak similarity
           to GTP-binding proteins of the RAS superfamily [1989 bp,
           662 aa]
          Length = 662

 Score = 34.7 bits (78), Expect = 0.043,   Method: Composition-based stats.
 Identities = 36/169 (21%), Positives = 78/169 (46%), Gaps = 11/169 (6%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           F   ++G    GKSS++  F+  +F E    TI       ++++K G +  +I  E+   
Sbjct: 449 FNCFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQYYLILQEL--- 505

Query: 64  AGQERYKSLAPM-YYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNK 122
            G++ Y  L      +  +   + YD + P+S S   S + +  +    ++L +  V +K
Sbjct: 506 -GEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL---QDLPLVFVASK 561

Query: 123 VDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEIGE 171
            D+ +  +   +I+ +E A+       L   +S++  + + ++F +I E
Sbjct: 562 ADL-DKQQQRCQIQPDELADELFVNHPL--HISSRWLSSLNELFIKITE 607

>AGL261W [4051] [Homologous to ScYPL051W (ARL3) - SH]
           complement(218211..218807) [597 bp, 198 aa]
          Length = 198

 Score = 34.3 bits (77), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 3   QFKLVLLGDSSVGKSSIVHRF--VKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEI 60
            + +++LG  + GK++ + +   V   + +  E  +    + Q V     ++  ++KF  
Sbjct: 17  HYSVLILGLDNAGKTTFLEQLKAVYHLYAKPLEKIVPT--VGQNVATVPLDKTTLLKF-- 72

Query: 61  WDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVG 120
           WD  GQE  +++   YY   +  + + D T  + L +    ++ +    G E + I ++ 
Sbjct: 73  WDVGGQEALRAMWSEYYVQTHGIIFIIDSTDRERLQECCDSLRSIVTDDGVEGVPILMLA 132

Query: 121 NKVD 124
           NK D
Sbjct: 133 NKQD 136

>KLLA0A03465g complement(314573..316552) similar to sp|P39722
           Saccharomyces cerevisiae YAL048c vacuolar aspartic
           proteasse singleton, start by similarity
          Length = 659

 Score = 34.7 bits (78), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 61/146 (41%), Gaps = 30/146 (20%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFVKDTF-----DELRESTIGAAFLS------QTVKIKDGN 51
           + ++V+ GDS VGK+S++   VKD F     D L   TI   F S       TV +  GN
Sbjct: 5   RIRIVVCGDSGVGKTSLIACLVKDQFISWLQDVLPPITIPKDFSSSRYSPENTVVVDTGN 64

Query: 52  EDVVIKFE-------IW----DTAGQERYKSLAPMYYRNANAAL-VVYDVTQPDS----L 95
            D+    +       IW    D    ER      M +R+    L VV    + D     L
Sbjct: 65  SDLATLHKELKNADVIWLVYSDHDSYERIALYWMMMFRSLGVNLPVVLCRNKCDDEVEFL 124

Query: 96  SKAQ---SWVQELQNKVGDEELVIYL 118
           S A    S   +L NK+ DEE +  L
Sbjct: 125 SSANIMDSDDDQLDNKIEDEEFIPIL 150

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 10/120 (8%)

Query: 8   LLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIW--DTAG 65
           +LG  + GKSS++  F+  +F E    TI       ++++K G +  +I  E+   +T  
Sbjct: 451 MLGKGNSGKSSLLESFLGRSFSEAYSPTIRPKISVNSLELKGGKQYYLILQELGEQETPI 510

Query: 66  QERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDI 125
            E    L        +   + YD + P+S S   S + +       +EL I  V  K D+
Sbjct: 511 LENKGKL-----DECDVLCLCYDSSDPESFSYIVSLIDKFDYL---KELPIVFVALKADL 562

>KLLA0F02662g 241804..242565 some similarities with sp|Q8VEH3 Mus
           musculus Hypothetical 21.4 kDa protein, hypothetical
           start
          Length = 253

 Score = 33.9 bits (76), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 3   QFKLVLLGDSSVGKSSIVH-----RFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIK 57
           Q  + ++G  + GK++  +      FV DT       T+G       V IKD        
Sbjct: 23  QLSIAVVGLQNSGKTTFTNLIAGEEFVVDTI-----PTLG-------VNIKDVKLPNHTN 70

Query: 58  FEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIY 117
            +++D AGQ R++ L    ++  +  + + D++   +  +A++ + ++      E + I 
Sbjct: 71  LKVYDLAGQTRFQKLWDRCFQQVDLLVFMIDLSDLTNWEQAKNKLHDVIIATNLEHVPIL 130

Query: 118 LVGNKVDIV 126
           ++GNKVD++
Sbjct: 131 ILGNKVDLI 139

>Sklu_2411.4 YMR023C, Contig c2411 8898-10388
          Length = 496

 Score = 33.9 bits (76), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 25/177 (14%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDV-VIKFEIWD 62
            KLVLLG  + GKSS+++    D      E++I ++    T    D   DV   K  + D
Sbjct: 248 IKLVLLGPPNAGKSSLLNSLTND------ETSIVSSIPGTTRDSIDVPIDVNGYKVVLCD 301

Query: 63  TAG-------QERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV 115
           TAG       Q   + +     +++ + LVV  V   + L         +++++ D+ ++
Sbjct: 302 TAGIRKNSSDQIELQGIRRAKMKSSQSDLVVLLVDASNELYITDDLKDHIKSQLRDKNII 361

Query: 116 IYLVGNKVDIVEAD--ESARK-IETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           I  V NK D+V+    ES R+ ++ E   +Y        K VS     G++D+ QE+
Sbjct: 362 I--VVNKSDLVDVGKIESIRQTLKAEFDGQYP------VKFVSCLNQTGIEDLIQEL 410

>AFL114W [3081] [Homologous to ScYPL218W (SAR1) - SH]
           complement(222754..223326) [573 bp, 190 aa]
          Length = 190

 Score = 32.7 bits (73), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 9/120 (7%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDTA 64
           KL+ LG  + GK++++H    D     R +T+   +   + ++  G+    IKF  +D  
Sbjct: 25  KLLFLGLDNAGKTTLLHMLKND-----RLATLQPTWHPTSEELAIGS----IKFTTFDLG 75

Query: 65  GQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVD 124
           G  + + L   Y+   N  + + D    +  ++A+  +  L      + +   ++GNK+D
Sbjct: 76  GHIQARRLWKDYFPEVNGIVFLVDAADSERFNEARVELDALFQIPELKTVPFVILGNKID 135

>ADR402W [2142] [Homologous to ScYAL048C - SH]
           complement(1426900..1428885) [1986 bp, 661 aa]
          Length = 661

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 45/110 (40%), Gaps = 15/110 (13%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFEIWDT 63
           F   +LG  + GKSS++  F+   F E    TI       ++++K G +  +I  E    
Sbjct: 446 FNCYILGKPNSGKSSLLESFLGRPFSETYSPTIRPKIAVNSLELKGGKQYYLILQEF--- 502

Query: 64  AGQERYKSLAPMYYRN------ANAALVVYDVTQPDSLSKAQSWVQELQN 107
            GQ+      P    N       +   + YD + P+S S   + V   Q+
Sbjct: 503 -GQQE-----PAILENQQKVMECDVLCLAYDSSDPESFSYLVNLVNRYQH 546

 Score = 30.4 bits (67), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 3  QFKLVLLGDSSVGKSSIVHRFVKDTF-----DELRESTIGAAF 40
          + ++V+ GD  VGKSS++   VKD F     D L   TI   F
Sbjct: 5  RIRIVVCGDKGVGKSSLIACLVKDQFIPNLQDALPAVTIPRDF 47

>AEL232C [2274] [Homologous to NOHBY] (196356..197285) [930 bp, 309
           aa]
          Length = 309

 Score = 31.6 bits (70), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 26/131 (19%)

Query: 5   KLVLLGDSSVGKSSIV-----HRFVKDTFDEL----RESTIGAAFLSQTVKIKDGNEDVV 55
           ++ ++G  + GK+++      H F  DT   L    R +TIG   L              
Sbjct: 70  QIAIVGLQNSGKTTLAALLTGHPFRADTIPTLGIDVRHATIGQTLL-------------- 115

Query: 56  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV 115
              +++D AGQ R++ L        +  + V D++   +   A+  +Q +          
Sbjct: 116 ---QVYDLAGQARHRFLWDRCLDTTDLVVYVLDLSDDTAWEAAKHALQSVLVATNARRTP 172

Query: 116 IYLVGNKVDIV 126
           + ++GNK D+V
Sbjct: 173 VLIIGNKADLV 183

>Kwal_47.17857
          Length = 198

 Score = 30.4 bits (67), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 88/195 (45%), Gaps = 20/195 (10%)

Query: 3   QFKLVLLGDSSVGKSSIVHRFV---KDTFDELRESTIGAAFLSQTVKIKDGNEDVVIKFE 59
           + + ++LG  + GKS++V   +   K    +L   T+G  F   T+  ++ N       +
Sbjct: 16  EIRCLVLGLDNSGKSTVVDWILSVYKKRPRQLITPTVG--FQIHTIPFQNHN------VQ 67

Query: 60  IWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQE-LQN--KVGDEELVI 116
           +WD  GQ   +     Y+   +  + V D      L ++   ++  LQN  ++G    ++
Sbjct: 68  LWDIGGQSTLRPYWDNYFDKTDVLMWVIDAAAAQRLEESIGELKVILQNRDRLGYGCKIV 127

Query: 117 YLVGNKVDIVEADESARKIETEEGAEYAQAQ--KLLFKEVSAKTGAGVKDIFQEIGEQLY 174
            L+ NK D++   ES      EE ++  + +   +  K  +A +G G+  +   I E+  
Sbjct: 128 VLL-NKTDLIPDLESITAKLKEELSDILKLETVPIEIKSTNALSGQGLDSLLPAIVEK-- 184

Query: 175 STKKASLKNKDQSRR 189
             K+ S  ++D +++
Sbjct: 185 -AKRLSSPDQDYTKQ 198

>AFR359C [3551] [Homologous to ScYEL038W (UTR4) - SH]
           (1089133..1089855) [723 bp, 240 aa]
          Length = 240

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 50/120 (41%), Gaps = 25/120 (20%)

Query: 59  EIWDTAGQERYKSLAPMYYRNANAA-------LVVYDVTQPDSLSKAQSWVQELQNKVGD 111
           E+ + A +     LA M  R+  AA       LV  DV  P         ++ LQ +V +
Sbjct: 50  ELINNADETERDLLADMQSRHGGAAAASLLRQLVAEDVKDP--------ALKALQGRVWE 101

Query: 112 EELVIYLVGNKVDIVEADESARKIETEEGAEY------AQAQKLLFKEVSAKTGAGVKDI 165
                Y  G     V AD + R I+   G  Y       QAQ+LLF  VS  +G GV D+
Sbjct: 102 RG---YASGEITAPVYAD-AVRFIQRNAGRVYIYSSGSVQAQRLLFGHVSNPSGDGVLDL 157

>Scas_692.9
          Length = 309

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 14/144 (9%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVV--IKFEIWD 62
           KL+L+G S  GKSS+    +   +       +GA     T+ ++  +   +  +   +WD
Sbjct: 14  KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 67

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL-QNKVGDEELVI 116
             GQ+      +       ++     + V+DV   D +   + + + L Q K    E  I
Sbjct: 68  CGGQDVFMENYFTKQKDHIFQMVQVLIHVFDVESTDVIKDIEIFTRALKQLKKYSPEAKI 127

Query: 117 YLVGNKVDIVEADESARKIETEEG 140
           +++ +K+D+V+ D+     E   G
Sbjct: 128 FVLLHKMDLVQLDKRNDLFEIMMG 151

>KLLA0E12837g 1135181..1135780 similar to sgd|S0005972 Saccharomyces
           cerevisiae YPL051w ARL3 ADP-ribosylation factor-like
           protein, member of the arf-sar family in the ras
           superfamily, start by similarity
          Length = 199

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%)

Query: 59  EIW---DTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQ----NKVGD 111
            IW   D +GQE ++ L   Y+   N   +VY V   DS  + Q  + ELQ    N    
Sbjct: 68  HIWKIIDVSGQESFRYLWDSYFNKDNIHGIVYMVDTSDS-DRLQESINELQARYVNTPAA 126

Query: 112 EELVIYLVGNKVD 124
            ++ I +V NK D
Sbjct: 127 VDIPIAVVLNKTD 139

>Scas_698.27
          Length = 701

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 23/106 (21%)

Query: 4   FKLVLLGDSSVGKSSIVHRFVKDT----FDELR-------ESTIGA--AFLSQTVKIK-- 48
              V+LG+ S GKS+I+ R ++D+     DE+R       +S + A   +LS+ ++ K  
Sbjct: 271 LNFVMLGNESAGKSTIIGRLLEDSGLVRIDEIRSVKKELEKSKLNAEMLYLSKLMEKKMS 330

Query: 49  -----DGNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDV 89
                D N   V +F  +D  G  ++ S +    R    A++  D 
Sbjct: 331 STFSLDKN---VSEFSAFDIPGDLKHLSSSIKAIRQCTTAILTIDC 373

>KLLA0E07634g 688734..690239 similar to sp|P32559 Saccharomyces
           cerevisiae YMR023c MSS1 mitochondrial GTPase involved in
           expression of COX1 singleton, start by similarity
          Length = 501

 Score = 29.6 bits (65), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 79/179 (44%), Gaps = 33/179 (18%)

Query: 5   KLVLLGDSSVGKSSIVHRF--------------VKDTFDELRESTIGAAFLSQTVKIKDG 50
           KL LLG+ + GKSS+V+                 +D+ D + +       L+ T  I+ G
Sbjct: 258 KLTLLGEPNSGKSSLVNEISQDDVAIVSDIPGTTRDSIDVMMDINGFKCILTDTAGIRQG 317

Query: 51  NEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVG 110
             D +      +  G +R K  +      ++  ++V DV+ P+    ++ + + +++ + 
Sbjct: 318 TSDSI------EIKGIDRSKKKS----LQSDLVVLVIDVSNPNI---SKHFEEFIKDNLS 364

Query: 111 DEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGAGVKDIFQEI 169
           D+ L++ L  NK D+    +    IE  +    A+ + L    VS  T  G++ + + +
Sbjct: 365 DKPLIVVL--NKSDLATETQLKYLIEKFD----AEFKALKIHTVSCLTKIGLEPLVKTL 417

>KLLA0E11638g 1028781..1029998 some similarities with sp|P01120
           Saccharomyces cerevisiae YNL098c RAS2 GTP-binding
           protein, hypothetical start
          Length = 405

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 69  YKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDIVEA 128
           Y  L  +    A+  ++ YD T P +L+   +    +  ++  +++ I + G K+D +  
Sbjct: 139 YSDLRHLQVNQADGFILCYDTTNPATLAD-MTLYHRIITRIKGDDVPIIVCGTKIDCI-- 195

Query: 129 DESARKIETEE 139
             S RK+  +E
Sbjct: 196 --SERKVSEDE 204

>KLLA0C06358g complement(563583..564482) highly similar to sp|Q00582
           Saccharomyces cerevisiae YML121w GTR1 GTP-binding
           protein singleton, start by similarity
          Length = 299

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 22/155 (14%)

Query: 5   KLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTVKIKDGNEDVV--IKFEIWD 62
           KL+L+G S  GKSS+    +   +       +GA     T+ ++  +   +  +   +WD
Sbjct: 8   KLLLMGRSGSGKSSM-RSIIFSNYSAFDTRRLGA-----TIDVEHSHLRFLGNMTLNLWD 61

Query: 63  TAGQE-----RYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQEL-QNKVGDEELVI 116
             GQ+      +       ++     + V+DV   D L     + + L Q K    +  I
Sbjct: 62  CGGQDVFMENYFTQQKDHIFQMVQVLIHVFDVESKDVLKDVDIFTRALKQLKKYSPDAKI 121

Query: 117 YLVGNKVDIVEADESA-------RKIETEEGAEYA 144
           +++ +K+D+V+ D+         RK++ +  AEY 
Sbjct: 122 FVLVHKMDLVQLDKRTELFDIMMRKLK-QASAEYG 155

>Scas_721.90
          Length = 397

 Score = 28.9 bits (63), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 10/44 (22%), Positives = 24/44 (54%)

Query: 2  LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQTV 45
          +QF L+LLG++ +GK++ ++       +   ++ +    LS  +
Sbjct: 27 IQFNLLLLGETGIGKTTFLNNLCNQVIENDNDTQVNVNPLSNNI 70

>Scas_690.10
          Length = 801

 Score = 28.9 bits (63), Expect = 3.6,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 44/114 (38%), Gaps = 19/114 (16%)

Query: 91  QPDSLSKAQSWVQELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLL 150
           + D ++K   W   L   + D+E +IY         E DE+   IE + GA+YA      
Sbjct: 326 KTDGVNKVTEWANLLAETLKDDEPIIY---------EYDETC-DIEEDAGADYAS----- 370

Query: 151 FKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDIQTQR 204
                     G+ D+    G++  S K ++     Q    DS +   +  Q  R
Sbjct: 371 ----DGSDDEGLADVEDLAGKEATSKKNSNSMETKQMVSKDSPTYRNLTKQGYR 420

>CAGL0L13090g 1395504..1397750 some similarities with sp|P38830
           Saccharomyces cerevisiae YHR124w meiosis-specific
           protein, hypothetical start
          Length = 748

 Score = 28.5 bits (62), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 141 AEYAQAQKLLFKEVSAKTGAGVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDI 200
           A Y+  +K++F EVS+ T        + +G  + S K  S + +   R+  + S N    
Sbjct: 367 ANYSPPKKIIFDEVSSPTNGSSPSPVKNVG--IISIKNRSRQKEQNKRKRGNASLNNNYN 424

Query: 201 QTQRPS 206
             QRP+
Sbjct: 425 NCQRPA 430

>CAGL0K06369g 624706..625698 highly similar to tr|Q03290
           Saccharomyces cerevisiae YDR460w TFB3, hypothetical
           start
          Length = 330

 Score = 27.3 bits (59), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 11/81 (13%)

Query: 56  IKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWVQELQNKVGDEELV 115
            K +I+D  G E+   +    +   N  L  +D    + L     +++E+++       +
Sbjct: 78  FKTQIFDDVGVEKEVDIRKRVFNVFNKTLEDFD----NDLEAYNKYLEEVED-------I 126

Query: 116 IYLVGNKVDIVEADESARKIE 136
           +Y + NK+D+VE +E  R  E
Sbjct: 127 VYKLDNKIDVVETEEKLRTYE 147

>Scas_721.8
          Length = 329

 Score = 27.3 bits (59), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 112 EELVIYLVGNKVDIVEADESARKIETEEGAEYA-QAQKLLFKEVSAK 157
           E+ + Y +GN +D+++ DE+   ++ E G          L KE+SA+
Sbjct: 130 EKSIPYAIGNAIDMMKLDENVTSVKLEVGLHTKDHYTPQLIKELSAR 176

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.127    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,594,883
Number of extensions: 266809
Number of successful extensions: 1467
Number of sequences better than 10.0: 249
Number of HSP's gapped: 1234
Number of HSP's successfully gapped: 254
Length of query: 212
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 115
Effective length of database: 13,238,163
Effective search space: 1522388745
Effective search space used: 1522388745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)