Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G07667g2582548781e-120
Scas_675.272901416012e-77
YKR013W (PRY2)3291355922e-75
KLLA0D02442g3681345933e-75
Scas_711.372671425592e-71
Kwal_14.24103731365612e-70
YJL079C (PRY1)2991305388e-68
YJL078C (PRY3)8811355518e-65
AAL179W3601395142e-63
Sklu_956.13191255051e-62
CAGL0F05137g2271424405e-54
Kwal_14.24092381344285e-52
AAL178W2051344134e-50
KLLA0D02420g2121354004e-48
KLLA0C01496g4561383092e-32
AFR700W4341432671e-26
Kwal_33.131927991432505e-24
Sklu_2422.936325643.1
CAGL0M05225g38147616.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G07667g
         (254 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   342   e-120
Scas_675.27                                                           236   2e-77
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   232   2e-75
KLLA0D02442g complement(207613..208719) some similarities with s...   233   3e-75
Scas_711.37                                                           219   2e-71
Kwal_14.2410                                                          220   2e-70
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   211   8e-68
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   216   8e-65
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   202   2e-63
Sklu_956.1 YJL079C, Contig c956 998-1957                              199   1e-62
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   174   5e-54
Kwal_14.2409                                                          169   5e-52
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   163   4e-50
KLLA0D02420g complement(206544..207182) some similarities with s...   158   4e-48
KLLA0C01496g complement(113533..114903) some similarities with s...   123   2e-32
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   107   1e-26
Kwal_33.13192                                                         100   5e-24
Sklu_2422.9 YNL229C, Contig c2422 18673-19764 reverse complement       29   3.1  
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    28   6.8  

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  342 bits (878), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 176/254 (69%)

Query: 1   MKLSIXXXXXXXXXXXXXXXXXXXXXXXXXXDVKTVRGVVYVQGGETKTSYTTLDDSTPT 60
           MKLSI                          DVKTVRGVVYVQGGETKTSYTTLDDSTPT
Sbjct: 1   MKLSIPLLSLAATSVLAAPAVVTVTEVAHEHDVKTVRGVVYVQGGETKTSYTTLDDSTPT 60

Query: 61  SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNLSD 120
           S                                                    QDSNLSD
Sbjct: 61  SVAEPVQENQVQNNAQAPAPSSSSSPTPAPAPAASPSSSSPAAASPSPSPSPAQDSNLSD 120

Query: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180
           FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY
Sbjct: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180

Query: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240
           SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY
Sbjct: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240

Query: 241 DPAGNFLGEFAQNV 254
           DPAGNFLGEFAQNV
Sbjct: 241 DPAGNFLGEFAQNV 254

>Scas_675.27
          Length = 290

 Score =  236 bits (601), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 107/141 (75%), Positives = 123/141 (87%), Gaps = 1/141 (0%)

Query: 115 DSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGE 174
           DSNLS+FA S+LNEHN KRALHQ+T  L+WSD+LA YAQNYA+ YDCSGNLVHSGGPYGE
Sbjct: 146 DSNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYADAYDCSGNLVHSGGPYGE 205

Query: 175 NLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGV-WG 233
           NLA+GY  VGSVDAWY+EI  Y+Y+NPGFSE+ GHFTQVVWKSST+VGC +K C    WG
Sbjct: 206 NLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWG 265

Query: 234 DYVICSYDPAGNFLGEFAQNV 254
            YVICSY+PAGNF+GEFA+NV
Sbjct: 266 SYVICSYNPAGNFIGEFAENV 286

 Score = 29.3 bits (64), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%)

Query: 35 TVRGVVYVQGGETKTSYTTL 54
          TVR +VYV+ G+T+T  TTL
Sbjct: 33 TVRAIVYVKDGQTQTDLTTL 52

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  232 bits (592), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 101/135 (74%), Positives = 116/135 (85%)

Query: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179
           DF+ SM+NEHN KRALH+DT  LTWSD LA YAQNYA++YDCSGNLVHSGGPYGENLA+G
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALG 250

Query: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239
           Y   GSVDAWY+EI  Y+Y+NPGFSES GHFTQVVWK +++VGC +KSCGG WGDY+ICS
Sbjct: 251 YGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICS 310

Query: 240 YDPAGNFLGEFAQNV 254
           Y  AGN +GEFA NV
Sbjct: 311 YKAAGNVIGEFADNV 325

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  233 bits (593), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 103/134 (76%), Positives = 117/134 (87%)

Query: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180
           FA SML+EHN KRALH+DT  L+WSDELA YAQNYA++YDCSG+L HSGGPYGENLAIGY
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADDYDCSGSLTHSGGPYGENLAIGY 290

Query: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240
              G+VDAWY EIKDY+++NP +S STGHFTQVVWKS+TKVGC +K CGGVWGDY+ICSY
Sbjct: 291 GTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICSY 350

Query: 241 DPAGNFLGEFAQNV 254
           DPAGN LG FA NV
Sbjct: 351 DPAGNMLGTFASNV 364

>Scas_711.37
          Length = 267

 Score =  219 bits (559), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (84%), Gaps = 1/142 (0%)

Query: 114 QDSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANN-YDCSGNLVHSGGPY 172
           Q ++LSDF  S+L EHN KRALH++T PLTWS+ELAQYAQ YA+N Y+C G L+HSGGPY
Sbjct: 121 QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPY 180

Query: 173 GENLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVW 232
           GENLA GY+ +GSVDAWY+EI +Y+Y+NPGFSESTGHFTQ+VWK +++VGCA+KSC   W
Sbjct: 181 GENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAW 240

Query: 233 GDYVICSYDPAGNFLGEFAQNV 254
           G Y+ICSY+ AGNF GE+  NV
Sbjct: 241 GTYLICSYNSAGNFDGEYEANV 262

>Kwal_14.2410
          Length = 373

 Score =  220 bits (561), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%)

Query: 119 SDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAI 178
           SDFA ++L  HN KR+LH+DT+ L+WSDELA YAQ+YA+ YDCSG+L HSGGPYGENLA+
Sbjct: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADKYDCSGSLSHSGGPYGENLAV 293

Query: 179 GYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVIC 238
           GYS  GSVDAWY EIKDY+++NP +S STGHFTQVVWK S+ +GC +KSCGG  GDYVIC
Sbjct: 294 GYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVIC 353

Query: 239 SYDPAGNFLGEFAQNV 254
           SY  AGNFLGEFA+NV
Sbjct: 354 SYKTAGNFLGEFAENV 369

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  211 bits (538), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 93/130 (71%), Positives = 112/130 (86%)

Query: 125 MLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGYSPVG 184
           +L EHN KRALH+DT  L+WSD LA YAQ+YA+NYDCSG L HSGGPYGENLA+GY    
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGYDGPA 225

Query: 185 SVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSYDPAG 244
           +VDAWY+EI +Y+++NPGFS +TGHFTQVVWKS+T+VGC +K+CGG WGDYVICSYDPAG
Sbjct: 226 AVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAG 285

Query: 245 NFLGEFAQNV 254
           N+ GE+A NV
Sbjct: 286 NYEGEYADNV 295

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  216 bits (551), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 92/135 (68%), Positives = 108/135 (80%)

Query: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179
           +F   +LNEHN  RALH DT PLTWSD LA YAQNYA+ YDCSG L HS GPYGENLA+G
Sbjct: 24  NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPYGENLALG 83

Query: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239
           Y+  G+VDAWY EI  YNY+NPGFSESTGHFTQVVWKS+ ++GC  K CG  W +Y++CS
Sbjct: 84  YTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCS 143

Query: 240 YDPAGNFLGEFAQNV 254
           Y+P GN+LGEFA+ V
Sbjct: 144 YNPPGNYLGEFAEEV 158

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  202 bits (514), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 87/139 (62%), Positives = 110/139 (79%), Gaps = 1/139 (0%)

Query: 117 NLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENL 176
           N + F + +L  HN +R LH+DT PLTWS+ELA++A+++AN YDCSG LVHS  PYGENL
Sbjct: 218 NGASFEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFANQYDCSGRLVHSDSPYGENL 277

Query: 177 AIGY-SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDY 235
           A+GY +P  +V AWYDEI DY+Y++P FS STGHF+Q+VWK +  +GCAVK CGG  GDY
Sbjct: 278 AVGYPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDY 337

Query: 236 VICSYDPAGNFLGEFAQNV 254
           +ICSYDPAGNFL  F +NV
Sbjct: 338 LICSYDPAGNFLRRFGENV 356

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  199 bits (505), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 86/125 (68%), Positives = 106/125 (84%)

Query: 117 NLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENL 176
           +LSDFA S+L+EHN KRALH+DT+ LTWS+ LA YAQ YA++YDCSG+L HSGGPYGENL
Sbjct: 168 DLSDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADSYDCSGSLTHSGGPYGENL 227

Query: 177 AIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYV 236
           A+GYS  G+VDAWY EI  Y+++NP +S STGHFTQVVWKS+++VGC +KSC   WG YV
Sbjct: 228 ALGYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSYV 287

Query: 237 ICSYD 241
           ICSY+
Sbjct: 288 ICSYN 292

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  174 bits (440), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 104/142 (73%), Gaps = 3/142 (2%)

Query: 116 SNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGG---PY 172
           SNLS++ + ML++HN KR LH+DT+ L W+D LA  AQ+YA+ YDCSGNL H+       
Sbjct: 82  SNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAI 141

Query: 173 GENLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVW 232
           GENLA+GY  + ++DAWYDEI+ Y+Y+NP     T HFTQ+VWK +  VGCA K+CGG  
Sbjct: 142 GENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDL 201

Query: 233 GDYVICSYDPAGNFLGEFAQNV 254
            +Y++C YDPAGN+ GEFA NV
Sbjct: 202 YNYIVCEYDPAGNWAGEFADNV 223

>Kwal_14.2409
          Length = 238

 Score =  169 bits (428), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 92/134 (68%), Gaps = 1/134 (0%)

Query: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180
           F   ML  HN  R LH D   L WS +L  +AQ YANNY+C+G L+HSG PYGENLA+G+
Sbjct: 103 FQSQMLETHNRFRDLH-DAPALRWSSDLQDFAQKYANNYNCNGTLIHSGSPYGENLALGF 161

Query: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240
           +   +  AWYDE+K YNY  PGFSE TGHFTQ+VWKSS  +GCA   CG  +G Y ICSY
Sbjct: 162 NTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICSY 221

Query: 241 DPAGNFLGEFAQNV 254
           DP GN  G++  NV
Sbjct: 222 DPPGNVAGQYQDNV 235

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  163 bits (413), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 72/134 (53%), Positives = 95/134 (70%), Gaps = 1/134 (0%)

Query: 121 FAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIGY 180
           FA ++L+ HN  R  H    PL W+  L  +AQ+YAN   C+G+LVHSG P+GENLA+GY
Sbjct: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYANRILCNGSLVHSGLPHGENLALGY 129

Query: 181 SPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICSY 240
           SP  +V AWYDEI +Y+++ PGFS +TGHFTQ+VW+S+T VGCA   CG  +G Y+IC Y
Sbjct: 130 SPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQY 189

Query: 241 DPAGNFLGEFAQNV 254
           DP GN   ++  NV
Sbjct: 190 DPPGNVADQYVANV 203

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  158 bits (400), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 97/135 (71%), Gaps = 1/135 (0%)

Query: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYDCSGNLVHSGGPYGENLAIG 179
           DF   +L+ HN  R  HQ  + L W+ ELA  AQN+AN+Y C+G L HS  PYGENLA+G
Sbjct: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFANSYVCNGQLEHSKLPYGENLALG 133

Query: 180 YSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAVKSCGGVWGDYVICS 239
           Y+   +V AWY+E+K Y++ NP F+ +TGHFTQ+VWK+++K+GCA   CG  +G Y +C 
Sbjct: 134 YNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVCE 193

Query: 240 YDPAGNFLGEFAQNV 254
           YDP GN +G+F++NV
Sbjct: 194 YDPPGNVIGKFSENV 208

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 86/138 (62%), Gaps = 17/138 (12%)

Query: 123 KSMLNEHNIKRALHQDTNPLTWSDELAQYAQNY------ANNYDCSGNLVHSGGPYGENL 176
           +S+LN HN  RA HQ TNPL W++ELA YA +Y      ++N  C+  L HSGGPYGENL
Sbjct: 299 ESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGENL 358

Query: 177 AIGYS--PVGSVDAWYDEIKDYNYAN-PGFSES---TGHFTQVVWKSSTKVGCAVKSC-- 228
           A G +  P   V  WYDEI  Y+Y N  G S +    GHFTQ+VW +ST VGC+V  C  
Sbjct: 359 AAGTNSDPAALVGLWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVTKCSS 418

Query: 229 GGVWGDYVICSYDPAGNF 246
           G V   Y+IC Y PAGN 
Sbjct: 419 GSV---YLICEYSPAGNV 433

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  107 bits (267), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 82/143 (57%), Gaps = 16/143 (11%)

Query: 120 DFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNY------DCSGNLVHSGGPYG 173
           + A  ++  HN KR LH+DT PL W+++L+ +A +Y +         C+  L HS GPYG
Sbjct: 269 NVASELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYG 328

Query: 174 ENLAIGYSPVGS-----VDAWYDEIKDYNYANPG----FSESTGHFTQVVWKSSTKVGCA 224
           EN+A G S         V++WY+EI+DY+Y +        ++ GHFTQ+VW  S +VGCA
Sbjct: 329 ENIASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCA 388

Query: 225 VKSCGGV-WGDYVICSYDPAGNF 246
           V  C     G Y++C Y P GN 
Sbjct: 389 VVYCSNNGKGIYILCEYHPVGNI 411

>Kwal_33.13192
          Length = 799

 Score =  100 bits (250), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 81/143 (56%), Gaps = 19/143 (13%)

Query: 122 AKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYD------CSGNLVHSGGP--YG 173
           A ++L EHN+KR+LH +T  L W D L+ +A NYAN+        CSG L HS      G
Sbjct: 632 ASAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQG 691

Query: 174 ENLAIGYS--PVGSVDAWYDEIKDYNYAN-PGF---SESTGHFTQVVWKSSTKVGCAVKS 227
           EN+A G +  P   VD WYDEI DY+Y +  G     +  GHFTQ+VW S+ KVGCAV  
Sbjct: 692 ENIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQ 751

Query: 228 CG-----GVWGDYVICSYDPAGN 245
           C      G    Y++C Y  AGN
Sbjct: 752 CDTMAKYGQNSIYLLCEYKDAGN 774

>Sklu_2422.9 YNL229C, Contig c2422 18673-19764 reverse complement
          Length = 363

 Score = 29.3 bits (64), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 129 HNIKRALHQDTNPLTWSDELAQYAQ 153
           H + + L +  NPL WSD LA+ AQ
Sbjct: 196 HLVNKYLRETGNPLLWSDNLAEQAQ 220

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 28.1 bits (61), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 153 QNYANNYDCSGNLVHSGGPYGENLAIGYSPVGSVDA---W--YDEIK 194
           + Y N+YDC  +++ + G YG    +  S +GSV+    W  Y+++K
Sbjct: 216 RTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLYEQLK 262

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.131    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,458,355
Number of extensions: 245254
Number of successful extensions: 460
Number of sequences better than 10.0: 25
Number of HSP's gapped: 445
Number of HSP's successfully gapped: 28
Length of query: 254
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 155
Effective length of database: 13,168,927
Effective search space: 2041183685
Effective search space used: 2041183685
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)