Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0G07557g24123812561e-178
YOR295W (UAF30)2282032533e-26
YMR233W2262272113e-20
ABL015C2202032104e-20
KLLA0B13024g1241001922e-18
Sklu_1837.2161881872e-17
CAGL0M04939g2332071764e-15
Kwal_55.2030878551639e-15
Scas_665.262491861157e-07
Scas_324.110368840.002
CAGL0J03916g433129720.31
YCR052W (RSC6)48362710.43
CAGL0M10659g57362700.57
KLLA0F24156g94069661.9
Kwal_14.167059974633.8
Sklu_1414.126845615.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0G07557g
         (238 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces c...   488   e-178
YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the U...   102   3e-26
YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containi...    86   3e-20
ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W (U...    86   4e-20
KLLA0B13024g complement(1138572..1138946) some similarities with...    79   2e-18
Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement         77   2e-17
CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces c...    72   4e-15
Kwal_55.20308                                                          67   9e-15
Scas_665.26                                                            49   7e-07
Scas_324.1                                                             37   0.002
CAGL0J03916g 370513..371814 similar to sp|P35844 Saccharomyces c...    32   0.31 
YCR052W (RSC6) [583] chr3 (214989..216440) Component of abundant...    32   0.43 
CAGL0M10659g 1066944..1068665 similar to sp|P53628 Saccharomyces...    32   0.57 
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...    30   1.9  
Kwal_14.1670                                                           29   3.8  
Sklu_1414.1 YCR068W, Contig c1414 105-911                              28   5.8  

>CAGL0G07557g 715354..716079 similar to tr|Q08747 Saccharomyces
           cerevisiae YOR295w, hypothetical start
          Length = 241

 Score =  488 bits (1256), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/238 (100%), Positives = 238/238 (100%)

Query: 1   MAPQYISEEYESMIDAVLTYCDEEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAF 60
           MAPQYISEEYESMIDAVLTYCDEEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAF
Sbjct: 1   MAPQYISEEYESMIDAVLTYCDEEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAF 60

Query: 61  KNVTEKPKVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSK 120
           KNVTEKPKVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSK
Sbjct: 61  KNVTEKPKVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSK 120

Query: 121 KSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVL 180
           KSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVL
Sbjct: 121 KSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVL 180

Query: 181 GKTSDIFMMHRALKHHILGPAPIEAEVIRTDQESTPSLASESSEQEHADSTDTSDSVY 238
           GKTSDIFMMHRALKHHILGPAPIEAEVIRTDQESTPSLASESSEQEHADSTDTSDSVY
Sbjct: 181 GKTSDIFMMHRALKHHILGPAPIEAEVIRTDQESTPSLASESSEQEHADSTDTSDSVY 238

>YOR295W (UAF30) [5079] chr15 (869205..869891) Component of the
           Upstream Activation Factor (UAF) complex, involved in
           activation of RNA polymerase I [687 bp, 228 aa]
          Length = 228

 Score =  102 bits (253), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 117/203 (57%), Gaps = 17/203 (8%)

Query: 9   EYESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKP 67
           +Y +MID +L+  D E V+   +R  L EV++++++S    +  L+ K L+  K   E+P
Sbjct: 6   DYSTMIDILLSDMDLETVTTKKVRMALKEVYAIDVESQGKAINKLIRKHLDLVK---ERP 62

Query: 68  KVKDISTDKVMTENR-------RYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSK 120
           +  + S + ++ EN        + I V K++  E +   E    T V+K K     T SK
Sbjct: 63  RF-ERSLEDLLKENATLAIELTKEITVSKRSSGEEKNDSE-TKGTHVEKKK----GTVSK 116

Query: 121 KSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVL 180
             +   K+T++  L +++G H  +RTE+VR LW YIK HNLQNP++K++I+ D  LE +L
Sbjct: 117 SPISTRKVTLSKSLASLLGEHELTRTEVVRRLWAYIKAHNLQNPNNKKEILCDEKLELIL 176

Query: 181 GKTSDIFMMHRALKHHILGPAPI 203
           GK++++F MH+ L  H+  P  I
Sbjct: 177 GKSTNMFEMHKILASHMTEPKKI 199

>YMR233W (YMR233W) [4189] chr13 (739184..739864) Protein containing
           a BAF60b domain of the SWIB complex, has moderate
           similarity to S. cerevisiae Uaf30p, which is a component
           of the Upstream Activation Factor (UAF) complex and is
           involved in activation of RNA polymerase I [681 bp, 226
           aa]
          Length = 226

 Score = 85.9 bits (211), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 116/227 (51%), Gaps = 23/227 (10%)

Query: 10  YESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKK-LEAFKNVTEKP 67
           Y  M+DA+L+  + +E+S   +R  L  ++S+N+ S     R L+++  LE F ++ E P
Sbjct: 7   YIPMVDAILSVSNPDEISPKRVRKALQILYSVNLDS----QRKLINELILERFGDIQENP 62

Query: 68  KVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSKKSMIHI- 126
           +V     D +  +    + + K+  +E  L+       K +    + K  N       I 
Sbjct: 63  RVLIPKNDLISRDQELSLRLQKE--EERPLRSTRKRKGKSESKSKRKKKKNDSPDSNSIS 120

Query: 127 --KMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTS 184
             K+ ++  LQ  +G+    RT++V+ +W+YIKEH+LQNP D+R+I+ D  +EP+ GK  
Sbjct: 121 VRKVLLSAPLQKFLGSEELPRTQVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFGKKM 180

Query: 185 DIFMMHRALKHHILGPAPI-----------EAEVIRTDQESTPSLAS 220
            +F M++ L  H+  P  I           E E I+ + ES P+L+ 
Sbjct: 181 TMFSMNKLLTKHLFNPDEIVKHEEEQKQTPEKE-IKLENESLPNLSG 226

>ABL015C [577] [Homologous to ScYMR233W (TRI1) - SH; ScYOR295W
           (UAF30) - SH] (371210..371872) [663 bp, 220 aa]
          Length = 220

 Score = 85.5 bits (210), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 111/203 (54%), Gaps = 15/203 (7%)

Query: 16  AVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKPKVKDIST 74
           A+L+  D +E+S   +R  L E+F++++     +++ L+   LE F  + ++ + K +S 
Sbjct: 20  AILSVSDPDEISAKRIRKALQELFAVDLDGDKKDIKALI---LERFDLLRDR-QSKVLSQ 75

Query: 75  DK-VMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSKKSMIHIK-MTVTP 132
           ++ V  ++     +++     A+  ++        KP+ K    +   +  H++ + ++ 
Sbjct: 76  EELVQRDSEMAAALVRGDAGRAKRPRK----RDADKPRKKRANQSDNPNSFHMRPVQLSE 131

Query: 133 ELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTSDIFMMHRA 192
            LQ ++G     RT++V+ +W YIK+H LQNPDD+R+I+ DA +EPV GK   +F M++ 
Sbjct: 132 PLQRLLGEEQLPRTQVVKAVWDYIKQHQLQNPDDRREILCDAAMEPVFGKKMTMFSMNKI 191

Query: 193 LKHHILGPAPIEAEVIRTDQEST 215
           L  H+  P     +V  +DQ++ 
Sbjct: 192 LSQHLTNP----KDVSGSDQDAN 210

>KLLA0B13024g complement(1138572..1138946) some similarities with
           sp|Q05024 Saccharomyces cerevisiae YMR233w, hypothetical
           start
          Length = 124

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 64/100 (64%), Gaps = 2/100 (2%)

Query: 116 VTNSKKSMIHIK-MTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDA 174
           V N   + IH+K + ++PELQ  +      RT++V+++W YIKEH+LQNP+D+R+II D 
Sbjct: 22  VANDNPNSIHLKKVGLSPELQEFLKVEEMPRTQVVKSVWDYIKEHDLQNPEDRREIICDD 81

Query: 175 MLEPVLGKTSDIFMMHRALKHHILGPAPIEAEVIRTDQES 214
            ++P+ G+   +F +++ L  H+   A  E + I T+Q S
Sbjct: 82  AMKPIFGEKMTMFTLNKILSKHLFNLAKSEKDEI-TEQHS 120

>Sklu_1837.2 YMR233W, Contig c1837 1803-2288 reverse complement
          Length = 161

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 56/88 (63%)

Query: 116 VTNSKKSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAM 175
           V+ +  S+   K+ ++ +L+  +G     RT++V+ +W YIKEH+LQNP+D+R+I+ D  
Sbjct: 41  VSENANSIQARKVLLSKKLEQFLGETELPRTQVVKKVWDYIKEHDLQNPNDRREILCDDA 100

Query: 176 LEPVLGKTSDIFMMHRALKHHILGPAPI 203
           +EP+ GK   +F M++ L  H+  P  +
Sbjct: 101 MEPIFGKKMTMFSMNKILSKHLFNPEDV 128

>CAGL0M04939g 539988..540689 similar to sp|Q05024 Saccharomyces
           cerevisiae YMR233w or tr|Q08747 Saccharomyces cerevisiae
           YOR295w, hypothetical start
          Length = 233

 Score = 72.4 bits (176), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 108/207 (52%), Gaps = 17/207 (8%)

Query: 10  YESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKPK 68
           Y SM+DA+++  D ++VS   +R  L ++FS+++++    +  L+   +  F+ +   P 
Sbjct: 10  YVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLENKKKEVNELI---VARFQILQADPH 66

Query: 69  V----KDISTDKVMTENRRYINVIKQTLKEAEL----KKEGITVTKVQKPKLKL----KV 116
           +    ++    K++  N   +   K   K+ +L    KK  I V K +  K       KV
Sbjct: 67  ILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSKKTRIQVKKKKSKKSSKDGEKKV 126

Query: 117 TNSKKSMIH-IKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAM 175
            N   + I+ +K+ ++ +L   +G     RT++V+ +W YIKEHNLQ+P+D+R+II D  
Sbjct: 127 ANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQVWDYIKEHNLQSPEDRREIICDDR 186

Query: 176 LEPVLGKTSDIFMMHRALKHHILGPAP 202
           + P+ G    +F +++ L  H+    P
Sbjct: 187 MRPIFGDKMTMFALNKILSKHLTKIEP 213

>Kwal_55.20308
          Length = 78

 Score = 67.4 bits (163), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 45/55 (81%)

Query: 144 SRTEIVRNLWKYIKEHNLQNPDDKRQIISDAMLEPVLGKTSDIFMMHRALKHHIL 198
           +RT+IV+ +W++IK++ LQNPDD+R+I  D +++PV G+ + +F ++++L +HIL
Sbjct: 2   ARTQIVKKVWEHIKDNQLQNPDDRREIFCDDLMKPVFGEKTTMFALNKSLSNHIL 56

>Scas_665.26
          Length = 249

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 39/186 (20%)

Query: 10  YESMIDAVL--TYCDEEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKP 67
           Y SMIDA+L  ++ D   ++  LR  L EVF+LNI+    +   ++  ++E ++   ++ 
Sbjct: 18  YISMIDALLNSSFTDNP-TVKELRMDLQEVFALNIEPLRGDFNDIIQSRIEMWQ---QRS 73

Query: 68  KVKDISTDKVMTENRRYINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSKKSMI--- 124
           K+                      + E +L+KE I++ +    KL  + +N+K  +I   
Sbjct: 74  KI---------------------IINEIDLEKENISLLRKFNEKLD-RHSNNKDDIISPR 111

Query: 125 --HIKMTVTPE------LQAVIGTHYQSRTEIVRNLWKYIKEHNLQNPDDKRQIISDAML 176
               K+ V P       L+   G    +++EI+  +W YI+ H L+  ++  +I+ D  L
Sbjct: 112 DKRQKVDVEPTYKISEPLRGFFGETELTKSEIMNRIWDYIELHKLKRSNNSEEILCDDKL 171

Query: 177 EPVLGK 182
             V G+
Sbjct: 172 GLVFGE 177

>Scas_324.1
          Length = 103

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 8  EEYESMIDAVLTYCD-EEVSLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEK 66
          + Y SMIDA+L+  + +EVS   +R  L E+F++++   D   + + D  +E F  + ++
Sbjct: 7  DRYVSMIDAILSASNPDEVSPKKIRRALQELFNVDL---DAQRKAVNDLIIERFNALQDR 63

Query: 67 PKVKDIST 74
          PKVK+ S 
Sbjct: 64 PKVKESSN 71

>CAGL0J03916g 370513..371814 similar to sp|P35844 Saccharomyces
           cerevisiae YPL145c KES1 or sp|P35843 Saccharomyces
           cerevisiae YOR237w HES1, start by similarity
          Length = 433

 Score = 32.3 bits (72), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 11/129 (8%)

Query: 26  SLNSLRAQLNEVFSLNIKSFDLNLRTLVDKKLEAFKNVTEKPKVKDI--STDKVMTENRR 83
             N++++ +++  +LN+K +  NL T+ DK  E +  +     ++ I  ++  V  E + 
Sbjct: 165 GYNNIKSSISKTLTLNVKQYGHNLLTIGDK--ETYLVIPPPLHIEGILMASPFVELEGKS 222

Query: 84  YINVIKQTLKEAELKKEGITVTKVQKPKLKLKVTNSKKSMIHIKMTVTPELQAVIGTHYQ 143
           YI        + E    G      QK   K KV    KS   +K   TP    VI   + 
Sbjct: 223 YIQSTTGMCCQFEYSGRGYFSG--QKNSFKAKVY---KSGADLKNNGTPLY--VISGQWS 275

Query: 144 SRTEIVRNL 152
             ++IV+NL
Sbjct: 276 GSSKIVKNL 284

>YCR052W (RSC6) [583] chr3 (214989..216440) Component of abundant
           RSC complex involved in chromatin remodeling [1452 bp,
           483 aa]
          Length = 483

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%)

Query: 100 EGITVTKVQKPKLKLKVTNSKKSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEH 159
           +GI + +  K  L+  +T   + +   K+  +P L  +IG    S  + V +++KYI  +
Sbjct: 204 DGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLATLIGMQTGSVNDAVYSIYKYILIN 263

Query: 160 NL 161
           NL
Sbjct: 264 NL 265

>CAGL0M10659g 1066944..1068665 similar to sp|P53628 Saccharomyces
           cerevisiae YNR023w, hypothetical start
          Length = 573

 Score = 31.6 bits (70), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 34/62 (54%)

Query: 100 EGITVTKVQKPKLKLKVTNSKKSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEH 159
           +G  + +     L   VT   K++   + + +P L +++G  + S+++ + +L+KYI  +
Sbjct: 283 DGFDIKRNGNTNLDAVVTIYPKAVESNRYSYSPALASLVGLSHGSKSDAIFSLYKYINAN 342

Query: 160 NL 161
           NL
Sbjct: 343 NL 344

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
           cerevisiae YHR120w MSH1 DNA mismatch repair protein,
           mitochondrial, hypothetical start
          Length = 940

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 11/69 (15%)

Query: 138 IGTHYQSRTEIVRNLWKYIKEH------NLQNPDDKRQIISDAMLEPVLGKTSDIFMMHR 191
           +G   Q     +RNL  YI+EH      NL+ P  ++Q+I+D M   +  +TS    +H 
Sbjct: 307 LGNFTQKEIAALRNLLLYIEEHLPDINTNLELP--QKQLITDIM--QIDSRTSTALELHS 362

Query: 192 AL-KHHILG 199
            + KHH  G
Sbjct: 363 TMRKHHKKG 371

>Kwal_14.1670
          Length = 599

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 10/74 (13%)

Query: 151 NLWKYIKEHNLQNPDDKRQIISDAMLEPVL----GKTSDIFMMHRALKHHILGPAPIEAE 206
           +LW ++K +   NP+  R +I D  L+P +     + + ++ +H+ LK  + G      +
Sbjct: 129 SLWDFVKLYAKDNPETVRSLI-DGSLKPTINAQKAQINRVYQLHQHLKQIVEG-----GK 182

Query: 207 VIRTDQESTPSLAS 220
             R D ++  SL S
Sbjct: 183 FTRVDLKALESLLS 196

>Sklu_1414.1 YCR068W, Contig c1414 105-911
          Length = 268

 Score = 28.1 bits (61), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 125 HIKMTVTPELQAVIGTHYQSRTEIVRN---LWKYIKEHNLQNPDD 166
           H ++ VTPE  +  G +YQ    +  +   LW   +++  QNP D
Sbjct: 74  HQRLDVTPEFVSEAGEYYQQHISVFSDEEELWTTNEKYRTQNPFD 118

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,368,577
Number of extensions: 302765
Number of successful extensions: 1335
Number of sequences better than 10.0: 73
Number of HSP's gapped: 1330
Number of HSP's successfully gapped: 74
Length of query: 238
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 139
Effective length of database: 13,168,927
Effective search space: 1830480853
Effective search space used: 1830480853
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)